Senast publicerat 27-11-2021 09:29

Regeringens proposition RP 204/2021 rd Regeringens proposition till riksdagen med förslag till lagar om ändring av lagen om beskattning av vissa gränsöverskridande hybridarrangemang och 9 och 10 § i inkomstskattelagen

PROPOSITIONENS HUVUDSAKLIGA INNEHÅLL

I denna proposition föreslås det att lagen om beskattning av vissa gränsöverskridande hybrid-arrangemang ändras. Ändringarna grundar sig på en direktivändring som gäller så kallade omvända hybrider, det vill säga näringssammanslutningar som i enlighet med en annan jurisdiktions lagstiftning anses vara särskilda skattskyldiga. 

I propositionen föreslås det att lagens tillämpningsområde utsträcks att omfatta situationer där en inkomstandel som härrör från en inhemsk näringssammanslutning inte beskattas i den stat där en sådan begränsat skattskyldig bolagsman som är en annan än en fysisk person, har sin hemvist därför att bolagsmannens hemviststat anser att sammanslutningen är en särskild skattskyldig. En ytterligare förutsättning är att inkomsten inte redan annars beskattas i Finland. Vid granskningen är det möjligt att beakta också indirekta transparenta ägande-strukturer. Det är därmed fråga om en i direktivet avsedd situation som anknyter till ett så kallat omvänt hybridsubjekt. En ytterligare förutsättning är att bolagsmannen ensam eller tillsammans med bolagsmän i intressegemenskap utövar bestämmande inflytande i hybridsubjektet. Avsikten är ändå inte att regleringen ska tillämpas, om det omvända hybridsubjektet är en i lagen om förvaltare av alternativa investeringsfonder avsedd alternativ investeringsfond som har bred ägarbas och innehar en diversifierad värdepappersportfölj. De föreslagna bestämmelserna om omvända hybrider avses bli tillämpade vid beskattningen av begränsat skattskyldiga bolagsmän i öppna bolag och kommanditbolag. 

Till inkomstskattelagen föreslås även bli fogade bestämmelser om skatteplikt för inkomst som förvärvats i Finland, när det är fråga om omvända hybridsubjekt. 

De föreslagna lagarna avses träda i kraft den 1 januari 2022. Lagarna tillämpas första gången vid beskattningen för 2022. 

MOTIVERING

Bakgrund och beredning

1.1  Bakgrund

En EU-rättsakt som förutsätter genomförande har lett till beredningen av propositionen. Inom OECD och EU har man på senare år strävat efter att genom olika åtgärder begränsa aggressiv skatteplanering som företag ägnar sig åt. OECD inledde år 2013 projektet BEPS http://www.oecd.org/tax/beps/. (Base Erosion and Profit Shifting), som har syftet att begränsa den erosion av bolagsskattebasen som följer av aggressiv skatteplanering och av skattekonkurrens mellan stater. Projektets slutrapporter publicerades i september 2015. 

Också i EU har det genomförts flera åtgärder för att motverka aggressiv skatteplanering och skatteflykt. En sådan åtgärd är rådets direktiv (EU) 2016/1164 om fastställande av regler mot skatteflyktsmetoder som direkt inverkar på den inre marknadens funktion, nedan direktivet mot skatteflykt. Vad bestämmelserna om så kallade hybridarrangemang gäller har direktivet ersatts av direktiv (EU) 2017/952 om ändring av direktiv (EU) 2016/1164 vad gäller hybrida missmatchningar med tredjeländer, nedan ändringsdirektivet Särskilt i internationella sammanhang används ofta förkortningen ATAD (Anti-Avoidance Tax Directive) för direktivet mot skatteflykt, och ändringsdirektivet benämns med förkortningen ATAD2.

Genom direktivet mot skatteflykt företogs ett samordnat genomförande i EU av OECD:s rekommendationer 2, 3 och 4 i BEPS-projektet och av vissa andra åtgärder. Bakgrunden till direktivet är kommissionens handlingsplan för en rättvis och effektiv företagsbeskattning COM(2015) 302 final.. Direktivet gäller situationer där skattskyldiga försöker minska sina skatter och agerar i strid med lagens syfte genom att dra nytta av skillnader mellan nationella skattesystem. Genom direktivet mot skatteflykt har flera rekommendationer som ingått i BEPS-projektet genomförts, till exempel rekommendationen om begränsning av rätten till ränteavdrag Genomfördes nationellt genom lag 1237/2018. samt regler om utländska bassamfund Genomfördes nationellt genom lag 1364/2018.. Ändringsdirektivet syftar till ett samordnat genomförande i EU av OECD:s rekommendationer om hybridarrangemang som utarbetats i samband med åtgärd 2 i BEPS-projektet, nedan OECD:s rapport 2015 OECD:s slutrapport från 2015 om neutralisering av effekterna av hybrida missmatchningar, om åtgärd 2 ().

I Finland genomfördes de i ändringsdirektivet förutsatta bestämmelserna huvudsakligen i finsk rätt genom lagen om beskattning av vissa gränsöverskridande hybridarrangemang (1567/2019), nedan hybridlagen, som trädde i kraft den 1 januari 2020. Dessutom ändrades lagen om undanröjande av internationell dubbelbeskattning (1552/1995), lagen om beskattning av inkomst av näringsverksamhet (360/1968), inkomstskattelagen (1535/1992) och inkomstskattelagen för gårdsbruk (543/1967). Då införlivades i finsk rätt emellertid inte artikel 9a i ändringsdirektivet, där det förutsätts att medlemsstaterna föreskriver att omvända hybrida missmatchningar är skattepliktiga så att regleringen gäller nationellt senast den 31 december 2021 och tillämpas från och med den 1 januari 2022. En omvänd hybrid är ett subjekt som betraktas som skattemässigt transparent inom sin registreringsjurisdiktion men som en särskild skattskyldig inom investerarens eller bolagsmannens jurisdiktion. I denna proposition föreslås det att artikel 9a i ändringsdirektivet genomförs i den nationella skattelagstiftningen. 

1.2  Beredningen av EU-rättsakten och propositionen

I samband med att direktivet mot skatteflykt antogs konstaterades i skäl 13 i direktivet ett behov av att fortsätta att utveckla EU:s lagstiftning för tillämpning på hybridarrangemang. I anslutning till detta bad Europeiska rådets råd för ekonomiska och finansiella frågor (Ekofin-rådet) i ett uttalande som gavs den 12 juli 2016 att kommissionen senast i oktober 2016 skulle lägga fram ett förslag till regler som ska tillämpas på hybrida missmatchningar med tredjeländer. Det var meningen att överenskommelse om förslaget skulle nås före utgången av år 2016. Kommissionen lade den 25 oktober 2016 fram ett förslag till direktiv om ändring av direktiv (EU) 2016/1164 vad gäller hybridarrangemang COM(2016) 687 final,.. Till förslaget anknöt också en promemoria som kommissionen sammanställt. SWD(2016) 345 final,. 

Under hösten 2016 och föråret 2017 behandlades direktivförslaget vid flera sammanträden i arbetsgruppen för skattefrågor (direkt beskattning) i Europeiska unionens råd. Rådets allmänna riktlinje beträffande direktivförslaget gavs den 21 februari 2017 och ändringsdirektivet antogs den 29 maj 2017. 

Genom ändringsdirektivet utvidgades avsevärt regleringen om hybridarrangemang i direktivet mot skatteflykt. Hela regleringen presenterades i ny form och tidtabellen för genomförande av den ändrades. Ändringsdirektivet upphävde hybridregleringen i det ursprungliga direktivet mot skatteflykt. Till ändringsdirektivet fogades också en ny artikel 9a där omvända hybrida missmatchningar regleras. I denna proposition är det fråga om att genomföra den artikeln. 

Propositionen har beretts vid finansministeriet. Finansministeriet lämnade riksdagen den 9 november 2016 en utredning om direktivförslaget .. I utredningen beskrevs allmänt förslaget till rådets direktiv om ändring av direktiv (EU) 2016/1164 vad gäller hybrida missmatchningar med tredjeländer (COM(2016) 687 final). 

Bestämmelser om beskattning av hybridarrangemang finns i artiklarna 9, 9a och 9b i ändringsdirektivet. Som ovan konstateras införlivades de i direktivet förutsatta bestämmelserna om beskattning av hybridarrangemang, med undantag för artikel 9a, i finsk rätt bland annat genom lagen om beskattning av vissa gränsöverskridande hybridarrangemang, som trädde i kraft den 1 januari 2020. 

Bakgrundsmaterialet till regeringens proposition finns tillgängligt på adressen valtio-neuvosto.fi/sv/projekt under beteckningen VM013:00/2020

EU-rättsaktens målsättning och huvudsakliga innehåll

2.1  Målsättning för direktivet mot skatteflykt

Den övergripande målsättningen för direktivet mot skatteflykt är att trygga bolagsskattebasen i medlemsstaterna. Syftet med bestämmelserna om hybridarrangemang i ändringsdirektivet är att motverka den erodering av skattebasen som följer av hybrida missmatchningar. Regleringen syftar främst till att förebygga genomförandet av hybridarrangemang som leder till att beskattning undviks. Om det förebyggande syftet uppnås, kan de fall där regleringen tillämpas bli få i praktiken. 

Bestämmelser om beskattningen av omvända hybridarrangemang finns i artikel 9a i ändringsdirektivet, som behandlas också i rekommendation 5 i OECD:s rapport 2015. Enligt OECD:s rapport 2015 är rekommendationerna i punkt 170 med anknytning till omvända hybrida situationer inte egentliga regler om hybrida missmatchningar (hybrid mismatch rules), utan syftet med dem är att åsidosätta subjektens skattemässiga transparens i vissa situationer och därigenom tillnärma den skattemässiga behandlingen av gränsöverskridande respektive inhemska situationer. OECD:s rapport 2015, s. 63. Enligt skäl 28 i direktivet bör medlemsstaterna vid genomförandet av detta direktiv använda de tillämpliga förklaringarna och exemplen i OECD:s BEPS-rapport som en källa till illustration eller tolkning i den mån som dessa överensstämmer med bestämmelserna i direktivet och unionsrätten. Som har sagts i propositionen om hybridlagen, har Finland också i sin egenskap av OECD-medlemsstat åtagit sig att beakta rekommendationerna. RP 68/2019 rd, s. 24. 

Enligt OECD:s definition är en omvänd hybrid ett subjekt som anses vara skattemässigt transparent inom den jurisdiktion där det etablerats men en särskild skattskyldig inom investerarens jurisdiktion. Definitionen kan åskådliggöras genom följande exempel. 

Exempel 

Vid beskattningen inom jurisdiktion A anses subjektet B vara en särskild skattskyldig, medan ur jurisdiktion B:s synvinkel är subjekt B transparent vid beskattningen. B är därmed ett hybridsubjekt som avses i direktivet, alltså det som enligt OECD:s definition är en omvänd hybrid (reverse hybrid). 

2.2  Den i artikel 9a i ändringsdirektivet ålagda skyldigheten att föreskriva att omvända hybrida situationer är skattepliktiga

Allmänt 

I artikel 9a i ändringsdirektivet förutsätts det att när förutsättningarna för att tillämpa artikeln är uppfyllda ska hybridsubjektet anses hemmahörande i den medlemsstat där det är registrerat eller etablerat, och det beskattas på sin inkomst i den mån denna inkomst inte på annat sätt beskattas enligt medlemsstatens eller någon annan jurisdiktions lagstiftning. 

Regleringen innehåller en särskild bestämmelse om företag för kollektiva investeringar. Enligt artikel 9a.2 i ändringsdirektivet ska punkt 1 i artikeln där omvända hybrida situationer beskrivs inte gälla för företag för kollektiva investeringar. Enligt bestämmelsen avses vid tillämpningen av artikeln med företag för kollektiva investeringar en investeringsfond eller ett investeringsföretag som har bred ägarbas, innehar en diversifierad värdepappersportfölj och omfattas av bestämmelser om investerarskydd i det land där det är etablerat. 

Direktivet mot skatteflykt innehåller dessutom allmänna bestämmelser om direktivets tillämpningsområde i artikel 1 och om definitioner i artikel 2. I artikel 3 föreskrivs att regleringen i direktivet utgör en miniminivå för regleringen, varvid det i nationell lagstiftning är möjligt att anta bestämmelser som är striktare än i direktivet. Dessa allmänna bestämmelser i artiklarna 1–3 tillämpas jämsides med de andra artiklarna. 

Också enligt andra stycket i rekommendation 5 i OECD:s rapport 2015 Chapter 5: Specific recommendations for the tax treatment of reverse hybrids, 2. Limiting the tax transparency for non-resident investors. ska ett omvänt hybridsubjekt i den stat där det är registrerat behandlas som ett allmänt skattskyldigt subjekt, om inte inkomst som subjektet delar ut beskattas enligt lagstiftningen i registreringsjurisdiktion och den inkomst som en begränsat skattskyldig investerare i den berörda intressegemenskapen I OECD-rekommendationen används till denna del termen kontrollgrupp (control group). får inte beskattas enligt lagstiftningen i investerarens hemviststat. OECD:s rapport 2015, s. 63. Enligt stycke 174 i OECD:s rapport 2015 baserar sig skattemässig transparens på det grundläggande antagandet att inkomst som en investerare får är skattepliktig för investeraren. Enligt rapporten är detta emellertid inte alltid fallet i gränsöverskridande situationer. Syftet med OECD:s rekommendation är att hindra att begränsat skattskyldiga drar nytta av skattemässig transparens relaterad till hybrid missmatchning. Enligt stycke 175 i OECD:s rapport 2015 är rekommendationen tillämplig i en situation där investeraren inte är skyldig att i beskattningen beakta inkomst som allokeras till den från ett subjekt i dess ägo. Rekommendationen är tillämplig endast om 

a) subjektet är skattemässigt transparent i sin registreringsstat 

b) subjektet får inkomster från en utländsk källa eller inkomst som inte annars beskattas enligt registreringsstatens lagstiftning 

c) all ovannämnda inkomst som subjektet får eller en del av den allokeras i enlighet med lagstiftningen i registreringsstaten till en begränsat skattskyldig investerare som hör till samma kontrollgrupp som subjektet. 

Tillämpningsområde 

Enligt skäl 8 i direktivet mot skatteflykt bör reglerna om omvända hybrida missmatchningar gälla för alla subjekt som behandlas som skattemässigt transparenta av en medlemsstat. Enligt artikel 1 i ändringsdirektivet avses med hybridsubjekt ett subjekt eller arrangemang som anses vara ett skattesubjekt enligt lagstiftningen i en jurisdiktion och vars inkomster eller utgifter behandlas som en eller flera andra personers inkomster eller kostnader enligt lagstiftningen i en annan jurisdiktion. En förutsättning för tillämpning är att denna inkomst inte på annat sätt beskattas enligt medlemsstatens eller någon annan jurisdiktions lagstiftning. 

Enligt artikel 9a i direktivet tillämpas artikeln i situationer där ett eller flera subjekt i intressegemenskap (i den svenskspråkiga direktivversionen används uttrycket ”närstående företag”) utövar bestämmande inflytande i ett omvänt hybridsubjekt. Termen ”subjekt” definieras inte i direktivet. Enligt definitionerna i direktivet avses dock med person en fysisk person eller ett subjekt. Artikeln kan därmed anses vara tillämplig endast på situationer där de som är ägare i ett omvänt hybridsubjekt är andra än fysiska personer. I direktivet anges inte krav avseende subjektets rättsliga form. 

En ytterligare förutsättning för tillämpning av artikel 9a i ändringsdirektivet är att subjektet är hemmahörande utomlands och beläget i en jurisdiktion som behandlar hybridsubjektet som en beskattningsbar person. I den engelskspråkiga direktivversionen används till denna del termerna ”non-resident entity” och ”located in a jurisdiction”. Den i direktivets svenska version använda termen ”hemmahörande” (hemviststat, enligt terminologin i Finland) tyder på att subjektet ska vara allmänt skattskyldigt inom den jurisdiktionen, medan termen ”beläget” tyder på att det också kan vara fråga om ett subjekt som inte är en särskild skattskyldig. Begreppen ”hemviststat” och ”stat där något är beläget” beskrivs i hybridlagens förarbeten (RP 68/2019 rd, s. 35–36). 

Vad gäller bestämmande inflytande förutsätts det i ändringsdirektivet att subjektet ensamt eller i intressegemenskap med ett annat subjekt har ett direkt eller indirekt intresse om 50 procent eller mer av rösterna, kapitalet eller rätten till en del av vinsten i ett hybridsubjekt som är registrerat eller etablerat i en medlemsstat. 

Enligt artikelns ordalydelse ska det bestämmande inflytandet granskas subjektspecifikt, dock så att även bestämmande inflytande i fråga om subjekt som är i intressegemenskap med subjektet beaktas. Definitionen av intressegemenskap (i den svenska direktivversionen används termen närstående företag) baserar sig på artikel 2.4 i direktivet mot skatteflykt, enligt vilken med närstående företag avses: 

a) ett subjekt i vilken den skattskyldige direkt eller indirekt har en andel i form av rösträtt eller kapitalinnehav motsvarande 25 procent eller mer eller har rätt att ta emot 25 procent eller mer av vinsterna i det subjektet. 

b) en fysisk person eller ett subjekt som direkt eller indirekt har en andel i form av rösträtt eller kapitalinnehav motsvarande 25 procent eller mer eller har rätt att ta emot 25 procent eller mer av den skattskyldiges vinster. 

Om en fysisk person eller ett subjekt direkt eller indirekt har en andel motsvarande 25 procent eller mer i en skattskyldig och ett eller fler subjekt, ska alla berörda subjekt, inbegripet den skattskyldige, betraktas som närstående företag. 

Definitionen har preciserats i ändringsdirektivet vad artikel 9a beträffar. Enligt artikel 2.4 i direktivet ska vid tillämpningen av artiklarna 9 och 9a följande gälla: 

a) Har missmatchningen uppstått enligt punkt 9 första stycket b, c, d, e eller g i denna artikel eller när en justering krävs enligt artikel 9.3 eller 9a, ändras definitionen av närstående företag så att kravet på 25 procent ersätts med ett krav på 50 procent. 

b) En person som agerar tillsammans med en annan person när det gäller röster eller kapitalinnehav i ett subjekt ska anses inneha ett ägarintresse i samtliga röster eller det kapitalinnehav i det subjektet som innehas av den andra personen. 

c) Med närstående företag ska även förstås ett subjekt som, för affärsredovisningsändamål, ingår i samma koncern som den skattskyldige, ett företag i vilket den skattskyldige har ett betydande inflytande på förvaltningen eller ett företag som har ett betydande inflytande på förvaltningen av den skattskyldige. 

Enligt artikel 9a.2 i ändringsdirektivet ska regleringen dock inte tillämpas på företag för kollektiva investeringar. Vid tillämpningen av artikeln avses med företag för kollektiva investeringar en investeringsfond eller ett investeringsföretag som har bred ägarbas, innehar en diversifierad värdepappersportfölj och omfattas av bestämmelser om investerarskydd i det land där det är etablerat. 

Förhållande till nationella skattesystem och till skatteavtal 

Ändringsdirektivet innehåller en brett upplagd helhet av olika bestämmelser som ingriper i hybridarrangemang. Avsikten är inte att regleringen i direktivet generellt ska ersätta reglerna i de nationella skattesystemen när det gäller avdrag för utgifter, skatteplikt för inkomster och avräkning av källskatt. Det är meningen att regler som uttrycker de på statens allmänna skattepolitik baserade principerna för skattesystemet ska tillämpas liksom nu. 

I princip är det inte meningen att regleringen i direktivet mot skatteflykt ska ändra sådana bestämmelser om fördelning av beskattningsrätt mellan stater som fastställts i skatteavtal om undanröjande av dubbelbeskattning. Skäl 11 i direktivet. Avsikten är att utöver övriga bestämmelser som ingår i skattesystemen tillämpa särskilda bestämmelser om hybridarrangemang, vilka kan medföra att det regelbaserade skattemässiga resultatet förändras. OECD:s rapport 2015 stycke 4. 

I direktivet behandlas inte explicit förhållandet mellan artikel 9a, nationella skattesystem och skatteavtal. 

Tidsfrist för genomförandet 

Regleringen om hybridarrangemang i artikel 9a i ändringsdirektivet ska genomföras nationellt i medlemsstaterna senast den 31 december 2021. Regleringen ska tillämpas från och med den 1 januari 2022. 

Nuläge och bedömning av nuläget

3.1  Den gällande regleringen om beskattning av hybridarrangemang

Regleringen om hybridsubjekt som betalningsmottagare 

Hybridlagen trädde i kraft vid ingången av 2020. Bestämmelserna i hybridlagen tillämpas så som i lagen föreskrivs närmare vid beskattningen av samfund, öppna bolag och kommanditbolag. I lagen föreskrivs om undantag i fråga om avdragsgillhet för utgifter och skatteplikt för inkomster som ska tillämpas på betalningar mellan personer i intressegemenskap samt på betalningar som anknyter till så kallade strukturerade arrangemang. I sammanhanget företogs dessutom vissa ändringar i lagen om undanröjande av internationell dubbelbeskattning. 

Enligt 2 § 2 punkten i hybridlagen avses med hybridsubjekt ett subjekt eller arrangemang som anses vara en särskild skattskyldig enligt lagstiftningen inom en jurisdiktion och vars inkomster eller utgifter behandlas som en eller flera andra personers inkomster eller utgifter enligt lagstiftningen inom en annan jurisdiktion. Definitionen grundar sig på artikel 2.9 tredje stycket i i direktivet. 

I 4 § i hybridlagen föreskrivs det om situationer där ett hybridsubjekt är betalningsmottagare. I OECD:s rapport 2015 gäller rekommendation 4 betalningar till hybridsubjekt, och i den används termen omvänd hybrid (reverse hybrid). Enligt 1 mom. är en utgift inte avdragsgill till den del motsvarande inkomst inte inkluderas i skattebasen inom betalningsmottagarens jurisdiktion eller inom en annan jurisdiktion där inkomsten anses ha förvärvats. Avdragsrätt för utgiften saknas dock bara om den hybrida missmatchningen beror på att en inkomst som motsvarar utgiften inom hybridsubjektets jurisdiktion allokeras till ett annat subjekt än vid beskattningen inom jurisdiktionen för en sådan person som har en andel i hybridsubjektet. 

I 2 mom. föreskrivs om situationer som anknyter till utländska hybridsubjekt. Enligt momentet är en betalning som ett inom en annan jurisdiktion beläget hybridsubjekt har mottagit och som inte inkluderas i skattebasen inom denna jurisdiktion, skattepliktig inkomst till den del betalningen motsvarar den skattskyldiges andel i hybridsubjektet och dras av vid beskattningen av ett annat subjekt och avdrag inte nekas inom detta subjekts jurisdiktion. Dessutom förutsätts att den hybrida missmatchningen beror på hybridsubjektet. 

I lagens förarbeten konstateras angående 4 § i hybridlagen följande: ”I den situation som avses i bestämmelsen kan hybridsubjektet vara beläget i Finland eller inom någon annan jurisdiktion. Det är inte en förutsättning för tillämpningen att betalningen görs mellan två jurisdiktioner. Bestämmelsen kan bli tillämplig även om betalningen görs mellan två finländska subjekt, om följden av detta är en hybrid missmatchning som avses i bestämmelsen. - - - En person som har en andel i ett hybridsubjekt kan vara belägen i Finland eller någon annan jurisdiktion.” RP 68/2019 rd, s. 62. Se även s. 29, där följande konstateras: ”Mellan inhemska parter kan en hybrid missmatchning uppstå t.ex. när en inhemsk aktör gör en betalning till ett inhemskt kommanditbolag vars ägare är utländska.” 

I lagens förarbeten konstateras dessutom följande: ”Förekomsten av en i bestämmelsen avsedd hybrid missmatchning kan i praktiken konstateras utifrån att ingen hybrid missmatchning i den aktuella situationen skulle ha uppstått till den del betalningen hade gjorts direkt till en person eller ett subjekt som äger en andel i hybridsubjektet. Ingen hybrid missmatchning ska anses uppstå till den del en person som har en andel i hybridsubjektet och som en andel av den betalning som gjorts till hybridsubjektet allokeras till är t.ex. ett skattefritt subjekt. I denna situation påverkas den skattemässiga behandlingen inte av att betalningen går via hybridsubjektet.” RP 68/2019 rd, s. 62. 

Både den gällande 4 § i hybridlagen och artikel 9a i ändringsdirektivet gäller situationer relaterad till ett omvänt hybridsubjekt (reverse hybrid). En omvänd hybrid är ett subjekt som betraktas som skattemässigt transparent inom sin registreringsjurisdiktion men som en särskild skattskyldig inom investerarens eller bolagsmannens jurisdiktion. Konstruktionen är skattemässigt transparent (transparent) när inkomsten beskattas hos subjektets ägare. Skattemässig transparens går att genomföra tekniskt på många olika sätt och praxis varierar från land till land. OECD:s rapport 2015 styckena 160–162. I Finland är till exempel kommanditbolag och öppna bolag som i beskattningen betraktas som näringssammanslutningar potentiella omvända hybridsubjekt. 

I de situationer som avses i artikel 9a i ändringsdirektivet är det fråga om att hybridsubjektet är beläget i Finland. I artikel 9a i direktivet är det inte fråga om nekande av avdrag för en utgift så som avses i 4 § 1 mom. i hybridlagen eller om i 2 mom. i samma paragraf avsedd skatteplikt för inkomst, utan om beskattning av ett hybridsubjekts vinst. Sådana situationer behandlas på ovan beskrivet sätt också i rekommendation 5 i OECD:s rapport 2015. Se även RP 68/2019 rd, s. 26, tabellen med en jämförelse mellan direktivreglering, nationell reglering eller föreslagen bestämmelse samt OECD:s rekommendationer. 

Genomförandetidtabellen för artikel 9a i ändringsdirektivet är enligt direktivet en annan än för den övriga hybridregleringen. Den gällande lagstiftningen om beskattning av hybrider täcker inte den reglering som förutsätts i artikel 9a i direktivet, därför behöver hybridregleringen utsträckas. 

Den gällande definitionen av intressegemenskap i hybridlagen 

Bestämmelserna om hybridarrangemang tillämpas i huvudsak bara när det är fråga om hybridarrangemang mellan aktörer i intressegemenskap. 

I 1 § 3 och 4 mom. i den gällande hybridlagen föreskrivs det närmare om definitionen av intressegemenskap. Enligt 1 § 3 mom. 2 punkten i hybridlagen förekommer intressegemenskap bland annat när en annan person Enligt 2 § 3 punkten i hybridlagen avses med person en fysisk person eller ett subjekt. eller ett annat subjekt direkt eller indirekt har en andel på 50 procent eller mer i rösträtt eller kapital i den skattskyldige, eller rätt till 50 procent eller mer av dess vinster. Definitionen av intressegemenskap grundar sig på artikel 2.4 i ändringsdirektivet. I bakgrunden finns också definitionen av intressegemenskap (närstående företag) i direktivet mot skatteflykt, för närmare information om detta se RP 68/2019 rd, s. 48. I förarbetena till hybridlagen konstateras det att ”begreppet intressegemenskap är relevant med tanke på de i denna proposition avsedda hybridarrangemangen för det första när en hybrid missmatchning som utgör en förutsättning för tillämpning av bestämmelserna i denna lag uppstår mellan en skattskyldig och en person som är i intressegemenskap med den skattskyldige. - - - Intressegemenskapen är dessutom av betydelse när en hybrid missmatchning uppstår mellan personer i intressegemenskap men ingetdera av dem är en skattskyldig i vars beskattning tillämpning av regleringen granskas.” RP 68/2019 rd, s. 49. 

Enligt ordalydelsen i artikel 9a i ändringsdirektivet är artikeln tillämplig om en eller flera närstående subjekt sammanlagt har ett direkt eller indirekt intresse om 50 procent eller mer av rösterna, kapitalet eller rätten till en del av vinsten i ett hybridsubjekt. 

Samma definition av begreppet närstående företag i artikel 2.4 i ändringsdirektivet gäller såväl bestämmelserna i den gällande hybridlagen som artikel 9a i ändringsdirektivet. I situationer enligt artikel 9a i ändringsdirektivet är det dock relevant att granska dels uppkomsten av intressegemenskap mellan investerare eller bolagsmän av subjektkaraktär, dels det innehav som dessa aktörer i intressegemenskap har i hybridsubjektet. Bestämmelserna i den gällande 1 § i hybridlagen täcker mångahanda hybridarrangemang. Lagtekniskt kan det nationella genomförandet av artikel 9a i ändringsdirektivet förutsätta att begreppet intressegemenskap definieras särskilt enbart med avseende på bestämmelsen i fråga. 

3.2  Allmän reglering om sammanslutningar i inhemska situationer

Ett omvänt hybridsubjekt är ett subjekt som anses vara skattemässigt transparent inom sin registreringsjurisdiktion men en särskild skattskyldig inom investerarens eller bolagsmannens jurisdiktion. Artikel 9a i ändringsdirektivet förutsätter att den skattemässiga behandlingen av sådana situationer ändras, om även de övriga tillämpningsförutsättningarna är uppfyllda. 

Enligt 4 § 1 mom. 1 punkten i inkomstskattelagen avses med sammanslutning i denna lag partrederier, öppna bolag, kommanditbolag och sådana konsortier som två eller flera personer har bildat för att bedriva näringsverksamhet och som är avsedda att verka för delägarnas gemensamma räkning, om de inte ska betraktas som samfund (näringssammanslutning). 

I 16 § i inkomstskattelagen föreskrivs om beskattning av näringssammanslutningar och deras delägare. Näringssammanslutningar, bland dem kommanditbolag och öppna bolag, är så kallade beräkningssubjekt i beskattningen. Enligt 16 § i inkomstskattelagen är näringssammanslutningar inte särskilda skattskyldiga. För en sådan sammanslutning ska dock fastställas resultatet av näringsverksamheten, vilket efter avdrag av tidigare skatteårs förluster ska fördelas för beskattning som delägarnas inkomst enligt de andelar som dessa har av sammanslutningens inkomst. Visar näringsverksamheten förlust, ska denna dras av från resultaten av sammanslutningens näringsverksamhet under de följande skatteåren. I 16 § i inkomstskattelagen föreskrivs även om situationer där en näringssammanslutning utöver inkomst av näringsverksamhet har jordbruksinkomst och annan inkomst och om hur dividender som sammanslutningen fått ska behandlas i beskattningen. 

Enligt 4 § 1 mom. 2 punkten i inkomstskattelagen avses med sammanslutning även konsortier som två eller flera personer har bildat och som brukar eller förvaltar en sådan gårdsbruksenhet som avses i 2 § 2 mom. i inkomstskattelagen för gårdsbruk, bedriver skogsbruk eller förvaltar en fastighet som konsortiet är mervärdesskattskyldigt för eller har ansökt om att bli mervärdesskattskyldigt för när det gäller överlåtelse av nyttjanderätten till fastigheten på det sätt som avses i 30 § i mervärdesskattelagen (beskattningssammanslutning). 

I 15 § i inkomstskattelagen föreskrivs det om beskattning av beskattningssammanslutningar och deras delägare. Beskattningssammanslutningar är inte särskilda skattskyldiga, det är i stället delägarna som beskattas. Allmänt skattskyldiga delägare är skattskyldiga beträffande sin andel av en inhemsk sammanslutnings inkomster som en del av deras obegränsade skattskyldighet. 

Artikel 9a i ändringsdirektivet gäller situationer där ett omvänt hybridsubjekt uppkommer, eftersom minst två jurisdiktioner olikbehandlar ett subjekt i beskattningen. Direktivet förutsätter inte förändringar i beskattningen av genuint inhemska sammanslutningar. 

3.3  Allmän reglering om sammanslutningar samt rättspraxis i gränsöverskridande situationer

Enligt 10 § 6 punkten i inkomstskattelagen är andel i finska sammanslutningars inkomst, nedan inkomstandel, sådan inkomst som förvärvats i Finland. I enlighet med 9 § 1 mom. 2 punkten i inkomstskattelagen är den i egenskap av inkomst som förvärvats i Finland skattepliktig inkomst även för begränsat skattskyldiga samt för andra utländska samfund än sådana som avses i 9 § 1 mom. 1 punkten i inkomstskattelagen. I 9 § 3 mom. i inkomstskattelagen föreskrivs dessutom att om en person som inte är bosatt i Finland eller ett utländskt samfund eller konsortium har ett fast driftställe i Finland för bedrivande av näringsverksamhet, är en sådan person, ett sådant samfund eller konsortium utan hinder av 9 § 1 mom. 2 punkten och 2 mom. skyldig att betala skatt på grund av inkomst för all inkomst som hänför sig till detta fasta driftställe. Bestämmelser om fast driftställe finns i 13 a § i inkomstskattelagen. 

Närmare bestämmelser om beskattningen av begränsat skattskyldiga finns i lagen om beskattning av begränsat skattskyldig för inkomst (627/1978), nedan källskattelagen, och till vissa delar i lagen om beskattningsförfarande (1558/1995). 

Skatteavtal och EU-rätten kan begränsa Finlands rätt att beskatta inkomster som begränsat skattskyldiga får. I skatteavtalen finns det i typiska fall en artikel om rörelseinkomst enligt vilken Finland har rätt att beskatta rörelseinkomst som en begränsat skattskyldig får från Finland, om ett fast driftställe i Finland uppkommer för den begränsat skattskyldige. 

I fråga om begränsat skattskyldiga tysta bolagsmän har det i rättspraxis ansetts att Finland i sina skatteavtal inte har avstått från sin rätt att beskatta en begränsat skattskyldig tyst bolagsman för inkomst som denne fått i samband med näringsverksamhet som ett kommanditbolag bedriver från sitt fasta driftställe i Finland (HFD 2002:34). 

I beskattningspraxis har det ansetts att enligt högsta förvaltningsdomstolens beslut (HFD 2002:34) ska inkomst som delats ut från en näringssammanslutning som skattepliktig inkomst för en bolagsman bedömas utifrån sammanslutningens verksamhet i beskattningen av bolagsmannen. Det innebär att om till exempel en finländsk sammanslutning eller en utländsk sammanslutning med ett fast driftställe i Finland bedriver näringsverksamhet i Finland, är inkomstandelen för en begränsat skattskyldig utländsk bolagsman näringsinkomst. Skatteförvaltningens anvisning: Inkomstbeskattning av begränsat skattskyldiga utländska samfund i Finland − Rörelseinkomst och andra inkomster från Finland, Diarienummer VH/5426/00.01.00/2020. 

Artikel 9a i ändringsdirektivet förutsätter att när förutsättningarna för att tillämpa artikeln är uppfyllda anses ett hybridsubjekt vara hemmahörande i den medlemsstat där det är registrerat eller etablerat, och beskattas på sin inkomst i den mån denna inkomst inte på annat sätt beskattas enligt medlemsstatens eller någon annan jurisdiktions lagstiftning. Om en sammanslutning har ett fast driftställe och inkomsten hänför sig till detta fasta driftställe, är utgångspunkten den att Finland med stöd av inkomstskattelagen beskattar inkomstandel som tillfaller en begränsat skattskyldig, och ett eventuellt tillämpligt skatteavtal hindrar i regel inte att Finland använder sin beskattningsrätt. I en sådan situation uppkommer ingen i artikel 9a i ändringsdirektivet avsedd omvänd hybrid missmatchning, eftersom inkomsten inte blir obeskattad. 

En i artikel 9a i ändringsdirektivet avsedd omvänd hybrid missmatchning skulle enligt gällande lagstiftning i Finland kunna uppstå när en sammanslutning har begränsat skattskyldiga bolagsmän för vilka det utifrån deras egen eller sammanslutningens verksamhet inte uppstår ett fast driftställe i Finland. En sådan situation kan eventuellt uppstå till exempel om ett kommanditbolags ansvariga bolagsman är utländsk, sammanslutningen inte bedriver någon verksamhet i Finland och dess inkomster inflyter endast från utlandet. Om begränsat skattskyldiga bolagsmän utifrån sammanslutningens verksamhet inte har ett fast driftställe i Finland eller om sammanslutningens inkomster inte hänför sig till ett fast driftställe som är beläget i Finland, kan det vara fråga om en hybrid situation som avses i direktivet och vars skattemässiga behandling ska ändras, enligt artikel 9a i ändringsdirektivet. En annan tänkbar tillämpningssituation anknyter till situationer enligt 9 § 5 och 6 mom. i inkomstskattelagen, vilka behandlas närmare i nästa avsnitt. 

Det som anges ovan gäller näringssammanslutningar, det vill säga kommanditbolag och öppna bolag och deras begränsat skattskyldiga bolagsmän. I fråga om beskattningssammanslutningar enligt 4 § 1 mom. 2 punkten i inkomstskattelagen kan det inte uppstå en i artikel 9a i ändringsdirektivet avsedd omvänd hybrid missmatchning, eftersom beskattningssammanslutningarnas verksamhet omfattar brukande eller förvaltning av gårdsbruksenheter, bedrivande av skogsbruk eller förvaltning av vissa fastigheter som Finland med stöd av 10 § 1 och 2 punkten i inkomstskattelagen och skatteavtalsbestämmelser har rätt att beskatta. Inkomst kan inte bli obeskattad på grund av en situation som anknyter till ett hybridsubjekt, och därmed förutsätter direktivet inte att beskattningen av dem ändras. 

3.4  Den skattemässiga behandlingen av begränsat skattskyldiga bolagsmän i alternativa investeringsfonder som bedriver kapitalplaceringsverksamhet i kommanditbolagsform

Regleringens huvuddrag 

I 9 § 5 och 6 mom. i inkomstskattelagen föreskrivs det om den skattemässiga behandlingen av vissa begränsat skattskyldiga bolagsmän, när det är fråga om tysta bolagsmäns investeringar i finska kommanditbolag. Bestämmelsen gäller endast begränsat skattskyldiga bolagsmän i vissa kommanditbolag. 

Enligt 9 § 5 mom. i inkomstskattelagen utgör med avvikelse från 3 mom. den del av ett kommanditbolags inkomst som motsvarar bolagsandelen för en begränsat skattskyldig tyst bolagsman i bolag som bedriver enbart kapitalplaceringsverksamhet skattepliktig inkomst endast till den del inkomsten är skattepliktig, om den betalas direkt till den skattskyldiga, samt förutsatt att på bolagsmannen tillämpas ett avtal om undvikande av dubbelbeskattning mellan Finland och den stat där bolagsmannen i fråga har sin hemvist. Om delägarens skattepliktiga inkomst överstiger delägarens andel i sammanslutningens inkomst, ska den överstigande delen betraktas som skattepliktig inkomst under de följande tio skatteåren efter hand som inkomstandelar inflyter. Ett kommanditbolag som bedriver kapitalplaceringsverksamhet ska vara en sådan alternativ investeringsfond, nedan AIF-fond som avses i lagen om förvaltare av alternativa investeringsfonder (162/2014) där syftet enligt bolagsavtalet och det enda faktiska syftet är att bedriva kapitalplaceringsverksamhet. Enligt 9 § 6 mom. i inkomstskattelagen tillämpas vad som föreskrivs i 5 mom. också på en begränsat skattskyldig vars andel motsvarande bolagsandelen av den i 5 mom. avsedda inkomsten bildas av inkomstandelen i en eller flera inhemska eller utländska sammanslutningar, under förutsättning att på den begränsat skattskyldiga tillämpas ett avtal för undvikande av dubbelbeskattning mellan Finland och den stat där den begränsat skattskyldiga har sin hemvist och att den utländska sammanslutningen är registrerad i en sådan jurisdiktion eller grundad i enlighet med lagstiftningen i en sådan jurisdiktion med vilken Finland har ett avtal om informationsutbyte i skatteärenden. 

Regleringen bottnar i en ändring som företogs 2005 med syftet att försätta utländska kapitalplacerares investeringar i finska målföretag via finska kapitalfonder i kommanditbolagsform i samma ställning i beskattningen som investeringar gjorda direkt i finska målföretag. År 2019 utvidgades regleringen i 9 § 5 mom. i inkomstskattelagen med stöd av ett nytt 6 mom. också till vissa strukturer med fondandelsfonder. Ändringen syftade till att sörja för att en investering som en utländsk kapitalplacerare gör genom en fondandelsfond i en finländsk kapitalfond i kommanditbolagsform i ett finländskt målföretag i beskattningen ska ha samma ställning som en investering gjord direkt i ett finskt målföretag. 

Beskattningen av en begränsat skattskyldig investerare sker enligt 9 § 5 mom. i inkomstskatte-lagen i praktiken enligt inkomstslag, om förutsättningarna för tillämpning av bestämmelsen är uppfyllda. Detta medför att vinster på överlåtelse av aktier och ränteintäkter inte är skattepliktig inkomst, eftersom de inte heller vid direkt utbetalning är skattepliktig inkomst för den begränsat skattskyldiga. Bestämmelserna i det skatteavtal som Finland och den utländska investerarens hemviststat har ingått avgör om dividendinkomst är skattepliktig. Enligt 3 g § i källskattelagen är ett kommanditbolag enligt 9 § 5 mom. i inkomstskattelagen skyldigt att uppbära källskatt på den inkomst enligt 3 § som ingår i den andel i sammanslutningens inkomst som innehas av en sådan begränsat skattskyldig enligt förstnämnda bestämmelse, alltså till exempel på dividendinkomst. Även EU-rätten kan inverka på skatteplikten för en inkomstandel (till exempel CSN 35/2016, ingen ändring, HFD 14.11.2017, liggare 5902). 

Trots att beskattningen av en begränsat skattskyldig investerare sker enligt inkomstslag har i synnerhet vid förlust fastställandet av den inkomstandel som investeraren får ur en finländsk sammanslutning betydelse. Enligt 9 § 5 mom. i inkomstskattelagen utgör högst den del av en tyst bolagsmans inkomst för skatteåret som motsvarar bolagsmannens andel i sammanslutningens resultat skattepliktig inkomst. På detta sätt kan en situation undvikas där inkomst som har fåtts från en sammanslutning som helt går med förlust är skattepliktig i Finland. Sammanslutningens förlustresultat för skatteåret medför att beskattningen av skattepliktig inkomst som en utländsk investerare får i Finland skjuts upp till de följande tio skatteåren. Den skattepliktiga inkomsten för de föregående skatteåren beskattas i takt med att bolagsmannen ur sammanslutningen får inkomstandelar utgående från ett positivt resultat i näringsverksamheten. 

Med ett kommanditbolag som bedriver kapitalplaceringsverksamhet avses ett kommanditbolag där syftet enligt bolagsavtalet och det enda faktiska syftet är att bedriva kapitalplaceringsverksamhet. En bedömning av begreppet kapitalplaceringsverksamhet i kapitalfondsstrukturer i kommanditbolagsform har också skett genom rättspraxis. En fastighetsfond (HFD 2007:10) och en inhemsk fondandelsfond (HFD 2007:11) har också ansetts vara sådana kommanditbolag som bedriver enbart kapitalplaceringsverksamhet som avses i 9 § 5 mom. i inkomstskattelagen. 

År 2019 infördes i 9 § 5 mom. i inkomstskattelagen kravet att ett kommanditbolag som bedriver kapitalplaceringsverksamhet också ska vara en sådan AIF-fond som avses i lagen om förvaltare av alternativa investeringsfonder. I ändringen ingick en övergångsbestämmelse enligt vilken kravet på tillämpning av lagen om förvaltare av alternativa investeringsfonder i fråga om investerare i kommanditbolag som bedriver kapitalplaceringsverksamhet och som registrerats före lagens ikraftträdande dock tillämpas första gången vid beskattningen för 2024. Krav på att fonden ska bedriva kapitalplaceringsverksamhet ansågs i samband med att den ursprungliga bestämmelsen togs in i lagen vara motiverat för allokering av bestämmelsens tillämpningsområde eftersom den skiljer de investeringar som en kapitalfond gör från bedrivande av övrig rörelse. RP 64/2005 rd. Vid den tidpunkt då 9 § 5 mom. i inkomstskattelagen stiftades var kapitalplaceringsbranschen emellertid inte reglerad. Kapitalplaceringsbranschen har påverkats av lagen om förvaltare av alternativa investeringsfonder som trädde i kraft våren 2014. Genom lagen genomfördes Europaparlamentets och rådets direktiv 2011/61/EU om förvaltare av alternativa investeringsfonder samt om ändring av direktiv 2003/41/EG och 2009/65/EG och förordningarna (EG) nr 1060/2009 och (EU) nr 1095/2010, nedan AIFM-direktivet. Genom lagen om förvaltare av alternativa investeringsfonder utvidgades regleringen av finansmarknaden till sådana med egendomsförvaltning jämförbara kapitalplaceringar i kommanditbolagsform och sådan fastighetsinvesteringsverksamhet som tidigare bedrivits med stöd av näringsfriheten. Lagen om förvaltare av alternativa investeringsfonder har tillämpats sedan 2014 och det ansågs befogat att beakta den lagstiftningsramen i samband med ändringen av tillämpningsområdet för bestämmelsen i inkomstskattelagen. I praktiken är majoriteten av de fonder i kommanditbolagsform som bedriver kapitalplaceringsverksamhet också sådana AIF-fonder som avses i lagen om förvaltare av alternativa investeringsfonder. RP 306/2018 rd. 

Regleringen i 9 § 5 och 6 mom. i inkomstskattelagen grundar sig på att en begränsat skattskyldig bolagsman i ett kommanditbolag beskattas som om bolagsmannen fick inkomsten direkt från Finland. Det är därmed fråga om en beskattningsmodell som grundar sig på transparens. Det innebär att kommanditbolag som avses i 9 § 5 och 6 mom. i inkomstskattelagen kan vara i artikel 9a i ändringsdirektivet avsedda omvända hybridsubjekt, om de övriga tillämpningsförutsättningarna i direktivet är uppfyllda och om det undantag för företag för kollektiva investeringar som nämns i artikel 9a.2 i ändringsdirektivet inte är tillämpligt. Den nuvarande regleringen bör ändras i överensstämmelse med kraven i ändringsdirektivet. 

Förhållandet mellan undantaget för företag för kollektiva investeringar och gällande lagstiftning 

Enligt artikel 9a.2 i ändringsdirektivet avses vid tillämpningen av artikeln med företag för kollektiva investeringar (collective investment vehicle) en investeringsfond eller ett investeringsföretag som har bred ägarbas, innehar en diversifierad värdepappersportfölj och omfattas av bestämmelser om investerarskydd i det land där det är etablerat. 

I Finlands nuvarande nationella skattelagstiftning finns ingen definition som fullt ut motsvarar artikel 9a.2 i ändringsdirektivet. Vid bedömningen av den nationella lagstiftningens nuläge i förhållande till den reglering som det i ändringsdirektivet angivna undantaget förutsätter kan man också granska den befintliga fondregleringen mer generellt. Nedan används också den övergripande termen ”fond” i stället för termen ”investeringsföretag”, som är i bruk i ändringsdirektivet. 

I EU omfattas den civilrättsliga fondföretagsregleringen av det så kallade UCITS-direktivet Europaparlamentets och rådets direktiv 2009/65/EG om samordning av lagar och andra författningar som avser företag för kollektiva investeringar i överlåtbara värdepapper (fondföretag) (omarbetning).,, som bottnar i syftet att utveckla ett europeiskt, reglerat instrument för kollektiva investeringar i överlåtbara värdepapper, UCITS (undertaking for collective investment in transferable securities). Efter att regleringen om AIF-fonder i det ovannämnda AIFM-direktivet trätt i kraft har även andra än i fondföretagsdirektivet reglerade kollektiva investeringar kommit att omfattas av EU-reglering. Definitionen av begreppet företag för kollektiva investeringar i ändringsdirektivet grundar sig emellertid inte direkt på definitionerna i AIFM- eller UCITS-direktiven. 

I Finland är placeringsfonder som avses i lagen om placeringsfonder (213/2019) sådana fondföretag som avses i UCITS-direktivet. Med stöd av 3 § i inkomstskattelagen är en placeringsfond i beskattningen ett separat samfund som dock är befriat från skatt med stöd av 20 a § i inkomstskattelagen. I 20 a § i inkomstskattelagen föreskrivs det närmare om förutsättningarna för skattefrihet för placeringsfonder. Eftersom en placeringsfond som avses i 20 a § i inkomstskattelagen inte är transparent i beskattningen i Finland ingår den inte alls i tillämpningsområdet för artikel 9a i ändringsdirektivet, och för dess vidkommande finns inte behov av att närmare bedöma huruvida undantaget för företag för kollektiva investeringar är tillämpligt. 

Som ovan konstateras har AIFM-direktivet genomförts i Finland genom lagen om förvaltare av alternativa investeringsfonder. Enligt 2 kap 1 § 1 mom. i den lagen avses med en AIF-fond ett företag eller kollektiva investeringar i annan form där kapital tas emot från ett antal investerare för att investera det i enlighet med en fastställd investeringspolicy till förmån för dessa investerare och som inte kräver auktorisation enligt artikel 5 i fondföretagsdirektivet. AIFM-direktivet tar inte ställning till i vilken rättslig form en AIF-fond är verksam, så AIF-fondernas rättsliga form definieras inte heller separat i nationell lag. Se RP 94/2013 rd (s. 91), där det sägs följande: ”Den rättsliga formen för alternativa investeringsfonder är i typfallet ett aktiebolag eller ett kommanditbolag, men kan också vara t.ex. ett andelslag eller ett registrerat öppet bolag. Också ett öppet bolag som uppkommit konkludent kan vara skyldigt att ansöka om att bli ett auktoriserat tillsynsobjekt. - - - Det är numera inte populärt men i princip möjligt att ordna investeringsverksamhet i form av ett öppet bolag.” Typiska rättsliga former för AIF-fonder i Finland är kommanditbolag, aktiebolag och avtalsbaserade specialplaceringsfonder. I Finland bedrivs i synnerhet kapitalplaceringsverksamhet primärt genom kommanditbolag. Då fungerar det förvaltningsbolag i aktiebolagsform som förvaltar kapitalfonden som kommanditbolagets ansvariga bolagsman och investerarna som kommanditbolagets tysta bolagsmän. En fond i kommanditbolagsform kan bedriva också till exempel fastighetsplaceringsverksamhet. Beskattningen av fastighetsfonder har granskats mer ingående till exempel i rapporten Eräiden osinkojen lähdeverotuksen och kiinteistösijoituksista saatujen voittojen verotuksen uudistaminen (Reform som gäller källskatt på viss vinstutdelning och beskattning av vinster från fastighetsinvesteringar), Finansministeriets publikationer – 2021:31, som en av finansministeriet tillsatt arbetsgrupp sammanställt. 

Aktiebolag och avtalsbaserade specialplaceringsfonder är i beskattningen separata samfund som avses i 3 § i inkomstskattelagen. De ingår därmed inte i tillämpningsområdet för artikel 9a i ändringsdirektivet. 

Däremot kan på det sätt som beskrivs ovan en AIF-fond i kommanditbolagsform som registrerats i Finland ingå i tillämpningsområdet för artikel 9a i ändringsdirektivet, eftersom kommanditbolag inte är särskilda skattskyldiga i Finland. En sådan möjlig situation som hör till tillämpningsområdet hänför sig i synnerhet till i 9 § 5 och 6 mom. i inkomstskattelagen avsedda AIF-fonder i kommanditbolagsform eller till kommanditbolag som bedriver kapitalplaceringsverksamhet Som ovan konstateras tillämpas kravet angående tillämpligheten för lagen om förvaltare av alternativa investeringsfonder i fråga om investerare i vissa kommanditbolag som bedriver kapitalplaceringsverksamhet första gången vid beskattningen för 2024., eftersom det under vissa förutsättningar är möjligt att på begränsat skattskyldiga bolagsmän i dem tillämpa sådan beskattning enligt inkomstslag som beskrivs närmare ovan och som grundar sig på transparens. Direktivets undantag för företag för kollektiva investeringar ska därmed granskas särskilt i förhållande till AIF-fonder i kommanditbolagsform. Detsamma gäller också en situation där en AIF-fond undantagsvis har registrerats i form av ett öppet bolag. 

Definitionen i ändringsdirektivet förutsätter att fonden har bred ägarbas (widely held). Enligt definitionen i lagen om förvaltare av alternativa investeringsfonder ska en AIF-fond ta emot kapital från ett antal investerare. Enligt lagens förarbeten ska existensen av ett antal investerare bedömas från fall till fall och med beaktande av direktivets definition samt med beaktande av att proportionalitetsprincipen styr tolkningen av direktivet. RP 94/2013 rd, s. 67. I lagen om förvaltare av alternativa investeringsfonder anges inga uttryckliga minimikrav när det gäller antalet bolagsmän i AIF-fonder i kommanditbolagsform som bedriver kollektiv investeringsverksamhet. Enligt lagens förarbeten varierar tolkningarna av vad uttrycket ”antal investerare” i AIFM-direktivet avser. Europeiska värdepappers- och marknadsmyndigheten (ESMA) har meddelat riktlinjer om nyckelbegreppen i AIFM-direktivet. ESMA/2013/61, 13.8.2013, s. 6. I riktlinjerna sägs angående begreppet ”antal investerare” att ett företag bör betraktas som ett företag som tar emot kapital från ett antal investerare även om företaget i praktiken bara har en investerare. Enligt lagens förarbeten varierar tolkningarna av vad som avses med AIFM-direktivets uttryck ”ett antal investerare”. RP 94/2013 rd, s. 202. Den breda ägarbas som avses i ändringsdirektivet sammanfaller därmed inte med kravet att AIF-fonder ska ha ett antal investerare. 

Definitionen i ändringsdirektivet förutsätter att fonden har en diversifierad värdepappersportfölj (a diversified portfolio of securities). Enligt 13 kap. 1 § i lagen om placeringsfonder, vilken gäller UCITS-fonder, ska ett fondbolag när det investerar tillgångar som ingår i en placeringsfond sprida de risker som är förenade med investeringsverksamheten. I 7 § i det kapitlet föreskrivs närmare om placeringsfonders krav på minimal diversifiering. I förarbetena till lagen om förvaltare av alternativa investeringsfonder har det konstaterats att AIF-fonder inte förutsätts sprida riskerna på motsvarande sätt som placeringsfonder. RP 94/2013 rd s. 217. Enligt förarbetena till lagen om förvaltare av alternativa investeringsfonder ska AIF-fonder ha en fastställd investeringspolicy som kan framkomma på många sätt. Syftet med investeringspolicyn är att ange hur de tillgångar som samlats in för ett gemensamt investeringsprojekt ska investeras för att resultera i gemensam avkastning för investerarna. Investeringspolicyn anger riktlinjer för klassificeringen och allokeringen av investeringarna, investeringsstrategierna, regional allokering, användning av finansiell hävstång, tidsmässiga aspekter på investeringsåtaganden och andra begränsningar som främjar riskspridning. RP 94/2013 rd, s. 68. Enligt den definition av begreppet fastställd investeringspolicy som ingår i ESMA:s riktlinjer om nyckelbegrepp kan en policy om investeringsverksamheten grunda sig på en eller flera av de ovannämnda kriterierna. ESMS/2013/61, 13.8.2013, s. 7. Varken AIFM-direktivet eller lagen om förvaltare av alternativa investeringsfonder ställer dock direkta begränsningar eller krav som gäller AIF-fondens investeringsportfölj. En AIF-fonds investeringsverksamhet sammanfaller därmed i princip inte med den definition av begreppet diversifierad värdepappersportfölj som ingår i ändringsdirektivet. 

Definitionen i ändringsdirektivet förutsätter att fonden omfattas av bestämmelser om investerarskydd (investor-protection regulation) i det land där den är etablerad. Målsättningen för AIFM-direktivet har varit att skapa ett system för hantering av risker som hänför sig till makrotillsynen över finansmarknaden samt att trygga investerarskyddet. AIF-fonder kan därmed anses uppfylla kravet på bestämmelser om investerarskydd. 

Enligt beskrivningen ovan förutsätter nationell verkställighet av det undantag för företag för kollektiva investeringar som anges i artikel 9a i ändringsdirektivet ett explicit tillägg till den nationella skattelagstiftningen, eftersom ingen motsvarande definition för närvarande finns vare sig i skattelagstiftningen eller i annan lagstiftning om fonder. 

Förslagen och deras konsekvenser

4.1  De viktigaste förslagen

I propositionen föreslås att artikel 9a i ändringsdirektivet genomförs genom att skattskyldigheten för begränsat skattskyldiga bolagsmän utökas i sådana situationer med omvända hybridsubjekt som avses i direktivet. 

För närvarande finns bestämmelser om beskattning av hybridarrangemang i hybridlagen. De föreslagna ändringarna avses bli genomförda med stöd av en ny 8 a § som fogas till lagen. I paragrafen definieras de situationer där omvända hybridsubjekt tillämpas. I paragrafen föreslås det bli föreskrivet närmare också om definitionen av begreppet intressegemenskap. Dessutom förutsätter de föreslagna ändringarna att 9 och 10 i inkomstskattelagen, där det föreskrivs om skattskyldighetens territoriella omfattning, ändras. 

Regleringen avses bli tillämpad på sådana näringssammanslutningar där det finns en begränsat skattskyldig bolagsman som är ett i 2 § 1 punkten i hybridlagen avsett subjekt och som ensam eller tillsammans med motsvarande begränsat skattskyldiga bolagsmän i intressegemenskap direkt eller indirekt har en andel i form av rösträtt eller kapital motsvarande 50 procent eller mer i sammanslutningen eller har rätt till 50 procent eller mer av vinsterna i den. En situation med ett omvänt hybridsubjekt förekommer när en inhemsk sammanslutning anses vara en särskild skattskyldig i den stat där en eller flera begränsat skattskyldiga bolagsmän har sin hemvist och varken bolagsmannens hemviststat eller Finland beskattar denna inkomstandel. 

Avsikten är att vid tillämpning av den föreslagna regleringen på det sätt som förutsätts i direktivet beakta både direkta och indirekta andelar i näringssammanslutningar. Regleringen avses bli tillämpad också när ett begränsat skattskyldigt subjekts innehav uppkommer via en sådan indirekt ägandestruktur där näringssammanslutningens omedelbara bolagsman är ett utländskt skattemässigt transparent subjekt. I fråga om en sådan bolagsman avses med hemviststat den stat där bolagsmannen är belägen. Detta motsvarar också direktivformuleringen, enligt vilken den jurisdiktion där subjektet är beläget granskas. 

Enligt förslaget ska specialbestämmelserna i 9 § 5 och 6 mom. i inkomstskattelagen inte tillämpas vid beskattningen av en begränsat skattskyldig bolagsman eller ett begränsat skattskyldigt subjekt, om det är fråga om en sådan situation med ett omvänt hybridsubjekt som avses i den föreslagna 8 a § i hybridlagen. Den föreslagna regleringen utökar sådana begränsat skattskyldigas skattskyldighet i Finland. Dessutom föreslås skattskyldigheten för begränsat skattskyldiga bolagsmän i näringssammanslutningar bli utökad i sådana situationer med omvända hybridsubjekt som avses i den föreslagna 8 a 1 i hybridlagen så att den omfattar sådan inkomstandel från en inhemsk sammanslutning som enligt huvudregeln inte varit skattepliktig därför att inkomsten inte har hänfört sig till ett fast driftställe i Finland. 

Den föreslagna regleringen ska emellertid inte alls tillämpas, om det omvända hybridsubjektet, alltså en sammanslutning som hör till bestämmelsens tillämpningsområde, är en AIF-fond som definieras närmare i bestämmelsen. AIF-fonden ska ha bred ägarbas och inneha en diversifierad värdepappersportfölj. På grund av skillnaderna mellan den nuvarande regleringen om AIF-fonder och den noggrannare definition som förutsätts i ändringsdirektivet motsvarar en i bestämmelsen avsedd AIF-fond inte nödvändigtvis alla nuvarande AIF-fonder som har formen av kommanditbolag. Syftet med den föreslagna regleringen är inte att ändra skatteregleringen rörande fonder i större utsträckning utan endast att fastställa det i ändringsdirektivet förutsatta tillämpningsområdet med avseende på den reglering som nu föreslås. 

Regleringsmodellen i direktivet grundar sig på att hybridsubjektets skattemässiga transparens begränsas så att det föreskrivs att det omvända hybridsubjektet är en särskild skattskyldig. I denna proposition föreslås som regleringsmodell till följd av särdragen hos den nationella beskattningen av sammanslutningar att skattskyldigheten för begränsat skattskyldiga bolagsmän utökas. Avsikten är inte att genom förslaget ändra skattskyldigheten för bolagsmän i andra situationer än sådana omvända hybrida situationer med anknytning till omvända hybridsubjekt som förutsätts i direktivet. 

Till den del den föreslagna regleringen utgår från att 9 § 5 och 6 mom. i inkomstskattelagen inte längre är tillämpliga grundar sig beskattningen på den huvudregel som motsvarar nuläget. I rättspraxis har det ansetts att Finland i sina skatteavtal inte har avstått från sin rätt att beskatta inkomst (HFV 2002:34). I övriga situationer som förutsätts i artikel 9a i ändringsdirektivet avviker den föreslagna bestämmelsen till sin bakgrund och målsättning från de med huvudregeln förenliga situationerna för beskattning av sammanslutningar. Avsikten är att genom den föreslagna regleringen sätta i kraft artikel 9a i ändringsdirektivet, enligt vilken en sammanslutnings inkomst i en omvänd hybrid situation ska beskattas i den stat där sammanslutningen är belägen. I direktivet förutsätts alltså att specialbestämmelser tillämpas på dessa situationer. När förutsättningarna för att tillämpa den föreslagna regleringen är uppfyllda är den inkomstandel som en bolagsman som är begränsat skattskyldig i Finland får skattepliktig i Finland, om inkomsten inte beskattas på annat sätt i bolagsmannens hemviststat. Det främsta syftet med skatteavtal är att undanröja juridisk dubbelbeskattning. Med juridisk dubbelbeskattning avses att två (eller fler) stater beskattar en och samma skattskyldige för samma inkomst. I en omvänd hybrid situation föreligger inte risk för juridisk dubbelbeskattning. 

Också i kommentarstexten i OECD:s modellskatteavtal har sådana situationer i samband med beskattning av sammanslutningar där inkomstandelen inte beskattas vare sig i den stat där sammanslutningen är belägen eller i bolagsmannens hemviststat bedömts annorlunda än andra situationer som gäller beskattning av gränsöverskridande inkomstandelar. Enligt OECD:s skatteavtalskommentarer från 2014 kan bolagsmannens rätt att i fråga om inkomstandelen åberopa skatteavtalsförmåner begränsas i en situation där den stat där en sammanslutning är belägen behandlar sammanslutningen som transparent medan bolagsmannens hemviststat behandlar den som ett separat bolag. Model Tax Convention on Income and on Capital: Condensed Version (as it read on 15 July 2014), s. 48, avsnitt 6.2. Också vid tillämpning av skatteavtal ska det beaktas huruvida sammanslutningen befinner sig i en omvänd hybrid situation. 

4.2  De huvudsakliga konsekvenserna

Ekonomiska konsekvenser 

Målsättningen för EU-regleringen om hybridarrangemang är att trygga bolagsskattebasen i medlemsstaterna. EU-regleringen bottnar i internationellt arbete på OECD-nivå. Avsikten är att genom regleringen säkerställa att inkomster och utgifter behandlas ändamålsenligt i beskattningen även i samband med gränsöverskridande arrangemang. Det egentliga syftet är att förebygga hybridarrangemang. När direktiven bereddes förmodade man att de situationer där bestämmelserna tillämpas och till exempel avdrag för en utgift nekas i beskattningen blir få i praktiken. BEPS-toimenpiteiden taloudellisten vaikutusten arviointiraportti (Utvärderingsrapport om BEPS-åtgärdernas ekonomiska konsekvenser), Finansministeriets publikation – 26/2017, s. 93. Det främsta syftet med direktiven är inte att öka skatteintäkterna utan att förebygga kringgående av skatt. 

Ändringen gäller inkomst för begränsat skattskyldiga bolagsmän i finska näringssammanslutningar när bolagsmannen är ett subjekt som avses i 2 § 1 punkten i hybridlagen och inkomsten inte hänför sig till ett fast driftställe i Finland eller när det är fråga om en situation enligt 9 § 5 och 6 mom. i inkomstskattelagen där bolagsmannen beskattas enligt transparensprincipen för sin andel i sammanslutningen som om bolagsmannen fick inkomsten direkt. Dessutom förutsätts det att bolagsmannen ensam eller tillsammans med ett subjekt i intressegemenskap har en sammanlagd andel i form av rösträtt eller kapital motsvarande 50 procent eller mer eller har rätt till 50 procent eller mer av sammanslutningens vinst och att hemviststaten inte beskattar inkomst som erhållits från sammanslutningen därför att sammanslutningen anses vara en särskild skattskyldig. Dessutom förutsätts att det i ändringsdirektivet avsedda undantaget för företag för kollektiva investeringar inte är tillämpligt. 

Enligt uppgifter i handelsregistret fanns det i Finland vid ingången av 2021 strax över 25 400 kommanditbolag och cirka 8 900 öppna bolag. . Av dem har endast en liten del begränsat skattskyldiga bolagsmän. Denna skara har kartlagts med hjälp av uppgifter om skatteåret 2019 som fåtts från Skatteförvaltningen. Utifrån dessa uppgifter hade år 2019 strax under 200 sammanslutningar en begränsat skattskyldig bolagsman som är en annan än en fysisk person. Uppgifterna grundar sig på handelsregisteruppgifter som kompletterats med skattedeklarationsuppgifter. Uppgifterna är förknippade med osäkerhet, bland annat på grund av anmälningsbrister. Uppgifter om vilka andelar av rösträtt eller kapital sammanslutningarnas bolagsmän har finns inte tillgängliga. I beskattningsuppgifterna ingår emellertid information om bolagsmännens inkomstandel till den del inkomstandelen har uppgetts i skattedeklarationen. Denna uppgift kan avvika från rösträtts- och kapitalandelen. I 2 kap. 9 § i lagen om öppna bolag och kommanditbolag föreskrivs det om delning av vinst mellan bolagsmännen i öppna bolag. Bestämmelserna i 2 kap. är dispositiva, alltså tillämpas de om inte annat har överenskommits i bolagsavtalet (2 kap. 1 § i lagen om öppna bolag och kommanditbolag). Kommanditbolags inkomst delas så att den beskattas som bolagsmännens inkomst i enlighet med bolagsavtalet eller de bestämmelser om vinstdelning som ingår i något annat avtal. Om ingen överenskommelse om vinstdelningen finns i bolagsavtalet eller något annat avtal, följs den bestämmelse om vinstdelning som finns i 7 kap. 4 § i lagen om öppna bolag och kommanditbolag. Det kan dock uppskattas att de deklarerade uppgifterna om inkomstandelar grovt taget motsvarar bolagsmannens andel av rösträtten. Enligt beskattningsuppgifterna är omkring 50 av de ovan angivna cirka 200 sammanslutningarna sådana där en begränsat skattskyldig bolagsman i bolagsform har en inkomstandel i sammanslutningen som är minst 50 procent. Av sammanslutningarna har cirka 50 inte angett uppgifter om inkomstandelen, eller så är uppgifterna bristfälliga. Av dessa sammanslutningar är 18 sådana för vars del det har antecknats att verksamheten upphör före ingången av 2021. På basis av detta kan det grovt uppskattas att cirka 50–80 av sammanslutningarna är sådana där en begränsat skattskyldig bolagsman som är en annan än en fysisk person har en andel i form av rösträtt eller kapital motsvarande 50 procent eller mer. En bolagsmans i direktivet avsedda andel i form av rösträtt eller kapital kan uppkomma även i form av innehavet hos flera bolagsmän som är i intressegemenskap med varandra. Närmare uppgifter om begränsat skattskyldiga bolagsmäns relationer i intressegemenskap är dock inte tillgängliga. 

De föreslagna bestämmelserna är dock tillämpliga på endast en liten del av de nämnda 50–80 sammanslutningarna. För det första är förslaget tillämpligt endast på sammanslutningar på vilka regleringen i 9 § 5 och 6 mom. i inkomstskattelagen är tillämplig i nuläget eller för vilka det inte uppkommer ett fast driftställe. Enligt 2019 års uppgifter fanns det i Finland 135 kapitalfonder i sammanslutningsform där minst ett utländskt samfund var en tyst bolagsman. Dessa är sammanslutningar på vars bolagsmän i 9 § 5 och 6 mom. i inkomstskattelagen i princip kan vara tillämpliga, men det finns inte mer detaljerad information om i hur många fall bestämmelsen har tillämpats på beskattning av bolagsmannens inkomstandel. Det är inte heller känt i hur många fall en begränsat skattskyldig bolagsman i bolagsform har en inkomstandel i sammanslutningen som är 50 procent eller mer. Som sagt ovan, hade år 2019 strax under 200 sammanslutningar en begränsat skattskyldig bolagsman som är en annan än en fysisk person. På grund av detta kan man grovt uppskatta att över hälften av de 50–80 sammanslutningar är sådana att reglering enligt 9 § 5 och 6 mom. i inkomstskattelagen skulle tillämpas. Det finns inte tillgänglig information om ett fast driftställe uppkommer i dessa fall. 

För det andra förutsätter tillämpningen av de föreslagna bestämmelserna att den stat där bolagsmannen är belägen inte beskattar inkomsten i fråga och att detta uttryckligen beror på ett omvänt hybridsubjekt, alltså på att sammanslutningen i hemviststaten anses vara en särskild skattskyldig. Staternas nationella bestämmelser om klassificering av utländska subjekt i beskattningen kan vara mycket varierande och basera sig också på rätts- eller beskattningspraxis. Exakt information finns inte tillgänglig beträffande ur hur många staters perspektiv en finsk sammanslutning för tillfället skulle betraktas som en särskild skattskyldig. Det kan ändå presumeras att klassificering av en finsk sammanslutning som särskild skattskyldig är mer sällsynt än att betrakta densamma som sammanslutning beskattningsmässigt sett. 

För det tredje är den föreslagna regleringen inte tillämplig om sammanslutningen är en AIF-fond som avses i regleringen och uppfyller de närmare tillämpningsförutsättningarna. Som ovan nämns i avsnitt 3.4 grundar sig de ytterligare förutsättningar som med stöd av ändringsdirektivet ställs i fråga om AIF-fonder i kommanditbolagsform inte direkt på befintlig skatte- eller civilrättslig reglering. Det finns inte information tillgänglig angående antalet AIF-fonder vilka betraktas som omvända hybridsubjekt som uppfyller de mer specifika kriterierna i den föreslagna regleringen. 

På grund av de ovan beskrivna orsakerna kan man bedöma att antalet potentiella tillämpningssituationer är betydligt mindre än det ovan uppskattade antalet bolagsmän i de ovan angivna 50–80 sammanslutningarna. Ändringens konsekvenser för skatteintäkterna bedöms därför vara ringa. 

Konsekvenser för myndigheternas verksamhet 

Administrativa kostnader torde uppkomma för Skatteförvaltningen på grund av den föreslagna regleringen om omvända hybridsubjekt. De föreslagna ändringarna inverkar på bland annat fördjupade anvisningar, deklarationsblanketter, anvisningar för ifyllande av skattedeklarationen, skattekontroll och informationssystem. Regleringen kan ställa krav också på Skatteförvaltningens internationella samarbete på grund av arrangemangens gränsöverskridande karaktär. 

I samband med den föregående propositionen om hybridreglering (RP 68/2019 rd) uppskattades kostnaderna för externt personarbete som behövdes för att genomföra ändringen i Skatteförvaltningens it-system till 115 000 euro. Nu är det fråga om en avsevärt snävare lagstiftningsändring som gäller ett betydligt mindre antal bestämmelser och skattskyldiga än hybridlagen. Man kan därför anta att de kostnader som ändringen ger upphov till är betydligt mindre än de som följde av den föregående propositionen om hybridreglering. 

De eventuella årliga övervakningskostnaderna väntas inte uppgå till stora belopp med hänsyn till det mycket begränsade antalet skattskyldiga som är föremål för den föreslagna lagstiftningen. Det kan antas att en del av de arrangemang som nu är föremål för reglering skulle upptäckas vid skattegranskningar och att ändringarna medför ökade administrativa kostnader förutom i samband med den ordinarie beskattningen också i skattegranskningsprocessen. Inte heller då bedöms mängden resurser som binds vara stor. 

Man kan förmoda att myndigheterna i någon mån föranleds administrativa kostnader förutom för övervakning och skattegranskning också med anledning av exempelvis på förhand meddelade ställningstaganden till arrangemang (Skatteförvaltningens och centralskattenämndens förhandsavgöranden). 

Konsekvenser för de skattskyldiga 

Den föreslagna regleringen handlar, liksom den reglering om beskattning av hybridarrangemang som verkställts tidigare, om att eliminera skattefördelar som bygger på kringgående av skatt, och regleringens primära målsättning är att förebygga arrangemang som resulterar i sådana skattefördelar. Om målet uppnås kan de situationer där de föreslagna bestämmelserna tillämpas därför bli få. De skattskyldiga behöver dock åtminstone känna till den föreslagna regleringens innehåll och iaktta de deklarationsskyldigheter som följer av den, vilket innebär att de skattskyldigas administrativa börda växer. Om den föreslagna regleringen är tillämplig vid beskattningen av en skattskyldig kan det också innebära att den skattskyldiges skattebelopp stiger till den nivå där det bör vara enligt de normala principer och bestämmelser som hör ihop med skattesystemet. 

Vid utarbetandet av propositionen har det inte heller varit möjligt att noggrant bedöma omfattningen av regleringens konsekvenser ur de skattskyldigas perspektiv. Det beror på att de situationer där regleringen tillämpas kan vara komplexa och vanligtvis baserar sig på omständigheter som är sådana att det inte finns något kunskapsunderlag för bedömning av dem. Värt att notera angående konsekvenserna för de skattskyldiga är utöver konsekvenserna i Finland den internationella koppling som är en väsentlig del av regleringen. Regleringen grundar sig på ett direktiv som i sin tur bygger på OECD:s rekommendationer. När det är fråga om en internationell transaktion är det sannolikt att reglering som motsvarar den föreslagna regleringen är i kraft också inom de andra jurisdiktioner till vilka transaktionen hänför sig. 

En större administrativ börda uppkommer för företag med en struktur som medför att regleringen kan bli tillämplig, och särskilt när regleringen är tillämplig på beskattningen av företaget. Detta väntas stödja den förebyggande verkan som är förenlig med målet för bestämmelserna tillsammans med den omständigheten att den skattefördel som arrangemanget resulterar i ute-blir. Tillämpningen av bestämmelserna leder då till att det skattemässiga resultat som baserar sig på hybridarrangemanget elimineras, dvs. neutraliseras. Företagens skattebörda kan då vara på samma nivå som i ett företag som inte har genomfört ett arrangemang. Företag som har genomfört ett arrangemang behöver emellertid bära den administrativa börda som hör samman med regleringen och tillämpning av den. Regleringens konsekvenser gäller alla företag som bestämmelserna tillämpas på, oberoende av om företaget har eftersträvat skattefördelar genom arrangemanget eller inte. Tillämpningen av bestämmelserna förutsätter inte att det kan visas att företaget har eftersträvat skattefördelar. 

Vid en granskning av regleringens konsekvenser för de skattskyldiga i Finland ska utgångspunkten för det första vara sammanslutningar med begränsat skattskyldiga bolagsmän som är andra än fysiska personer. Regleringen inverkar åtminstone indirekt på alla sådana sammanslutningar, eftersom de behöver känna till innehållet i regleringen om omvända hybridarrangemang på motsvarande sätt som den övriga skattelagstiftningens innehåll. Den administrativa börda som anknyter till regleringen väntas dock vara liten i situationer där sammanslutningen inte har en sådan struktur som medför att regleringen kan bli tillämplig. Enligt skäl 12 i direktivet, är det endast nödvändigt att behandla sådana fall där det föreligger en betydande risk för skatteflykt genom användning av hybrida missmatchningar för att säkerställa proportionalitet. En av den föreslagna regleringens centrala tillämpningsförutsättningar har att göra med att en begränsat skattskyldig bolagsman, i vars beskattning en sammanslutning ses som särskilt skattskyldig, har kontroll över sammanslutningen på det sätt som avses i den föreslagna regleringen. I kontrollsituationer kan man bedöma att den skattskyldige har möjlighet att identifiera strukturer som sannolikt medför tillämplighet av regleringen och inverka på dem. 

Tillämpningsområdet för det undantag för AIF-fonder som ingår i regleringen kan avvika från tillämpningsområdet för 9 § 5 och 6 mom. i inkomstskattelagen så att inte alla AIF-fonder som omfattas av de ovannämnda bestämmelserna i inkomstskattelagen uppfyller de närmare förutsättningarna för tillämpning av den föreslagna regleringen. Eftersom den definition som grundar sig på direktivet är ny och motsvarande uppgifter inte rapporteras exempelvis till Skatteförvaltningen är det inte känt hur många AIF-fonder som är att betrakta som omvända hybridsubjekt som uppfyller de närmare förutsättningarna i den föreslagna regleringen. 

Bolagsmän som omfattas av regleringen föranleds årliga rapporteringskostnader i och med att skatt ska deklareras till Finland. Dessutom stiger den faktiska skattenivån för sådana inkomsandelar som dessa begränsat skattskyldiga får, eftersom inkomster som nu är skattefria blir skattepliktiga. 

Alternativa handlingsvägar

5.1  Handlingsalternativen och deras konsekvenser

Syftet med propositionen är att genomföra en EU-rättsakt nationellt. Det direktiv som ska genomföras är därför centralt för propositionens innehåll. Vid direktivgenomförandet gäller det också att beakta den nuvarande nationella lagstiftningen och dess samverkan med regleringen i direktivet. I denna proposition är en sådan lösning ett förslag om att direktivgenomförandet ska ske genom att skattskyldigheten för bolagsmän utökas i stället för att beskattningen av sammanslutningar ändras så att sammanslutningen föreskrivs vara en särskild skattskyldig. 

Artikel 9a i ändringsdirektivet förutsätter att det omvända hybridsubjektet när förutsättningarna för att tillämpa artikeln är uppfyllda anses vara hemmahörande i den medlemsstat där det är registrerat eller etablerat och beskattas på sin inkomst i den mån denna inkomst inte på annat sätt beskattas enligt medlemsstatens eller någon annan jurisdiktions lagstiftning. Enligt direktivets ordalydelse bör uttryckligen det omvända hybridsubjektets, alltså sammanslutningens, skattskyldighet utökas när förutsättningarna för tillämpning av en omvänd hybrid är uppfyllda. 

Skattskyldighet för sammanslutningar rimmar emellertid illa med Finlands skattesystem där sammanslutningar inte är särskilda skattskyldiga utan endast beräkningssubjekt. En modell där sammanslutningar görs skattskyldiga i en situation med anknytning till ett omvänt hybridsubjekt förefaller i princip förutsätta grundläggande ändringar i skattesystemet. Ändringarna förutsätter att modellen för beskattning av sammanslutningar omprövas som en helhet. Att ändra modellen enbart i fråga om inkomstandelar som omvända hybridsubjekt betalar skulle förutsätta att de situationer och inkomstandelar som undantagsbestämmelsen är tillämplig på definieras tillräckligt exakt. 

För tillfället är sammanslutningar inte särskilda skattskyldiga, och därmed inte heller allmänt eller begränsat skattskyldiga. Om skattskyldigheten beträffande ett omvänt hybridsubjekts inkomster åläggs en sammanslutning, ska denna åtminstone vad beträffar det omvända hybridsubjektets inkomst betraktas som allmänt skattskyldig. Detta förutsätter ändringar åtminstone i 9 § 1 mom. och 16 § i inkomstskattelagen. Det är oklart huruvida sammanslutningen kan betraktas som skattskyldig endast vad ett omvänt hybridsubjekts inkomst beträffar och fortsättningsvis endast som ett beräkningssubjekt i övrigt. Ändringen kan inverka på sammanslutningens skatteavtalsställning och till exempel på Finlands skyldighet att i egenskap av hemviststat avräkna utländsk skatt. I synnerhet om sammanslutningen endast delvis blev skattskyldig skulle det vara fråga om en helt ny typ av reglering som kan medföra komplicerade tolkningssituationer. 

Om det föreskrivs att sammanslutningen ska vara en särskild skattskyldig påverkas i avgörande mån också risk- och ansvarsfördelningen mellan sammanslutningen och bolagsmännen, om till exempel den skatt som sammanslutningen betalar belastar också de andra bolagsmännens inkomstandel. Att göra en sammanslutning skattepliktig för ett omvänt hybridsubjekts inkomst kan påverka skattebördan även hos andra bolagsmän än de som utgör omvända hybridsubjekt. Till exempel i fråga om en sådan allmänt skattskyldig bolagsman i en sammanslutning som är en fysisk person kan valet att beskatta sammanslutningen enligt samfundsskattesatsen beroende på bolagsmannens procentsats för förvärvsinkomster leda till en aningen strängare eller lindrigare beskattning. Även till exempel för en annan begränsat skattskyldig bolagsman för vars inkomstandel den hemviststat beskattar men enligt en skattesats som är lägre än samfundsskattesatsen i Finland skulle följden för bolagsmannen kunna bli strängare beskattning. Detta motsvarar inte direktivets syfte, eftersom som inkomst för en omvänd hybrid enligt direktivet ska beskattas enbart sådan inkomst som inte beskattas enligt lagstiftningen i den stat där sammanslutningen är belägen eller inom någon annan jurisdiktion. Beaktandet av sådana situationer skulle förutsätta till exempel att ett separat system för avräkning av skatter införs, vilket kan betraktas som ett besvärligt och tungrott förfarande i administrativt hänseende. Man kan förmoda att de omvända hybrida situationerna är fåtaliga på årsbasis, och därmed verkar en ändring av hela systemet för beskattning av sammanslutningar inte vara proportionell. 

Vid den fortsatta beredningen utreddes också möjligheten att till den föreslagna bestämmelsehelheten foga en sekundär bestämmelse som nämnts i remissvaren; enligt den ska en sammanslutning vara skattskyldig för ett omvänt hybridsubjekts inkomst till den del ett skatteavtal hindrar beskattningen av detta omvända hybridsubjekts inkomst på bolagsmannanivå. Införandet av den sekundära regeln förutsätter ändringar åtminstone i 16 § i inkomstskattelagen, enligt vilken näringssammanslutningar inte är särskilda skattskyldiga. Denna modell är även i övrigt förknippad med samma utmaningar som alternativet att i första hand göra sammanslutningar skattskyldiga för omvända hybridsubjekts samtliga inkomster. Också i och med en sekundär regel skulle förändra sammanslutningarnas skattemässiga status förändras åtminstone till den del de skulle vara skattskyldiga i fråga om omvända hybridsubjekts inkomster, och detta skulle kunna inverka på tillämpningen av skatteavtal. Möjligheten att förutse beskattningsavgöranden skulle minska genom att exempelvis avgörandet angående den sekundära bestämmelsens tillämplighet med anledning av förändringar som gäller bolagsmännen skulle kunna variera från ett skatteår till ett annat, och därigenom skulle också sammanslutningens skattskyldighetsstatus kunna variera. Om sammanslutningen blev skattskyldig för ett omvänt hybridsubjekts inkomst till följd av hur ett skatteavtal tolkas i fråga om en viss bolagsman, skulle detta kunna leda till svårförutsedda utfall i fråga om eventuella andra bolagsmän, i synnerhet i ändringsbeskattningssituationer, om sammanslutningens skattskyldighet inverkade på den skattemässiga behandlingen av de andra bolagsmännen. 

Direktivet förutsätter att det ingrips i omvända hybridsubjekts inkomst som redan befintliga sammanslutningar delar ut, och ansvaret och riskerna för delägarna i sammanslutningarna skulle kunna förändras på ett för bolagsmännen orimligt och överraskande sätt. Det är värt att notera att direktivet inte möjliggör en övergångstid för beskattning av omvända hybridsubjekts inkomst, utan inkomsten ska beskattas från och med den 1 januari 2022. 

Särskilt vid den fortsatta beredningen har frågor kring sammanjämkning av den modell som valts och skatteavtal utretts. I utkastet till regeringens proposition och utlåtandena om det bedömdes Finlands beskattningsrätt i synnerhet i förhållande till artikel 7 i skatteavtalen, vilken gäller beskattning av rörelseinkomst. Konsekvenserna av den lagstiftningsmodell som föreslås i denna proposition kan i och för sig avvika från den modell som valts i direktivet i situationer där ett av Finland ingånget avtal om undanröjande av dubbelbeskattning begränsar Finlands rätt att beskatta en begränsat skattskyldig bolagsmans som rörelseinkomst beskattade inkomstandel till exempel när det är fråga om inkomst som en sammanslutning fått från utlandet och som inte har någon koppling till Finland. Detta motsvarar rådande beskattnings- och rättspraxis i fråga om beskattningen av begränsat skattskyldiga bolagsmäns inkomstandel. Den nu föreslagna bestämmelsen om beskattning av omvända hybridsubjekts inkomst avviker dock till sin bakgrund och målsättning från den med huvudregeln förenliga situationen vid beskattning av gränsöverskridande sammanslutningsinkomst, och också skatteavtalets inverkan kan avvika från de med huvudregeln förenliga tolkningslinjerna. I den föreslagna bestämmelsehelheten ingår också ett föreslaget tillägg till 10 § 6 punkten i inkomstskattelagen, enligt vilket ett omvänt hybridsubjekts inkomst föreskrivs vara inkomst som förvärvats i Finland. Skatteavtalens tillämplighet bedöms alltid från fall till fall och avtalens innehåll kan skilja sig åt. Artikel 9a i ändringsdirektivet kan vara tillämplig också i en situation där inget tillämpligt skatteavtal alls finns. Även ur detta perspektiv kan den föreslagna modellen anses vara motiverad. 

Av de övriga medlemsstaterna har åtminstone Sverige i sitt förslag gått in för en liknande lösning. Regleringen i Sverige om beskattning av sammanslutningar motsvarar i många avseenden regleringen i Finland. Av ovannämnda skäl kan det anses vara ett mer motiverat alternativ att skattskyldigheten för begränsat skattskyldiga delägare utökas till att omfatta de situationer som förutsätts i direktivet. 

Artikel 9a i ändringsdirektivet har formulerats så att inga frivilliga optioner förekommer. Enligt artikel 9a.2 i ändringsdirektivet ska regleringen inte tillämpas på företag för kollektiva investeringar. Vid det här laget är det känt att av medlemsstaterna i EU har Sverige tolkat bestämmelsen så att det inte är fråga om tvingande direktivreglering, så Sverige har låtit bli att införliva bestämmelsen i sin rätt. Det är samtidigt känt att sammanslutningar i Sverige som bildats med stöd av den nationella lagstiftningen i typfall inte är verksamma som fonder eller bedriver fondföretagsverksamhet. Se finansministeriets arbetsgruppsrapport Eri sijoitusmuotojen verokohtelu (Skattebehandlingen av olika investeringsformer) VM 14/2018 (s. 160–161), enligt vilken de största kapitalfonderna i Sverige har registrerats på Jersey och till den del det i kapitalfondsstrukturerna används fonder som registrerats i enlighet med lagstiftningen i Sverige är de i regel aktiebolag till sin rättsliga form. Kommanditbolagsstrukturer används just inte. Det kan bedömas att undantaget för företag för kollektiva investeringar inte har lika stor betydelse i den svenska verksamhetsmiljön som i Finland, där det är typiskt att exempelvis kapitalplaceringsverksamhet bedrivs via sammanslutningar i kommanditbolagsform. Under beredningen har det bedömts att bestämmelsen om företag för kollektiva investeringar ingår i direktivregleringen och att det därmed är befogat att införa den i den nationella lagstiftningen i Finland. 

5.2  Handlingsmodeller som används eller planeras i andra medlemsstater

Allmänt 

De åtgärder som förutsätts i direktivet ska sättas i kraft den 31 december 2021. Med anledning av detta är inte alla medlemsstaters planer kända ännu. 

Danmark 

Danmark har haft nationell reglering om omvända hybridsubjekt redan före ändringsdirektivet. 

Enligt de nuvarande nationella bestämmelserna i Danmark omkarakteriseras vissa subjekt som i regel är transparenta i beskattningen som särskilda skattskyldiga. Detta förutsätter att utländska investerare har en direkt över 50 procent stor ägarandel i subjektet eller i dess rösträtt. Dessutom ska de utländska investerarnas skatterättsliga hemviststat betrakta subjektet som en särskild skattskyldig, och Danmark ska inte ha ett giltigt skatteavtal med investerarens hemviststat om informationsutbyte. Om dessa tillämpningsförutsättningar är uppfyllda och subjektet inte omfattas av de undantag som definieras närmare i regleringen, ska det betala dansk samfundsskatt i likhet med andra särskilda skattskyldiga. 

Vissa fonder som bedriver kapitalplaceringsverksamhet (venture funds) har lämnats utanför regleringen om omvända hybridsubjekt. Dessutom är fonder som avses i UCITS-direktivet befriade från tillämpning av bestämmelserna från och med den 1 januari 2020. 

Artikel 9a i ändringsdirektivet förutsätter sannolikt en del ändringar i de bestämmelser om omvända hybridsubjekt som gäller i Danmark. Mer detaljerad information om ändringarna är ännu inte tillgänglig. 

Sverige 

I Sverige trädde den lag som gäller genomförande av direktivet i kraft den 1 juli 2021.. Genom lagen sattes det i kraft bestämmelser om beskattning av vissa transparenta företag. I lagen utökades skattskyldigheten för begränsat skattskyldiga i vissa situationer så att den nu omfattar inkomster från svenska sammanslutningar, om intressegemenskap föreligger. 

De situationer som det enligt artikel 9a i ändringsdirektivet ska ingripas i har i den svenska regeringens proposition identifierats som situationer där ett svenskt subjekt i form av handelsbolag har endast inkomster som inte är hänförliga till ett fast driftställe, till exempel inkomst i form av ränta från utlandet, och åtminstone en begränsat skattskyldig delägare”Genomförande av bestämmelsen i EU:s direktiv mot skatteundandraganden för att motverka omvända hybrida missmatchningar”, Prop. 2020/21:111, s. 16.. I propositionen åskådliggörs situationen genom ett exempel där handelsbolaget HB har endast utländsk ränteinkomst från staten B och en svensk delägare i bolagsform, AB, samt en begränsat skattskyldig delägare i bolagsform, A. Den svenska delägaren är obegränsat skattskyldig, så den beskattas för sin andel av handelsbolagets inkomst, som består av ränteinkomst från utlandet. Den begränsat skattskyldige delägaren åter är skattskyldig för inkomsten från handelsbolaget endast i den mån denna är hänförlig till ett fast driftställe i Sverige. Om A:s hemviststat betraktar HB som en särskild skattskyldig, innebär det att A:s inkomstandel varken beskattas i Sverige eller i staten A där delägaren har sin hemvist. 

I Sverige har man gått in för en lagstiftningsmodell där det ingrips i sådana omvända hybrida situationer som beskrivs ovan genom ökad skattskyldighet för begränsat skattskyldiga. De föreslagna bestämmelserna är emellertid tillämpliga på det i direktivet förutsatta sättet endast i situationer där en begränsat skattskyldig delägare och ett subjekt i handelsbolagsform anses vara i intressegemenskap med varandra på det sätt som avses i direktivet. 

I propositionen har också övervägts ett alternativ där ett subjekt i handelsbolagsform görs skattskyldigt till den del en begränsat skattskyldig delägares inkomst inte beskattas till följd av en omvänd hybrid situation. I propositionen anses det ändå att frågan om att göra handelsbolagen till skattesubjekt innefattar omfattande och komplexa frågeställningar som behöver utredas och analyseras noggrant. Särskilt med hänsyn till den korta tidsram i artikel 9a inom vilken direktivets bestämmelser ska vara genomförda bedöms det i propositionen att det för att genomföra artikel 9a inte är en lämplig väg framåt att göra handelsbolag till skattesubjekt, varken helt eller delvis. I Sverige fördes under remissbehandlingen fram att skatteavtalens inverkan på den valda modellen bör bedömas mer ingående. I propositionen har det anförts att det bör överlämnas till rättstillämpningen att avgöra hur skatteavtalen närmare ska tillämpas i förhållande till den nu föreslagna regleringen. 

I Sverige har man valt att låta bli att genomföra artikel 9a.2 i direktivet, enligt vilken regleringen om omvända hybrider inte ska tillämpas på företag för kollektiva investeringar. Enligt den svenska regeringens proposition är det möjligt att tillämpa undantaget i direktivet endast i fråga om fonder som har bred ägarbas, innehar en diversifierad värdepappersportfölj och omfattas av bestämmelser om investerarskydd i den stat där det är etablerat. Enligt propositionen är det tveksamt om undantaget går att tillämpa på exempelvis AIF-fonder; i remissvar hade det krävts att dessa skulle befrias från regleringen om omvända hybrider. Dessutom har den svenska regeringen ansett att ett införande av undantaget skulle innebära ett svagare skydd för den svenska skattebasen. Enligt propositionen kan det emellertid vara motiverat att följa upp detta längre fram. 

I den svenska regeringens proposition har det bedömts att den föreslagna regleringen berör en tydligt avgränsad skara begränsat skattskyldiga bolagsmän. Antalet sådana delägare uppskattas vara färre än 30. 

Nederländerna 

I Nederländerna är det meningen att bestämmelserna om omvända hybridsubjekt som avses i artikel 9a i ändringsdirektivet ska träda i kraft den 1 januari 2022. Enligt en proposition som överlämnades i september 2021 lämpar sig bestämmelserna för holländska omvända hybridsubjekt, alltså sådana sammanslutningar (partnership) som registrerats i eller är belägna i Nederländerna, om sådana investerare i intressegemenskap (related investors) i vars beskattning sammanslutningen anses vara en särskild skattskyldig är berättigade till 50 procent eller mer av rösträtten eller kapitalet i sammanslutningen eller av dess vinst. När förutsättningarna är uppfyllda anses det omvända hybridsubjektet vara ett allmänt skattskyldigt skattesubjekt i Nederländerna. För undvikande av dubbelbeskattning betraktas som avdragsgilla vid beräkning av det omvända hybridsubjektets skattepliktiga inkomst de vinster som delas ut till sådana utländska bolagsmän vars hemviststat anser att sammanslutningen är skattemässigt transparent. Omvända hybridsubjekt är därmed i praktiken skattskyldiga i Nederländerna endast till den del som inkomsten inte beskattas hos investerarna. Ovannämnda regel tillämpas dock inte i förhållande till allmänt skattskyldiga inhemska investerare i sammanslutningen. I den föreslagna regleringen ingår dessutom flera närmare bestämmelser, bland annat med anknytning till källbeskattning av dividender. 

Enligt förslaget tillämpas bestämmelserna om omvända hybrider inte på företag för kollektiva investeringar som är sammanslutningar som registrerats i eller är belägna i Nederländerna. Sådana företag för kollektiva investeringar som avses i undantaget är enligt propositionsutkastet fonder som avses i UCITS-direktivet samt sådana i AIFM-direktivet avsedda AIF-fonder som placerar i värdepapper och vars placeringsportfölj är diversifierad. 

Irland 

I Irland inleddes i juli 2021 ett remissförfarande (Feedback Statement) där intressentgrupper ombeds kommentera genomförandet av artikel 9a i ändringsdirektivet. I begäran om utlåtande har man dryftat en modell där en omvänd hybrid situation avgörs så att hybridsubjektets inkomster beskattas genom samfundsskatt som om subjektets affärsverksamhet bedrevs som allmänt skattskyldig. I begäran om utlåtande har man begärt tekniska synpunkter på förhållandet mellan regleringen om omvända hybridsubjekt och skatteavtal. 

I begäran om utlåtande har det i fråga om undantaget för företag för kollektiva investeringar ansetts att fonder som avses i UCITS-direktivet och AIFM-direktivet uppfyller ändringsdirektivets krav på investerarskydd. Om de andra kraven läggs olika alternativ fram i begäran om utlåtande. Beträffande kravet på bred ägarbas har det i begäran om utlåtande dryftats huruvida definitionen av begreppet faktisk förmånstagare i lagstiftningen om förhindrande av penningtvätt, vilken grundar sig på EU-reglering, skulle kunna utnyttjas när ändringsdirektivet genomförs. Kravet på bred ägarbas kan då uppfyllas, om fonden inte har en enda faktisk förmånstagare som innehar en mer än 25 procent stor andel i fonden. I utlåtandebegäran ombes intressentgrupperna också ge sin syn på huruvida det i den nationella lagstiftningen bör föreskrivas närmare om ändringsdirektivets krav på en diversifierad värdepappersportfölj och hur detta skulle kunna genomföras. 

Luxemburg 

I Luxemburg genomfördes artikel 9a i ändringsdirektivet redan 2019 som en del av den övriga regleringen i ändringsdirektivet om beskattning av hybridarrangemang. Angående det undantag för företag för kollektiva investeringar som anges i artikel 9a i ändringsdirektivet hänvisas det i regleringen till den befintliga fondregleringen i Luxemburg, men undantaget har avgränsats så att fonderna dessutom ska ha bred ägarbas och inneha en diversifierad värdepappersportfölj och att bestämmelserna om investerarskydd ska vara tillämpliga på dem. 

Remissvar

6.1  Remissvar

Utlåtanden om utkastet till regeringsproposition gavs av Skatteförvaltningen, Finnwatch ry, Finanssiala ry, Finlands näringsliv rf, Centralhandelskammaren, Finlands Advokatförbund, Finlands Fackförbunds Centralorganisation FFC rf, Företagarna i Finland rf, Skattebetalarnas Centralförbund rf, professor Marjaana Helminen, professor Juha Lindgren och biträdande professor Moritz Scherleitner. 

I utlåtandena togs det i stor utsträckning ställning till den föreslagna modellen där skattskyldigheten för inkomst från omvända hybridsubjekt åläggs bolagsmännen, inte sammanslutningarna. I huvudsak omfattades i utlåtandena valet att bolagsmännen åläggs skattskyldighet. Fastän den föreslagna modellen i huvudsak vann understöd, uttrycktes i en del utlåtanden oro för att skatteavtalen kan hindra beskattningen av inkomst från omvända hybridsubjekt i situationer där sammanslutningen inte har ett fast driftställe i Finland. Därför ansågs det att förslaget inte nödvändigtvis till alla delar genomför artikel 9a i ändringsdirektivet. I ett utlåtande föreslogs som lösning att skattskyldighet påförs sammanslutningen sekundärt i fråga om inkomst från ett omvänt hybridsubjekt i situationer där ett skatteavtal hindrar beskattning av en begränsat skattskyldig bolagsmans inkomstandel. I två utlåtanden ansågs det att ett effektivt genomförande av ändringsdirektivet förutsätter att sammanslutningen blir skattskyldig i en omvänd hybrid situation. 

I flera utlåtanden kommenterades det undantag i direktivet som gäller företag för kollektiva investeringar. En remissinstans rekommenderade att undantaget i fråga om AIF-fonder frångås. I övrigt tog utlåtandena i huvudsak fasta på definitionerna i bestämmelsen om AIF-fonder, och preciseringar av dem önskades. 

I utlåtandena önskades i synnerhet att det skulle tydliggöras hur tillämpningskriterierna om bestämmande inflytande och intressegemenskap ska tolkas, hur transparenta bolagsmän behandlas när beskattningen verkställs och hur beskattningen av inkomster från omvända hybridsubjekt utförs. 

I propositionen har hänsyn tagits till omständigheter som lyftes fram under remissbehandlingen. Föreslagna bestämmelser, termerna i dem och specialmotiveringen har preciserats. Det undantag som gäller företag för kollektiva investeringar har preciserats på grund av den inverkan som de av formuleringarna i direktivet föranledda specialvillkoren har på den föreslagna bestämmelsen. Den föreslagna modellens bedömning som hänför sig till skatteavtal har breddats. Dessutom har bedömningen av alternativa modeller fördjupats. 

6.2  Utlåtande av rådet för bedömning av lagstiftningen

Utkastet till regeringens proposition har överlämnats till rådet för bedömning av lagstiftningen 7.10.2021. Rådet för bedömning av lagstiftningen har i sitt utlåtande av 22.10.2021 ansett att utkastet till proposition innehåller en koncis beskrivning av propositionens EU-bakgrund, syfte samt motivering. Enligt utlåtandet har konsekvenserna av lagförslaget huvudsakligen utretts endast kvalitativt. I de ekonomiska konsekvenserna har man definierat regleringens målgrupper, lyft fram bedömningssvårigheter och bedömt konsekvenserna för skatteintäkterna som ringa. I konsekvenserna för myndigheternas verksamhet har bedömts uppgifter och kostnader som orsakas för Skatteförvaltningen. Rådet för bedömning av lagstiftningen anser att utkastet till regeringens proposition delvis följer anvisningen om konsekvensbedömning av lagförslag. Rådet rekommenderar att utkastet till proposition korrigeras i enlighet med rådets utlåtande innan regeringens proposition lämnas till riksdagen. 

Rådet har rekommenderat att man i utkastet till propositionen ska klarare beskriva hur sannolikt det är att de bedömda konsekvenserna blir verklighet. Dessutom ska man enligt utlåtandet bättre konkretisera det svårförståeliga ämnet genom grafer, exempel och termförklaringar. Även konsekvenserna från den skattskyldiges perspektiv ska ännu preciseras. 

Propositionens innehåll och motiv har kompletterats och preciserats med hänsyn till rekommendationerna av rådet för bedömning av lagstiftningen. 

Specialmotivering

7.1  Lagen om beskattning av vissa gränsöverskridande hybridarrangemang

1 §. Tillämpningsområde. Enligt 1 § i hybridlagen föreskrivs det i lagen om avdragsgillhet för utgifter och skatteplikt för inkomster, när de hänför sig till gränsöverskridande hybridarrangemang. Till 2 mom. föreslås bli fogad en 3 punkt enligt vilken lagen ska tillämpas också på begränsat skattskyldiga subjekt som direkt eller indirekt har en andel i ett omvänt hybridsubjekt. 

Som ovan konstateras i samband med beskrivningen av nuläget gäller både 4 § i hybridlagen och den nu föreslagna regleringen näringssammanslutningar som är omvända hybridsubjekt. Enligt skäl 29 i ändringsdirektivet kommer bestämmelserna om hybrida missmatchningar i artikel 9.1 och 9.2 endast att vara tillämpliga i den mån som den situation som innefattar en skattskyldig ger upphov till missmatchning. Det ska inte uppstå någon missmatchning när ett arrangemang är föremål för en justering i enlighet med artikel 9.5 eller 9a och följaktligen ska arrangemang som är föremål för justering i enlighet med dessa delar av detta direktiv inte vara föremål för ytterligare justering enligt bestämmelserna om hybrid missmatchning. Om både 4 § i hybridlagen och den föreslagna nya 8 a § i princip kan vara tillämpliga på samma situation, ska den nya 8 a § tillämpas i första hand. Dessutom kan regleringen i 4 § i hybridlagen emellertid vara tillämplig också när en skattskyldig som avses i hybridlagen, alltså någon som betalar en prestation, är näringssammanslutningen själv, eftersom med skattskyldig enligt 2 § 5 punkten i hybridlagen avses en aktör som hör till lagens tillämpningsområde. 

2 §. Definitioner. Till 2 § i hybridlagen föreslås bli fogad en 6 punkt där de situationer med omvända hybridsubjekt där den föreslagna bestämmelsen i hybridlagen kan bli tillämplig. 

Enligt propositionen är avsikten att bestämmelserna om omvända hybridsubjekt ska tillämpas på näringssammanslutningar som avses i 4 § 1 mom. 1 punkten i inkomstskattelagen och på deras bolagsmän. Näringssammanslutningar är enligt 4 § 1 mom. 1 punkten i inkomstskattelagen partrederier, öppna bolag, kommanditbolag och sådana konsortier som två eller flera personer har bildat för att bedriva näringsverksamhet och som är avsedda att verka för delägarnas gemensamma räkning, om de inte ska betraktas som samfund. 

Med en i definitionen avsedd annan jurisdiktion enligt vars lagar näringssammanslutningens skattemässiga status granskas avses för det första den stat eller de stater där sammanslutningens begränsat skattskyldiga bolagsman, eller bolagsmän i intressegemenskap, har sin hemvist. Hemviststaterna kan vara en eller flera så länge som förutsättningarna för att tillämpa bestämmelsen är uppfyllda för varje hemviststats vidkommande. För att bestämmelsen ska kunna tillämpas förutsätts att dessa jurisdiktioners beskattningsreglering jämförs med avseende på huruvida det omvända hybridsubjektet anses vara en särskild skattskyldig i beskattningen eller inte. 

Regleringen avses bli tillämpad också när ägande i ett begränsat skattskyldigt subjekt uppkommer via en sådan indirekt ägandestruktur där en direkt bolagsman i en näringssammanslutning är ett utländskt skattemässigt transparent subjekt. I en sådan situation är den begränsat skattskyldige själv inte direkt bolagsman i näringssammanslutningen. Bolagsmannen är ett transparent utländskt subjekt för vars del den stat där bolagsmannen är belägen avses med uttrycket hemviststat. Vid granskningen beaktas därmed regleringen både i den stat där bolagsmannen är belägen och regleringen i hemviststaten för det subjekt som är ägare i bolagsmannen. 

8 a §. Situationer med anknytning till ett omvänt hybridsubjekt. Enligt 1 mom. beskattas när tillämpningsförutsättningarna är uppfyllda en inkomstandel som fåtts från ett omvänt hybridsubjekt som inkomst för en begränsat skattskyldig bolagsman. Avsikten är att den föreslagna bestämmelsen ska tillämpas endast på sådana situationer med omvända hybridsubjekt som avses i den föreslagna regleringen, och avsikten är inte att ändra på hur beskattningen av sammanslutningar i övrigt genomförs i gränsöverskridande situationer enligt huvudregel. 

Enligt 1 mom. 1 punkten är avsikten att bestämmelsen ska tillämpas endast på situationer där sammanslutningens begränsat skattskyldiga bolagsman är ett subjekt som avses i 2 § 1 punkten i hybridlagen. Bestämmelsen grundar sig på en formulering i artikel 9a i ändringsdirektivet, enligt vilken artikeln tillämpas på situationer där ett eller flera subjekt utövar bestämmande inflytande i ett omvänt hybridsubjekt. 

Enligt 1 mom. 2 punkten är avsikten att bestämmelsen ska tillämpas endast på situationer där den begränsat skattskyldiga bolagsmannen ensam eller tillsammans med en motsvarande bolagsman i intressegemenskap utövar bestämmande inflytande i det omvända hybridsubjektet. Bestämmande inflytande förekommer i situationer där bolagsmannen har en andel i form av rösträtt eller kapitalinnehav på 50 procent eller mer eller har rätt till 50 procent eller mer av vinsterna i det omvända hybridsubjektet. Detta motsvarar även formuleringen i artikel 9a i ändringsdirektivet. 

Med termen ”motsvarande bolagsman” avses att det på det sätt som föreskrivs i 1 punkten är fråga om ett subjekt som är sådant att inkomst från det inte beskattas av bolagsmannens hemviststat på det sätt som föreskrivs i 3 punkten. Vid bedömningen av om bestämmande inflytande uppkommer utgående från de sammanräknade rösträtterna, kapitalandelarna eller vinstandelarna för bolagsmän i intressegemenskap beaktas endast bolagsmän i situationer med omvända hybridsubjekt. 

Avsikten är att bolagsmannens andel i form av rösträtt och kapitalinnehav i sammanslutningen vid tillämpning av den föreslagna bestämmelsen ska bedömas så som bestäms i bolagsavtalet och föreskrivs i lagen om öppna bolag och kommanditbolag (389/1988). Öppna bolags inkomst fördelas för beskattning som bolagsmännens inkomst enligt det registrerade bolagsavtalets bestämmelse om delning av vinst. Om bestämmelser om vinstfördelningen inte finns i det registrerade bolagsavtalet ska bestämmelserna om delning av vinst och förlust i lagen om öppna bolag och kommanditbolag tillämpas i beskattningen. Skatteförvaltningens ställningstagande Fördelningen av beskattningsbar inkomst inom öppna bolag och kommanditbolag VH/455/00.01.00/2019. Kommanditbolags inkomst fördelas för beskattning som bolagsmännens inkomst enligt bestämmelsen om delning av vinst i bolagsavtalet eller i något annat avtal. Om det inte i bolagsavtalet eller i något annat avtal har överenskommits om vinstfördelning ska bestämmelsen om delning av vinst och förlust i 7 kap. 4 § i lagen om öppna bolag och kommanditbolag tillämpas. Skatteförvaltningens ställningstagande Fördelningen av beskattningsbar inkomst inom öppna bolag och kommanditbolag VH/455/00.01.00/2019. I direktivet definieras det inte hur indirekt ägande ska beräknas när det bestämmande inflytandet fastställs. Det är meningen att ägandet ska beräknas proportionellt genom att ägandet i varje steg multipliceras. Om det relativa ägandet understiger 50 procent är det inte fråga om bestämmande inflytande som avses i momentet. 

För att den föreslagna bestämmelsen ska vara tillämplig förutsätts det att bestämmande inflytande förekommer mellan det omvända hybridsubjektet och dess bolagsman eller bolagsmän för vars del det med stöd av denna bestämmelse är fråga om beskattning av inkomstandel. När uppkomsten av bestämmande inflytande granskas beaktas dock ägandet i sammanslutningen hos sådana subjekt som agerar tillsammans och som på det sätt som beskrivs i artikel 9a i ändringsdirektivet är i intressegemenskap med delägaren. Särskilda bestämmelser om uppkomsten av intressegemenskap vid tillämpning av denna bestämmelse finns i 4 mom. Vid bedömningen av det bestämmande inflytandet beaktas dessutom 2 mom., där det föreskrivs om att agera tillsammans. 

Enligt 1 mom. 3 punkten förutsätter tillämpningen av bestämmelsen att bolagsmannens hemviststat inte beskattar den inkomstandel som fåtts från det omvända hybridsubjektet som är skattepliktig med stöd av den föreslagna bestämmelsen. Om den föreslagna bestämmelsen i överensstämmelse med tillämpningsförutsättningarna är tillämplig på flera bolagsmän på den grunden att de tillsammans utövar bestämmande inflytande i det omvända hybridsubjektet, granskas det särskilt för varje bolagsman huruvida inkomstandelen är skattepliktig i bolagsmannens hemviststat. Enligt 1 mom. 3 punkten är avsikten att bestämmelsen ska tillämpas endast på situationer där dessa inkomster inte beskattas på annat sätt enligt lagstiftningen i Finland eller inom någon annan jurisdiktion. Bestämmelsen avses bli tillämpad i situationer där hybrid missmatchning leder till att inkomstandelen blir obeskattad och detta följer av att klassificeringen av sammanslutningen är en annan i den stat där sammanslutningen är belägen, alltså i Finland, än i den stat där inkomsttagaren är belägen. Om inkomstandelen blir obeskattad av en annan orsak än till följd av hybrid missmatchning avses den föreslagna bestämmelsen inte bli tillämpad. I bestämmelsens tillämpningsområde ingår inte situationer där inkomst blir obeskattad därför att bolagsmannen i sin hemviststat är ett subjekt som är befriat från beskattning. 

Enligt artikel 9a i direktivet ska en omvänd hybrid situation beskattas i den mån denna inkomst inte på annat sätt beskattas enligt medlemsstatens eller någon annan jurisdiktions lagstiftning. Enligt OECD:s rapport 2015 beskattas de omvända hybrida situationer där den omvända hybridens inkomst inte beskattas enligt lagarna i investerarens stat. Innehållet i det föreslagna momentet motsvarar formuleringen i artikel 9a i ändringsdirektivet och målsättningen i OECD:s rapport 2015. 

Enligt 2 mom. ska det vid bedömning av uppkomsten av bestämmande inflytande enligt 1 mom. 2 punkten anses att en bolagsman som agerar tillsammans med en annan bolagsman när det gäller rösträtt eller kapitalinnehav i ett omvänt hybridsubjekt innehar samtliga röster eller det kapitalinnehav i det subjektet som innehas av den andra bolagsmannen. Vid granskning av om bestämmande inflytande uppkommer till följd av att bolagsmän agerar tillsammans är det meningen att röster och kapitalinnehav ska beaktas endast i fråga om sådana bolagsmän som uppfyller förutsättningarna i 1 mom. 1 och 3 punkten och som agerar tillsammans, med andra ord är det meningen att endast bolagsmän i en situation med ett omvänt hybridsubjekt ska beaktas vid bedömningen. 

Syftet med bestämmelsen är att bestämmelsernas tillämplighet inte ska förhindras enbart av den anledningen att de i 1 mom. 2 punkten angivna förutsättningarna i fråga om bestämmande inflytande inte är uppfyllda när ägandet eller rösträtten har splittrats mellan flera personer som ändå agerar i samförstånd med avseende på detta ägande, t.ex. i ett hybridarrangemang. Utan den särskilda bestämmelsen i denna punkt skulle tillämpningen av hybridbestämmelsen kunna förhindras av att ingen i 4 mom. 1–3 punkten avsedd intressegemenskap formellt förekommer i situationen. 

Direktivet innehåller ingen närmare beskrivning av en situation där personer kan anses agera tillsammans. I kapitel 11 i OECD:s rapport 2015 beskrivs situationer där bestämmelsen kan bli tillämplig samt exempel på dem. I rapporten hänvisas det till artikel 9 i modellskatteavtalet enligt vars b-punkt subjekt agerar tillsammans när samma personer direkt eller indirekt deltar i förvaltningen av eller kontrollen över såväl ett företag i den ena avtalsslutande staten som ett företag i den andra avtalsslutande staten eller äger en del av deras kapital. 

Agerande tillsammans kan därmed basera sig exempelvis på ett delägaravtal eller något motsvarande arrangemang. Det agerande tillsammans som avses i bestämmelsen förutsätter ändå att delägaravtalet eller något annat arrangemang har en väsentlig inverkan på ägandet eller rösträtten i fråga. 

Det agerande tillsammans som avses i 2 mom. kan uppfyllas också när familjemedlemmar agerar tillsammans. Som familjemedlemmar kan betraktas en persons make eller den som personen lever med i en äktenskapsliknande relation, syskon, halvsyskon, släktingar i upp- eller nedstigande led till personen eller till den som personen är gift med eller lever med i en äktenskapsliknande relation, och personer som är gifta med eller lever i en äktenskapsliknande relation med dessa personer. Till familjemedlemmar kan dessutom räknas dödsbon i vilka den fysiska personen eller någon av de ovannämnda personerna har en andel. 

Enligt 3 mom. är inkomsten emellertid skattepliktig endast till den del denna inkomstandel inte beskattas i Finland med stöd av andra bestämmelser. Eftersom avsikten är att 3 mom. ska tillämpas på bolagsmännen var för sig, är avsikten att också momentets tillämplighet ska granskas för varje bolagsmans del. Det avgörande är huruvida den berörda bolagsmannens inkomstandel beskattas i Finland med stöd av någon annan bestämmelse. Bestämmelsen är inte tillämplig till exempel om inkomsten med stöd av 9 och 10 § i inkomstskattelagen är skattepliktig inkomst i Finland. I typfall är till exempel en begränsat skattskyldig tyst bolagsmans inkomstandel sådan inkomst som förvärvats i Finland på basis av uppkomsten av ett fast driftställe och skattepliktig i Finland, varvid den föreslagna nya 8 a § inte blir tillämplig. 

Innehållet i 3 mom. motsvarar formuleringen i artikel 9a i ändringsdirektivet, enligt vilken hybridsubjektet beskattas på sin inkomst i den mån denna inkomst inte på annat sätt beskattas enligt medlemsstatens eller någon annan jurisdiktions lagstiftning. 

I 4 mom. föreskrivs om när bolagsmän anses vara i intressegemenskap på det sätt som avses i paragrafen. Den föreslagna bestämmelsen innehåller tre punkter, och i de situationer som beskrivs i dem anses intressegemenskap råda vid tillämpning av bestämmelsen. 

Vid bedömningen av om bestämmande inflytande uppkommer på grundval av intressegemenskap är avsikten att beakta endast det bestämmande inflytande som utövas av i paragrafen avsedda bolagsmän, det vill säga sådana bolagsmän som uppfyller förutsättningarna i 1 mom. 1 och 3 punkten i den paragraf som föreslås. 

Enligt 4 mom. 1 punkten förekommer intressegemenskap när en fysisk person eller ett subjekt direkt eller indirekt har en andel i form av rösträtt eller kapital motsvarande 50 procent eller mer i bolagsmännen eller har rätt till 50 procent eller mer av vinsterna eller när en bolagsman direkt eller indirekt har en andel i form av rösträtt eller kapital motsvarande 50 procent eller mer i en annan bolagsman eller har rätt till 50 procent eller mer av vinsterna. Enligt definitionen av intressegemenskap kan flera subjekt vara i intressegemenskap med varandra. 

Intressegemenskap förekommer exempelvis mellan två bolagsmän i bolagsform, om en fysisk person äger 50 procent eller mer av vartdera företaget antingen direkt eller indirekt, till exempel via ett holdingbolag. 

Enligt 4 mom. 2 punkten förekommer intressegemenskap mellan bolagsmän när en fysisk person eller ett subjekt har ett betydande inflytande på förvaltningen av bolagsmän eller en när bolagsman har betydande inflytande på förvaltningen av en eller flera bolagsmän. Med ”betydande inflytande” i 2 punkten avses situationer där en delägare kan utöva bestämmande inflytande i bolagsmännen, till exempel på grund av en betydande investering som delägaren har gjort. 

Sådant betydande inflytande som avses i bestämmelsen ska anses förekomma också i en situation enligt 31 § 2 mom. 4 punkten i lagen om beskattningsförfarande. Enligt nämnda bestämmelse kan bestämmande inflytande grunda sig på att parterna har en gemensam förvaltning eller den ena parten annars utövar ett faktiskt bestämmande inflytande över den andra parten. 

Enligt 4 mom. 3 punkten förekommer intressegemenskap också när bolagsmännen ingår i samma koncern för affärsredovisningsändamål. Med begreppet koncern för affärsredovisningsändamål avses en koncern bestående av alla subjekt som är fullt integrerade i den koncernredovisning som upprättats i enlighet med internationella redovisningsstandarder eller bokföringslagen (1997/1336). 

I 5 mom. föreskrivs om hur agerande tillsammans inverkar på uppkomsten av intressegemenskap. Vid tillämpning av 4 mom. ska en person som agerar tillsammans med en annan person när det gäller rösträtt eller kapitalinnehav i ett subjekt anses inneha samtliga röster eller det kapitalinnehav i det subjektet som innehas av den andra personen. Med agerande tillsammans avses detsamma som i 2 mom. 

I 6 mom. föreskrivs om ett undantag som gäller vissa AIF-fonder. När bestämmelsen är tillämplig beskattas en begränsat skattskyldig bolagsmans andel i en finsk sammanslutning på samma sätt som nu, vilket innebär att den föreslagna nya regleringen inte är tillämplig i övrigt. Sådan beskattning enligt inkomstslag som avses i 9 § 5 och 6 mom. i inkomstskattelagen och som grundar sig på transparensprincipen kan därmed alltjämt vara tillämplig på en begränsat skattskyldig bolagsmans inkomstandel. 

Enligt 6 mom. förutsätter tillämpningen av undantaget för det första att sammanslutningen är en AIF-fond som avses i lagen om förvaltare av alternativa investeringsfonder. I momentet föreskrivs dessutom om de andra närmare krav som ändringsdirektivet förutsätter. Eftersom undantaget gäller AIF-fonder, som det föreskrivs närmare om särskilt i civilrättslig lagstiftning, är det motiverat att närma sig också undantagets närmare innehåll via civilrättslig reglering, men så att de uttryckliga gränser som formuleringarna i direktivet ställer beaktas samtidigt. Formuleringarna i direktivet är inte entydiga i alla hänseenden. Med avseende på målsättningen för direktivet är det i 6 mom. fråga om ett undantag från huvudregeln, så det är motiverat att de anknytande begreppen tolkas snävt. 

I momentet förutsätts att AIF-fonden har bred ägarbas. I definitionen i 6 mom. görs ett avsteg från det tillämpningsområde som följer direkt av AIFM-direktivet och lagen om förvaltare av alternativa investeringsfonder. Enligt AIFM-direktivet ska en AIF-fond i regel ha ett antal investerare. Det är möjligt att det i själva verket är tillräckligt att en AIF-fond har en enda investerare och att till exempel en fond där investerarna är en enda eller några få inte kan anses ha en bred ägarbas på det sätt som förutsätts i ändringsdirektivet. Att definiera vad som är en bred ägarbas med avseende på den berörda bestämmelsen är ändå inte motiverat, eftersom fondstrukturerna kan variera betydligt. 

Den tredje förutsättningen för att momentet ska kunna tillämpas är att AIF-fonden innehar en diversifierad värdepappersportfölj. Begreppet värdepapper definieras inte mer ingående i ändringsdirektivet. Enligt 2 kap. 6 § 4 mom. 1 punkten i lagen om förvaltare av alternativa investeringsfonder avses i den lagen med värdepapper värdepapper enligt 2 kap. 1 § i värdepappersmarknadslagen (746/2012). Enligt 2 kap. 1 § i värdepappersmarknadslagen avses med värdepapper värdepapper som är omsättningsbara och som har satts eller kommer att sättas i omlopp bland allmänheten tillsammans med flera andra värdepapper som utfärdats över identiska rättigheter. Det kan vara fråga om exempelvis 

1) aktier i aktiebolag och motsvarande andelar i andra företag samt om depositionsbevis för sådana rättigheter, 

2) obligationer och andra skuldförbindelser samt om depositionsbevis för sådana rättigheter, 

3) andra värdepapper som ger rätt att förvärva eller sälja värdepapper som avses i 1 och 2 punkten samt om värdepapper som kan berättiga till kontant betalning som fastställs i relation till andra värdepapper, valutor, räntor eller avkastningar, råvaror eller andra index eller värden, 

4) fondandelar enligt lagen om placeringsfonder (48/1999) Lagen om placeringsfonder 48/1999 har upphävts genom lagen om placeringsfonder 213/2019. och andra därmed jämförbara andelar i fondföretag. 

Som värdepapper betraktas i värdepappersmarknadslagen dock inte rättigheter som ensamma för sig eller tillsammans med andra värdepapper medför rätt att besitta en viss lägenhet, en viss annan lokal eller fastighet eller en viss del av en fastighet. 

AIF-fonder kan investera också i fastighetsegendom eller fastighetsvärdepapper. Enligt 3 § i lagen om fastighetsfonder (1173/1997) avses med fastighetsvärdepapper aktier eller andra värdepapper eller sådana finansiella instrument som avses i lagen om investeringstjänster (747/2012) och som ensamma för sig eller tillsammans med andra värdepapper eller finansiella instrument medför rätt att besitta en viss bostad, en annan lägenhet eller fastighet eller en del av en fastighet. 

I momentet förutsätts att AIF-fondens värdepappersportfölj är diversifierad. Ändringsdirektivets ordalydelse definierar inte heller kravet på diversifiering närmare. Av ändringsdirektivet kan man emellertid inte sluta sig till att det inte är möjligt att tillämpa också på AIF-fonder, om tillämpningsförutsättningar uppfylls i övrigt. Med avseende på detta finns det inte anledning att tolka ändringsdirektivets krav på diversifiering så att det även i fråga om AIF-fonder ska föreskrivas lika detaljerat om spridning av investeringsverksamhetens risker som i fråga om placeringsfonder som avses i UCITS-direktivet. För detta talar också den engelskspråkiga versionen av direktivet, som kan hänvisa också till att investeringarna ska vara mångsidiga (diversified). Formuleringarna i direktivet kan visserligen anses ställa krav också på AIF-fondernas investeringsverksamhet. I en AIF-fonds investeringsverksamhet beaktas principen om riskspridning. Den diversifiering som avses i 6 mom. förutsätter att riskspridning de facto också har genomförts, till exempel så att AIF-fondens tillgångar inte har investerats i värdepapper som hör ihop med ett enda objekt. Diversifieringen ska granskas som en samlad bedömning av situationen för hela skatteårets vidkommande. 

I 7 mom. föreskrivs om vissa situationer där indirekt ägande förekommer. Som ovan konstateras är avsikten att vid tillämpning av den föreslagna bestämmelsen beakta både direkt och indirekt ägande på det sätt som förutsätts i direktivet. I momentet föreslås bli föreskrivet att om en direkt bolagsman i en näringssammanslutning är ett utländskt skattemässigt transparent subjekt ska på det begränsat skattskyldiga subjektet, som innehar en andel av det transparenta subjektet, tillämpas samma bestämmelser som i paragrafen i övrigt föreskrivs i fråga om begränsat skattskyldiga bolagsmän. Momentet syftar dels till att det inte ska vara möjligt att befrias från den föreslagna regleringen på den grunden att den omedelbara bolagsmannen inte är en särskild skattskyldig i den stat där den är belägen, dels till att inkomsten i strid med direktivets syfte ska beskattas flera gånger. I momentet används för det begränsat skattskyldiga subjektets del inte termen ”bolagsman”, eftersom den begränsat skattskyldiges andel i inkomsten från ett omvänt hybridsubjekt är indirekt i situationer som denna. Den begränsat skattskyldiges andel av rösterna, kapitalet eller rätten till vinst i ett omvänt hybridsubjekt beräknas proportionellt. Som det i paragrafen föreskrivs om bolagsmän ska i fråga om det indirekta ägande som avses i momentet bestämmelserna om bestämmande inflytande uppfyllas och bestämmelsen bli tillämplig endast till den del som inkomsten inte beskattas enligt lagstiftningen i Finland eller inom någon annan jurisdiktion. 

7.2  Inkomstskattelagen

9 §. Allmän och begränsad skattskyldighet. Det föreslås att 5 mom. ändras så att det däri införs en bestämmelse om att den skattemässiga behandling som föreskrivs i 5 mom. inte ska tillämpas, om kommanditbolaget är ett omvänt hybridsubjekt enligt i det föreslagna 8 a § 1 mom. Ifall undantaget gällande AIF-fonder i den föreslagna hybridlagens 8 a § 6 mom. ändå var tillämpligt på kommanditbolaget, skulle det inte vara frågan om en sådan situation som avses i samma lags 8 a § 1 mom. Eftersom 9 § 6 mom. i inkomstskattelagen är tillämpligt endast när 5 mom. är tillämpligt behöver motsvarande precisering inte göras i 6 mom. 

10 §. Inkomst som förvärvats i Finland. Till 6 punkten fogas en hänvisning till 8 a § i hybridlagen. I punkten föreslås bli föreskrivet att inkomst som förvärvats i Finland i en situation enligt 8 a § i hybridlagen utgör inkomstandel från en näringssammanslutning som avses i 4 § 1 mom. 1 punkten i inkomstskattelagen. 

I den föreslagna bestämmelsen är det fråga om att beskatta inkomstandelar. Det är meningen att beskattningen ska verkställas med stöd av tillägget i 10 § 6 punkten i inkomstskattelagen om beskattning av inkomst från omvända hybrider och med stöd av bestämmelserna om beskattning av begränsat skattskyldiga bolagsmäns inkomstandelar. Sammanslutningsinkomst som förvärvas av ett utländskt samfund som är bolagsman i en finsk sammanslutning ska enligt förslaget beskattas enligt samfundets inkomstskattesats, med stöd av 15 § 3 mom. i lagen om beskattning av begränsat skattskyldig för inkomst. I enlighet med lagen om beskattningsförfarande och Skatteförvaltningens beslut av den 30 december 2016 om deklarationsskyldighet och anteckningar (A123/200/2016) ska en näringssammanslutning och en begränsat skattskyldig delägare i en näringssammanslutning lämna en skattedeklaration i Finland, förutsatt att de har skattepliktig inkomst i Finland. Propositionen inverkar inte på beräkningen av resultatet av näringsverksamhet som fastställs för en sammanslutning eller på hanteringen av en förlustsituation i sammanslutningens beskattning. 

Ikraftträdande

Lagarna föreslås träda i kraft den 1 januari 2022. Lagarna tillämpas första gången vid beskattningen för 2022. 

Inkomstskattelagens 9 § 5 mom. har ändrats genom lag 292/2019, vilken innehöll en särskild ikraftträdandebestämmelse. Enligt bestämmelsen tillämpas 9 § 5 mom. på begränsat skattskyldiga tysta bolagsmän i sådana kommanditbolag som bedriver kapitalplaceringsverksamhet och som har registrerats innan lag 292/2019 trädde i kraft, dock första gången vid beskattningen för 2024. Till dess tillämpas i deras beskattning de bestämmelser som gällde vid ikraftträdandet av denna lag. Därför föreslås det en särskild preciserande ikraftträdandebestämmelse, enligt vilken ikraftträdandebestämmelsen för lagen om ändring av inkomstskattelagen (292/2019) även skulle tillämpas på denna lags 9 § 5 mom. Den tidigare ikraftträdandebestämmelsen skulle därmed inte upphävas. Ändringsdirektivet förutsätter att regleringen i den föreslagna hybridlagens 8 a § skulle tillämpas även på situationer som omfattas av denna ikraftträdandebestämmelse, ifall förutsättningarna för dess tillämpande uppfylls. Därmed föreslås ytterligare att i sådana situationer som avses i den föreslagna hybridlagens 8 a § 1 mom. skulle inkomstskattelagens 9 § 5 mom. ändå inte tillämpas på sådana bolagsmän som avses i den nämnda ikraftträdandebestämmelsen. Detta motsvarar situationen för övriga bolagsmän än de som avses i ikraftträdandebestämmelsen. 

Kläm 

Kläm 

Eftersom ändringsdirektivet innehåller bestämmelser som föreslås bli genomförda genom lag, föreläggs riksdagen följande lagförslag: 

Lagförslag

1. Lag om ändring av lagen om beskattning av vissa gränsöverskridande hybridarrangemang 

I enlighet med riksdagens beslut 
ändras i lagen om beskattning av vissa gränsöverskridande hybridarrangemang (1567/2019) 1 § 2 mom. 2 punkten och 2 § 5 punkten, samt 
fogas till 1 § 2 mom. en ny 3 punkt, till 2 § en ny 6 punkt och till lagen en ny 8 a § som följer: 
1 § Tillämpningsområde 
Lagen tillämpas på 
 En icke ändrad del av lagtexten har utelämnats 
2) öppna bolag och kommanditbolag, med undantag för 5 § 1 mom. och 6 § 2 mom., 
3) begränsat skattskyldiga subjekt som direkt eller indirekt har en andel i ett omvänt hybridsubjekt. 
2 § Definitioner 
I denna lag avses med 
 En icke ändrad del av lagtexten har utelämnats 
5) skattskyldig en aktör som enligt 1 § 2 mom. hör till lagens tillämpningsområde, 
6) omvänt hybridsubjekt en i 4 § 1 mom. 1 punkten i inkomstskattelagen avsedd näringssammanslutning som i enlighet med en annan jurisdiktions lagstiftning anses vara en särskild skattskyldig. 
8 a § Situationer med anknytning till ett omvänt hybridsubjek 
Som inkomst för en begränsat skattskyldig bolagsman beskattas en inkomstandel som fåtts från ett omvänt hybridsubjekt, om 
1) bolagsmannen är ett subjekt som avses i 2 § 1 punkten, 
2) bolagsmannen ensam eller tillsammans med en motsvarande bolagsman i intressegemenskap som uppfyller förutsättningarna i 1 och 3 punkten direkt eller indirekt har en andel i form av rösträtt eller kapital motsvarande 50 procent eller mer i sammanslutningen eller har rätt till 50 procent eller mer av vinsterna i den sammanslutningen, och 
3) bolagsmannens hemviststat inte beskattar inkomstandelen på grund av att den anser näringssammanslutningen vara en särskild skattskyldig. 
Vid bedömning av uppkomsten av bestämmande inflytande enligt 1 mom. 2 punkten ska en i 1 och 3 punkten i det momentet avsedd bolagsman som agerar tillsammans med en annan bolagsman som uppfyller motsvarande förutsättningar när det gäller rösträtt eller kapitalinnehav i ett omvänt hybridsubjekt anses inneha samtliga röster eller det kapitalinnehav i det subjektet som innehas av den andra bolagsmannen. 
Inkomsten är emellertid skattepliktig endast till den del denna inkomstandel inte beskattas i Finland med stöd av någon annan bestämmelse. 
Vid tillämpning av denna paragraf anses bolagsmän som avses i den vara i intressegemenskap om 
1) en fysisk person eller ett subjekt direkt eller indirekt har en andel i form av rösträtt eller kapital motsvarande 50 procent eller mer i bolagsmännen eller har rätt till 50 procent eller mer av vinsterna eller om en bolagsman direkt eller indirekt har en andel i form av rösträtt eller kapital motsvarande 50 procent eller mer i en annan bolagsman eller har rätt till 50 procent eller mer av vinsterna, 
2) en fysisk person eller ett subjekt har ett betydande inflytande på förvaltningen av bolagsmännen eller en bolagsman har betydande inflytande på förvaltningen av en eller flera bolagsmän, eller 
3) bolagsmännen ingår i samma koncern för affärsredovisningsändamål. 
Vid tillämpning av 4 mom. ska en person som agerar tillsammans med en annan person när det gäller rösträtt eller kapitalinnehav i ett subjekt anses inneha samtliga röster eller det kapitalinnehav i det subjektet som innehas av den andra personen. 
Med avvikelse från vad som föreskrivs i 1 mom. beskattas en begränsat skattskyldig bolagsmans inkomst inte med stöd av denna paragraf, om det omvända hybridsubjektet är en sådan i lagen om förvaltare av alternativa investeringsfonder (162/2014) avsedd alternativ investeringsfond som har bred ägarbas och innehar en diversifierad värdepappersportfölj. 
Vad som i denna paragraf föreskrivs om bolagsmän tillämpas också på ett begränsat skattskyldigt subjekt, om dess andel motsvarande bolagsandelen i ett omvänt hybridsubjekt uppkommer indirekt på basis av ägandet av en eller flera utländska skattemässigt transparenta bolagsmän eller andra subjekt och motsvarande inkomst inte beskattas inom jurisdiktionen därför att den stat där bolagsmannen är belägen eller det begränsat skattskyldiga subjektets hemviststat inte anser näringssammanslutningen vara en särskild skattskyldig. 
 Paragraf eller bestämmelse om ikraftträdande börjar 
Denna lag träder i kraft den 20 . 
Lagen tillämpas första gången vid beskattningen för 2022. 
 Slut på lagförslaget 

2. Lag om ändring av 9 och 10 § i inkomstskattelagen 

I enlighet med riksdagens beslut 
ändras i inkomstskattelagen (1535/1992) 9 § 5 mom. och 10 § 1 mom. 6 punkten, sådana de lyder, 9 § 5 mom. i lag 292/2019 och 10 § 1 mom. 6 punkten i lag 1399/2014, som följer: 
9 § Allmän och begränsad skattskyldighet 
Kläm 
Med avvikelse från 3 mom. utgör den del av ett kommanditbolags inkomst som motsvarar bolagsandelen för en begränsat skattskyldig tyst bolagsman i bolag som bedriver enbart kapitalplaceringsverksamhet skattepliktig inkomst endast till den del inkomsten är skattepliktig, om den betalas direkt till den skattskyldiga, samt förutsatt att på bolagsmannen tillämpas ett avtal om undvikande av dubbelbeskattning mellan Finland och den stat där bolagsmannen i fråga har sitt hemvist. Om delägarens skattepliktiga inkomst överstiger delägarens andel i sammanslutningens inkomst, ska den överstigande delen betraktas som skattepliktig inkomst under de följande tio skatteåren efter hand som inkomstandelar inflyter. Ett kommanditbolag som bedriver kapitalplaceringsverksamhet ska vara en sådan alternativ investeringsfond som avses i lagen om förvaltare av alternativa investeringsfonder (162/2014) där syftet enligt bolagsavtalet och det enda faktiska syftet är att bedriva kapitalplaceringsverksamhet. Detta moment tillämpas dock inte, om det är fråga om en situation som avses i 8 a § 1 mom. i lagen om beskattning av vissa gränsöverskridande hybridarrangemang (1567/2019). 
Kläm 
10 § Inkomst som förvärvats i Finland 
Inkomst som förvärvats i Finland är bland annat 
 En icke ändrad del av lagtexten har utelämnats 
6) dividend, överskott från andelslag och annan därmed jämförbar inkomst från ett finskt aktiebolag, andelslag eller annat samfund, andel i finska sammanslutningars inkomst samt inkomstandel från en näringssammanslutning som avses i 8 a § i lagen om beskattning av vissa gränsöverskridande hybridarrangemang, 
 En icke ändrad del av lagtexten har utelämnats 
 Paragraf eller bestämmelse om ikraftträdande börjar 
Denna lag träder i kraft den 20 . 
Lagen tillämpas första gången vid beskattningen för 2022. 
Ikraftträdandebestämmelsen i lagen om ändring av 9 § i inkomstskattelagen (292/2019) tillämpas också på 9 § 5 mom. i denna lag. I fråga om situationer som avses i 8 a § 1 mom. i lagen om beskattning av vissa gränsöverskridande hybridarrangemang (1567/2019) tillämpas dock 9 § 5 mom. i denna lag inte på bolagsmän som avses i den nämnda ikraftträdandebestämmelsen. 
 Slut på lagförslaget 
Helsingfors den 28 oktober 2021 
Statsminister Sanna Marin 
Finansminister Annika Saarikko