Regeringens proposition
RP
205
2017 rd
Regeringens proposition till riksdagen med förslag till lagstiftning om tredimensionella fastigheter
PROPOSITIONENS HUVUDSAKLIGA INNEHÅLL
I denna proposition föreslås det att fastighetsbildningslagen, fastighetsregisterlagen samt markanvändnings- och bygglagen ändras så att det blir möjligt att bilda en ny tredimensionellt bestämd fastighetsenhet, dvs. en tredimensionell fastighet, i ett utrymme ovanför och under markytan inom ett detaljplaneområde. Målet är att göra det enklare och smidigare att genomföra stora byggprojekt i flera plan inom detaljplaneområden genom att möjliggöra uppdelning av fastigheter även i höjdled. 
Fastigheter bildas enligt förslaget så som för närvarande genom styckning eller klyvning. När en tredimensionell fastighet första gången bildas inom ett område ska fastighetsbildningsförrättningen enligt förslaget gälla den tvådimensionellt avgränsade fastigheten i markplanet. Denna traditionella fastighet kallas enligt förslaget basfastighet. En förutsättning för bildande av tredimensionella fastigheter föreslås alltid vara att det finns en detaljplan, och inom ett byggnadskvarter att fastigheten ingår i en bindande tomtindelning. 
Bestämmelserna i fastighetsbildningslagen, fastighetsregisterlagen samt markanvändnings- och bygglagen ändras så att det blir möjligt att bilda, söka lagfart på, inteckna och i fastighetsregistret införa tredimensionella fastigheter som har såväl en horisontell som en vertikal utsträckning. Vidare föreslås det att fastighetsbildningslagen ses över så att det blir möjligt att stifta en tredimensionell servitutsrätt exempelvis för en förbindelse till en tredimensionell fastighet inom ett detaljplaneområde. Av registerenheterna utanför lagfartssystemet inom ett fastställt detaljplaneområde kan enligt förslaget allmänna områden och inlösningsenheter vid behov vara tredimensionella fastigheter. 
Enligt förslaget ska markanvändnings- och bygglagen dessutom ändras så att de inbördes förhållandena mellan tredimensionella fastigheter och de nödvändiga förhållandena visavi basfastigheten kan regleras genom byggnadsservitut och samregleringsavtal. Det föreslås också att bl.a. bestämmelserna om hörande och besvärsrätt ändras så att det processuella rättsskyddet för en tredimensionell fastighet samt fastigheter ovanför och under den säkerställs vid bygglovsförfarande och tomtindelning som gäller fastigheten. 
Enligt den föreslagna lagstiftningen ska exempelvis de delar av ett visst område som anvisats för olika användningsändamål inom ett detaljplaneområde kunna bildas till självständiga tredimensionella fastigheter. Tredimensionella fastigheter ska enligt förslaget kunna bildas endast om inte något annat följer av detaljplanen. Behovet av tredimensionalitet härrör i princip från dem som genomför byggprojekt. I detaljplanen bestäms enligt förslaget vid behov mer detaljerat om genomförandet av tredimensionella samprojekt, men lagstiftningen förutsätter inte några särskilda planbestämmelser om tredimensionalitet. I byggnadskvarter ska tredimensionaliteten dock enligt förslaget alltid basera sig på en tredimensionell tomtindelning enligt en bindande tomtindelning. Enligt lagstiftningen ska det bli möjligt att utarbeta en bindande tomtindelning även under markytan. I fastighetsbildningslagen föreslås även tekniska ändringar för att korrigera de föråldrade hänvisningarna till den tidigare lagen om samfällda skogar. I regleringen i fråga om det tillstånd för miljöåtgärder som avses i markanvändnings- och bygglagen görs en teknisk ändring som undanröjer problemen gällande tolkningen av ordalydelsen i den gällande lagen. Enligt förslaget ska också lagen om parcellers ombildande till självständiga lägenheter upphävas som obehövlig. 
De föreslagna lagarna avses träda i kraft den 1 augusti 2018. 
ALLMÄN MOTIVERING
1
Inledning
Fastighetsindelning skapar en grund för ägande av fast egendom och för fastighetssystemet. I 2 § i lagen om inlösen av fast egendom och särskilda rättigheter (603/1977, inlösningslagen) definieras fast egendom som äganderätt till fastigheter eller andra jord- och vattenområden samt i princip även till de byggnader och anordningar som finns på fastigheterna och innehas av fastighetsägaren. Ägande av fast egendom innefattar äganderätt till en eller flera fastigheter eller en kvotdel av en fastighet. Enligt nuvarande tolkning kan äganderätten även gälla ett outbrutet område som utgör en del av en fastighet som ägs av någon annan. Outbrutna områden utgör dock bara en mellanetapp i processen för omsättning av fast egendom. Efter lagfart på ett outbrutet område ska det genom styckningsförrättning bildas en fastighet av det. Huvudprincipen för fastighetsbildningslagen (554/1995) är att äganderättsindelningen och fastighetsindelningen faktiskt ska kongruera med så liten fördröjning som möjligt efter fastighetsomsättningen. 
Inom fastighetsdatasystemet bildar uppgifterna om enheten för jordäganderätt (lägenhet eller tomt) samt uppgifterna om innehav och säkerhetsanvändning tillsammans ett samlat basregister. Fastighetsregistret samt lagfarts- och inteckningsregistret uppdateras kontinuerligt på elektronisk väg. Ett tillförlitligt fastighetsregister samt ett tillförlitligt och aktuellt lagfarts- och inteckningsregister utgör tillsammans en ovillkorlig förutsättning för att kreditgivnings- och säkerhetssystemet ska fungera och för att rättsskyddet för parterna i fastighetsrelaterade rättshandlingar ska tillgodoses. 
Fastighetsindelningen, som omspänner hela Finlands jord- och vattenareal samt även allmänna vattenområden, inrymmer i 2 § i fastighetsregisterlagen (392/1985) avsedda fastigheter och andra registerenheter, såsom fastigheters samfällda områden. Fastigheter och deras samfällda områden anges vanligen som områden med bestämda gränser, som bildats till registerenheter genom fastighetsförrättningar. Utöver de tvådimensionella fastigheter och deras samfällda områden som avses i gällande lagstiftning ska enligt förslaget fastighetsindelningsenheterna kunna bestämmas och införas i registret även tredimensionellt. Än så länge har Finland inte någon lagstiftning om tredimensionella fastigheter (3D-fastigheter), men i många länder, exempelvis i våra grannländer Sverige och Norge, är det möjligt att bilda tredimensionella fastigheter. 
2
Nuläge
I det tvådimensionella fastighetssystemet har en fastighet av hävd ansetts utsträcka sig både uppåt och nedåt så långt som ett motiverat ekonomiskt nyttjande av den via mänsklig aktivitet kan anses vara möjligt. Enligt denna modell kan man tänka sig att inte bara fastighetens areal utan också hela den för mänskligt nyttjande disponibla volymen av fastigheten i princip står under besittning av ägaren till den fastighet som avgränsas i markplanet. Inskränkningar i detta följer närmast av sådana normer som gäller ett allmänt intresse och som begränsar ägarens nyttjandefrihet eller ger andra än ägaren möjlighet att utnyttja ett utrymme ovanför eller under markytan. Det att ägaren av en traditionell fastighet inte använder fastigheten och ur perspektivet för möjligheterna till ekonomiskt nyttjande inte kan använda den på ett visst djup under eller en viss höjd över markytan innebär inte att utrymmet enbart på den grunden frigörs för att användas av andra. Den omständigheten att den befogenhet att nyttja som basfastighetens ägare har i praktiken begränsas, krymper eller upphör på ett visst avstånd från markytan innebär inte att utrymmet ägandemässigt tillhör någon annan eller samhället (staten eller kommunen) eller kan tas i besittning utan ersättning. 
Av den rättsliga ställningen för basfastighetens ägare följer att basfastighetens ägare har intresse av att medverka i beslutsfattande som gäller utrymmet ovanför eller under markytan, oavsett vilken befogenhet eller faktisk möjlighet att nyttja utrymmet ägaren har i varje enskilt fall. Inom det finländska systemet inverkar den faktiska avsaknaden av befogenhet och nyttjandemöjlighet för ägaren närmast på det ersättningsbelopp som det bestäms att ska betalas till ägaren för någon annans rätt, men ägarens talan består och intrång i äganderätten ska ha en laglig grund. En grund för rätt att använda en fastighet som ägs av en annan kan vara exempelvis ett privaträttsligt avtal eller en rätt som utifrån 96 § 1 mom. i markanvändnings- och bygglagen (132/1999) uppkommit vid en förrättning enligt inlösningslagen (se exempelvis HD 1987:121). 
Den äganderätt som basfastighetens ägare har till utrymmen ovanför och under markytan är till sin karaktär alltid begränsad och de facto en elastisk rätt som ständigt förändras när samhället utvecklas och förändras. Om exempelvis ett myndighetsbeslut genom vilket det har varit förbjudet att nyttja underjordiska utrymmen eller naturresurser upphävs senare, kommer den ursprungliga ägarmakten att utvidgas eller återgå så att den motsvarar utgångsläget. Äganderättens elastiska karaktär kommer också till uttryck i att nya, även tidigare okända utnyttjandemöjligheter i princip alltid tillhör fastighetens ägare, och för att andra än ägaren ska kunna använda dem måste det i alla lägen finnas en laglig grund. 
I flera länder har man numera även i lagstiftningen utvidgat granskningen av fastigheter från horisontella fastigheter i markplanet, som i denna proposition kallas basfastigheter, till 3D-fastigheter. Vid en fastighetsförrättning kan utsträckningen för en 3D-fastighet anges förutom i det horisontella planet även i djup- och höjdled med koordinaterna x, y och z. Det innebär att fastighetens utsträckning bestäms vertikalt dels mot rymden, dels mot jordens innanmäte samt att dess läge bestäms. Utöver fastighetens tvådimensionella areal kan fastigheten uppmätas och uppfattas också som en tredimensionell helhet, exempelvis i sådana fall där fastigheten bildar en våning i en byggnad eller en underjordisk tunnel. 
Urbanisering har genererat ett behov av egentlig tredimensionell administrering av olika objekt. Urbanisering, förtätning av verksamheter och förläggning av dem ovanpå varandra har gett upphov till sådana helheter i realvärlden som det visat sig vara nödvändigt att administrera tredimensionellt även på nivån för registersystemet. I Finland har urbaniseringen ägt rum senare än i många andra europeiska länderna. Finland befinner sig i begynnelsestadiet när det gäller förtätning av städer och omfattande vertikal tillväxt för städer. Förläggning av olika typer av verksamheter helt eller delvis ovanpå varandra är den effektivaste och den mest praktiska handlingsmodellen inom flera projekt i dag och i framtiden. För att fastighetssystemets klarhet och koppling till realvärlden ska kunna säkerställas även i ett framtidsperspektiv bör också fastighetssystemet i Finland identifiera även andra än objekt som definieras i ett plan. 
Fastighetsindelningen har olika funktionella syften. En fastighet kan vara en registerenhet, ett föremål för omsättning, en driftsenhet som bildas av olika registerenheter (såsom en gårdsbruksenhet), ett föremål för verkställighet (såsom utmätning) och ett föremål för beskattning. Det centrala här är den karaktär av föremål för äganderätt som en enskild enhet inom fastighetsindelningen har. För det andra kan fastighetsindelningsenheterna, dvs. fastigheterna specificerade med en fastighetsbeteckning, vara föremål för flera olika typer av rättshandlingar, såsom överlåtelse eller arrende. För det tredje kan en fastighet i betydande grad nyttjas genom att den upplåts för pantsättning som säkerhet för lån. Till den del det enligt lagstiftningen i vissa länder blivit möjligt att bilda tredimensionella fastigheter avviker dessa i praktiken inte på något sätt från traditionella tvådimensionella s.k. basfastigheter när det gäller de funktioner som nämns ovan. 
Enligt 32 § 2 mom. i fastighetsbildningslagen ska fastigheter inom detaljplaneområden bildas så att styckning inte äventyrar genomförandet av planen. Planens konsekvenser för fastighetsbildningen har vid behov beroende på planläggarens prövning förenats med godkännande av en bindande tomtindelning. Inom området för en bindande tomtindelning får styckning inte förrättas så att det vid förrättningen uppkommer en ny fastighetsgräns som avviker från gränsen för ett byggnadskvarter eller för en sådan tomt som följer tomtindelningen (32 § 1 mom. i fastighetsbildningslagen). 
Tomtbildning enligt en bindande tomtindelning innebär genomförande av planen. Syftet är att få områdets ägandeförhållanden beträffande marken att motsvara planen innan man börjar bygga på området. Utgångspunkten i det nuvarande systemet är att en byggnad ska uppföras inom tomtgränserna. Innan byggandet kan påbörjas ska tomten vara i byggarens besittning och införd i fastighetsregistret (81 § i markanvändnings- och bygglagen). I dessa situationer tjänar fastighetsbildningen således fastighetens bebyggande och återspeglar den utgångspunkt för vårt rättssystem som innebar att fastighetsägaren får uppföra en byggnad på det område fastighetsägaren äger och att fastighetsägaren också betraktas som ägare till de byggnader som finns på området, om inte något annat har överenskommits eller bestämts om saken. 
Ändringar i den rådande fastighetsindelningen kan åstadkommas endast genom fastighetsförrättningar, som förrättas av en förrättningsingenjör på ansökan av markägaren. Äganderättigheter kan inte överföras genom detaljplaner. Befintlig äganderätt till mark kan inte heller direkt påverkas genom enskilda myndigheters beslut, ändrade skattebestämmelser eller allmänna principbeslut om förvaltningen. Ändringar i fastighetsindelningen ska göras genom fastighetsbildningsförrättningar på det sätt som föreskrivs i fastighetsbildningslagen. Fastighetsbildningsförrättningar bygger i regel på formbundna överlåtelseavtal eller andra avtal om ägararrangemang. Även inlösning av en del av en tomt enligt detaljplanen är en tänkbar grund för att få äganderätten till tomten i en och samma händer före en fastighetsbildningsförrättning. 
Med stöd av 156 § 3 mom. i fastighetsbildningslagen omfattar en fastighetsbildningsförrättning även ordnande av vägförbindelse till förmån för en nybildad fastighet, vid behov så att den belastar grannfastigheternas område genom en servitutsrätt, vägrätt eller någon annan nyttjanderätt. I de länder där bestämmelser om tredimensionell fastighetsindelning har utfärdats genom lag kommer även förbindelserna för färdsel att ordnas så som vid traditionell tvådimensionell fastighetsindelning. Inom detaljplaneområden strävar man efter att beakta ordnandet av förbindelserna redan i planläggningsstadiet, men det är ofta nödvändigt att stifta servitutsrättigheter vid fastighetsförrättningar, antingen på basis av ett avtal eller genom förrättningsingenjörens beslut för genomförande av planen. 
2.1
Lagstiftning och praxis
2.1.1
2.1.1 Fastigheter i lagstiftningen
Fastighetsbildningslagen, som trädde i kraft vid ingången 1997, innehåller inte några bestämmelser med förutsättningar för tredimensionell fastighetsbildning. De situationer där ägande eller besittning av tredimensionellt avgränsade fastigheter kan komma på frågan har reglerats i både fastighetsbildningslagen och fastighetsregisterlagen. Ett tvådimensionellt fastighetssystem står dock som utgångspunkt för den nuvarande regleringen. 
Med fastighet avses enligt 2 § i fastighetsbildningslagen en sådan självständig enhet för jordäganderätt som med stöd av fastighetsregisterlagen ska införas som fastighet i fastighetsregistret, och med annan registerenhet avses en annan fristående enhet som med stöd av den lagen ska införas i fastighetsregistret. En fastighet inbegriper det område som hör till den, andelar i samfällda områden och i gemensamma särskilda förmåner samt de servitutsrättigheter och enskilda särskilda förmåner som hör till fastigheten (fastighetens utsträckning). 
En förteckning över fastigheter och andra registerenheter finns i 2 § 1 mom. i fastighetsregisterlagen. I fastighetsregistret införs enligt det momentet som fastigheter 
1) lägenheter, 
2) tomter, 
3) allmänna områden, 
4) statens skogsmarker, 
5) skyddsområden som i enlighet med naturvårdslagen (1096/1996) eller tidigare gällande lagstiftning har inrättats på områden som tillhör staten (skyddsområde), 
6) områden som har avskilts genom inlösning (inlösningsenhet), 
7) områden som har avskilts för allmänna behov,  
8) fristående tillandningar, och 
9) allmänna vattenområden. 
Som andra registerenheter införs i fastighetsregistret samfällda områden samt biområden som enligt lagen om allmänna vägar (243/1954) besitts med vägrätt. På samma sätt som bestämmelserna i 2 § i fastighetsbildningslagen gäller förteckningen i 2 § i fastighetsregisterlagen det tvådimensionella fastighetssystemet. 
Jordabalken (540/1995), som gäller inskrivningsärenden, innehåller bestämmelser om bl.a. inskrivning av särskilda rättigheter. Vissa i jordabalken noggrant reglerade särskilda rättigheter som hänför sig till en fastighet får på ansökan inskrivas i lagfarts- och inteckningsregistret. Med stöd av 14 kap. 2 § i jordabalken är vissa jordlegorättigheter som omfattas av inskrivningsskyldighet också sådana att fordringsinteckningar kan fastställas i dem, på samma sätt som i lägenheter och tomter.  
Genom inskrivningsbara jordlegorättigheter har det i fastighetssystemet uppkommit sådana inteckningsbara enheter i vars s.k. anläggningsbeteckning fordringsinteckningar har kunnat fastställas. Dessutom har ett område som baserar sig på ett avtal om delning av besittningen mellan samägarna till en fastighet och som anvisats att besittas av en samägare med ensamrätt kunnat bildas av en i avtalet fastställd självständig del av en byggnad som finns på fastigheten. En sådan självständig del har kunnat få en anläggningsbeteckning och fordringsinteckningar har kunnat fastställas i den. Fordringsinteckningar har således kunnat beviljas i en kvotdel av en fastighet som omfattas av ett avtal om delning av besittningen. 
Med stöd av 154 § i fastighetsbildningslagen har till förmån för en fastighet eller kommunen kunnat stiftas servitutsrättigheter t.ex. för att förlägga och använda konstruktioner som behövs för befolkningsskyddet, för att förlägga och använda en för fastigheterna gemensam värmecentral, för att förlägga och använda en avloppsledning och andra till avledande och hantering av avloppsvatten hörande anordningar och konstruktioner samt för att förlägga och använda telefon-, el-, gas- och värmeledningar eller andra dylika ledningar samt tillhörande anordningar och konstruktioner. 
2.1.2
2.1.2 Nuvarande handlingsmodeller för ”tredimensionella” projekt
I fastighetsdatasystemet beskrivs fastighetsindelningen och fastighetsägandet enligt en tvådimensionell modell. I fastighetsregistret ingår fastigheter som angetts i plankoordinatsystemet och som är föremål för bl.a. fastighetsägande. Projekt som baserar sig på utnyttjande av fastigheter i realvärden genomförs dock alltid tredimensionellt. På grund av att tredimensionell fastighetsbildning är en omöjlighet måste man vid omfattande byggprojekt för närvarande ofta ta till lösningar som inte ursprungligen är avsedda som verktyg för ägande och besittning som bestäms tredimensionellt. 
Det vanliga tillvägagångssättet är att (bas)fastigheten är samägd i kvotdelar. Den faktiska besittningen av byggnaderna på fastigheten visas i ett tredimensionellt bestämt avtal om delning av besittningen utifrån vilket varje samägare till fastigheten har besittningsrätt till ett bestämt tredimensionellt utrymme och byggnadsrätt på fastigheten. Genom avtal om delning av besittningen har man i typiska fall också kommit överens om olika slags rättigheter och skyldigheter som hänför sig till exempelvis husteknik, färdsel eller lösning av tvister. 
Ett avtal om delning av besittningen är till sin karaktär ett privaträttsligt avtal, och om det inskrivs ska inskrivningen göras med främsta företräde i inskrivningssystemet. I inskrivningssystemet ingår då en anteckning om avtalet om delning av besittningen och om när det upphör, men ur fastighetsdatasystemet fås inga uppgifter om innehållet i avtalet. Uppgifter om de områden på fastigheten som parterna har besittningsrätt till liksom även om parternas inbördes rättigheter och skyldigheter ingår endast i de privaträttsliga avtal som parterna ingått. I samband med inskrivning har kopior av avtalen sparats bland handlingar som arkiveras, och den som vill bekanta sig med en handling ska hos inskrivningsmyndigheten anhålla om att få ta del av den. Det finns inte några särskilda krav på innehållet i avtalen om delning av besittningen. 
Det ursprungliga syftet med avtal om delning av besittningen som ingåtts av samägare till en fastighet har varit att lösa problem i synnerhet i anslutning till samäganderättsförhållanden på parhusfastigheter. Problemet framgår exempelvis av regeringens proposition med förslag till jordabalk och vissa lagar i samband med den (RP 120/1994), av motiveringen till 14 § 3 mom. i jordabalken: 
”Problem har förekommit särskilt i fråga om s.k. parhusfastigheter som inte har ombildats till bostadsaktiebolag. Det är oklart när ett avtal om nyttjande av en fastighet har bindande verkan mot en ny ägare av en kvotdel. Enligt lagen om vissa samäganderättsförhållanden (180/58) kan ett samägandeförhållande genom domstolsbeslut upplösas genom försäljning av hela fastigheten, om det inte är möjligt att avskilja en andel genom skifte. 
Enligt den föreslagna paragrafen kan vissa problem i samband med samägandeförhållanden elimineras genom inskrivning av besittningsavtal som innebär att delägarna får nyttja vissa områden av fastigheten eller vissa byggnader på den.” 
Den praxis att upprätta tredimensionella avtal om delning av besittningen som utformats ur dessa utgångslägen har förändrat användningsområdet för det avtal som inskrivs från det ursprungliga behovet och ökat antalet avtal. Efter ikraftträdandet av jordabalken har det årliga antalet inskriva avtal om delning av besittningen ökat från 236 år 1997 till 604 år 2014. Trots att ett ökat antal avtal om delning av besittningen inte korrelerar direkt med ett ökat behov av tredimensionell fastighetsbildning, står det klart att inskrivna avtal om delning av besittningen i allt högre grad har ingåtts för att bilda exempelvis inteckningsbara enheter på olika våningsplan i anslutning till köpcenter. I synnerhet dessa är objekt där de tredimensionella fastigheterna kan erbjuda ett nytt, effektivare sätt att agera. När man på en fastighet med flera ägare uppför en helhet vars besittning har delats upp mellan ägarna genom ett avtal om delning av besittningen, deltar samtliga fastighetsägare som sökande när bygglov söks. De som ansöker om bygglov har tillsammans hand om de praktiska arrangemangen för genomförandet av projektet, exempelvis genom att i enlighet med en gemensam ståndpunkt bemyndiga aktörer att företräda de sökande vid byggnadstillsynsförfaranden. Avtal om delning av besittningen kommer i regel inte till byggtillsynsmyndigheten för prövning annat än till de delar avtalen innehåller exempelvis bemyndigande att ansöka om bygglov. 
När lagstiftningen inte möjliggör bildande av 3D-fastigheter har man i motsvarande situationer också upprättat tredimensionellt bestämda avtal om arrende av mark. När jordlegolagen stiftades tänkte man inte på arrendeobjekten specifikt som tredimensionella objekt, utan i lagen föreskrivs det om situationer där en fastighet eller ett område av den tills vidare eller för viss tid upplåts på lega mot avgift. Av praktiska skäl har man också börjat ingå avtal om tredimensionellt bestämda objekt, utan något explicit stöd i lagstiftningen. I synnerhet vid byggande som gäller underjordiska utrymmen kan vissa problem som hänför sig till avtal om delning av besittningen lösas genom användning av tredimensionella avtal om arrende av mark. Under jorden agerar man dock sällan inom en enda markägares område. Det är då omöjligt att ingå avtal om arrende av mark eller det är i praktiken lika arbetskrävande att ingå sådana avtal som att förlita sig på avtal om delning av besittningen. Användningen av tredimensionella avtal om arrende av mark är även i övrigt förenad med motsvarande problem som avtalen om delning av besittningen när det gäller det invecklade avtalssystemet och olämplig lagstiftning. I fråga om avtal om arrende av mark framgår det av fastighetsdatasystemet enbart att avtalet finns och när det upphör, men inga uppgifter om arrendeområdet eller innehållet i avtalet i övrigt. Närmare uppgifter om arrendeområdet och innehållet i avtalet finns i handlingar som man hos inskrivningsmyndigheten särskilt ska anhålla om att få ta del av. För närvarande finns det ungefär 150 gällande tredimensionellt bestämda avtal om arrende av underjordisk mark där exempelvis Helsingfors stad är antingen arrendegivare eller arrendator (källa Helsingfors stad, fastighetsverket). 
Markanvändnings- och bygglagen innehåller bestämmelser om såväl byggnadsservitut (158 och 159 §) som tillstånd för placering av samhällstekniska anordningar, såsom ledningar (161 §). Det ingår i byggnadstillsynsmyndigheternas uppgifter att behandla och avgöra ärenden som gäller byggnadsservitut och tillstånd för placering. En anteckning om stiftande av ett servitut görs i fastighetsregistret för innehavaren av servitutsrätten och den belastade fastigheten. 
I 164 § i markanvändnings- och bygglagen föreskrivs det om samreglering av fastigheter. Samregleringen kan gälla exempelvis bilparkering, utrymmen för avfallshantering, rum som ökar boendetrivseln, gemensam bastu och tvättstuga samt ordnandet av gårdsområdet till ett öppet område för gemensamt bruk i ett slutet kvarter. Genom regleringen bestäms det hur området eller lägenheten ska användas, iståndsättas och underhållas samt hur kostnaderna för regleringen ska fördelas och betalas. Också för beslut om samreglering görs det en anteckning i fastighetsregistret. Införande i fastighetsdatasystemet av nyttjanderättigheter som stiftats genom byggnadstillsynsmyndighetens beslut om samregling baserar sig på 81 § i markanvändnings- och byggförordningen (895/1999). 
En tomtägare har rätt att bygga på sin tomt och få ett bygglov, om byggandet är förenligt med detaljplanen och även övriga villkor för beviljande av bygglov är uppfyllda. En byggnad får inte placeras eller byggas så att den orsakar en granne onödig olägenhet. För att bygglov ska beviljas förutsätts det att det finns en användbar infartsväg till byggplatsen och att vattentillgången och avloppsvattnet kan skötas på ett tillfredsställande sätt (135 § i markanvändnings- och bygglagen). I detaljplanen presenteras omfattningen av och ändamålet med byggandet samt principer som gäller byggnadernas läge (55 § i markanvändnings- och bygglagen). I planen kan man dessutom genom planbestämmelser uppställa villkor för byggandet och områdesanvändningen (57 § i markanvändnings- och bygglagen). 
Byggnadsservitut och beslut om samreglering behövs endast när byggandet eller annan användning av tomten på något sätt stöder sig på att en annan fastighet används. Byggandet eller användningen av byggnaden överskrider då fastighetsgränsen eller byggandet äger rum så nära gränsen att det måste genomföras på ett speciellt sätt som belastar användningen av den andra fastigheten. För en lösning som följer detaljplanen krävs det ofta servitut eller samregleringar (i synnerhet inom områden som ska bebyggas tätt). I regel kommer parterna överens om servitut eller samregleringar på avtalsbasis. I vissa fall kan servitut eller samregleringar stiftas också utan ett avtal (159 och 164 § i markanvändnings- och bygglagen), vilket dock är mycket sällsynt eftersom utgångspunkten är att samförstånd nås. Om beviljande av bygglov villkoras av stiftande av ett servitut, nämns detta som ett tillståndsvillkor i bygglovet. 
Ett byggnadsservitut kan stiftas endast om servitutet är nödvändigt för innehavaren av servitutsrätten och det inte medför betydande olägenhet för den belastade fastigheten (158 § i markanvändnings- och bygglagen). På motsvarande sätt kan ett förordnande om samreglering utfärdas, om regleringen främjar användningen av flera fastigheter och inte orsakar någon fastighet oskälig belastning (164 § i markanvändnings- och bygglagen). Dessa villkor ska vara uppfyllda också när det handlar om ett avtalsbaserat servitut eller en avtalsbaserad reglering. Ett syfte med inskrivningen av servitut och avtal om samreglering är att säkerställa att de hålls i kraft även om fastigheten övergår i någon annans ägo (81 § i markanvändnings- och byggförordningen). 
Byggnadsservitut och samregleringar används i någon mån även i situationer med tredimensionell fastighetsförvaltning, trots att bestämmelserna har utformats och oftast används för att reglera förhållanden mellan traditionella tvådimensionella tomter. Exempelvis på området för Kampens centrum i Helsingfors har man gått in för en samreglering som berör fem tomter på två kvarters område och fyra allmänna områden. Kampens samreglering gäller bl.a. trafikförbindelser, konstruktioner, grunder, VVS-teknik, elteknik och brandsäkerhet. Inom området har man dessutom stiftat byggnadsservitut mellan fastigheterna. För samförvaltning av en byggnad eller en helhet som ihopbyggda byggnader bildar exempelvis just i köpcenter behövs det avtal om användningen av lokalerna och om underhållet. Bara en del av avtalen och villkoren i dem har karaktär av sådana samregleringar som avses i 164 § i markanvändnings- och bygglagen och som i och med registrering får ett permanent skydd vid fastighetens ägarbyten. 
Om en detaljerad planering av markanvändningen är nödvändig endast för byggande eller annan användning av underjordiska utrymmen, kan detaljplanen enligt 56 § i markanvändnings- och bygglagen utarbetas etappvis så att den omfattar endast underjordiska områden. På ett område där detaljplanen omfattar endast underjordiska utrymmen, tillämpas de bestämmelser i markanvändnings- och bygglagen eller i andra lagar som gäller områden som saknar detaljplan och som styr markanvändningen ovan jord. Enligt 78 § 5 mom. i markanvändnings- och bygglagen ska bestämmelserna om tomtindelning dock inte tillämpas på området för en detaljplan för underjordiska utrymmen. I nuvarande form hindrar bestämmelsen i praktiken bildandet av tredimensionella tomter i underjordiska utrymmen. 
2.1.3
2.1.3 Markförvärv
För genomförandet av detaljplaner krävs det ofta ägararrangemang som gäller fastigheterna, eftersom områdesgränserna, kvarteren och tomterna enligt planerna inte alltid motsvarar den gällande fastighetsindelningen. Detsamma gäller tomter som anvisats i en bindande tomtindelning. Förvärv av en tomt enligt en bindande tomtindelning och ägande eller innehav som tillfaller samma aktör är en förutsättning för förverkligande av tomten, dvs. byggande på tomten. Det kan handla om antingen att äga ensam eller att samäga i kvotdelar. Så som redogjorts i det föregående bygger tredimensionell besittning av utrymmen i dag ofta på att en tomt är samägd i kvotdelar. Ägandet kan tillfalla en byggherre antingen genom köp eller genom annat frivilligt förvärv eller genom inlösning som en tvångsåtgärd. 
En byggherre kan bli enda ägare till enskilda byggplatser inom ett detaljplaneområde eller plantomter enligt en bindande tomtindelning genom det förfarande för inlösning av en del av en tomt som avses i 62 § i fastighetsbildningslagen. Oberoende av markägande har kommunen då sekundär rätt att lösa in tomten med äganderätt (se även 62 a och 62 b § i fastighetsbildningslagen). Ägandet av en plantomt enligt detaljplanen kan också tillfalla samma aktör genom ett obligatoriskt ägobyte enligt 64 § i fastighetsbildningslagen. 
Inom detaljplaneområden har markförvärv som en tvångsåtgärd i hög grad genomförts vid ett förfarande enligt inlösningslagen och så att inlösningsgrunden i fråga om detaljplaneområden vanligen har funnits i markanvändnings- och bygglagen. Exempelvis med stöd av 96 § i markanvändnings- och bygglagen får kommunen utan särskilt inlösningstillstånd lösa in ett sådant allmänt område samt en sådan tomt enligt detaljplanen för en allmän byggnad som i detaljplanen avsetts för kommunens behov. Utifrån detta kan kommunen t.ex. lösa in ett område som i detaljplanen för kommunens behov anvisats för underjordiskt byggande (t.ex. en metrotunnel), för att begränsa den egentliga markägarens nyttjanderätt. I dessa fall av inlösning av underjordiska utrymmen kvarstår äganderätten hos markägaren medan inlösaren bara får nyttjanderätt till det underjordiska utrymmet. En metrotunnel eller en underjordisk parkeringshall kan således inte på denna grund ombildas till en inteckningsbar fastighet. 
2.1.4
2.1.4 Förhållande till bostads- och fastighetsaktiebolagssystemet
Enligt lagen om bostadsaktiebolag (1599/2009) äger en delägare aktier som berättigar till att besitta en viss lägenhet i en byggnad, medan bolaget har äganderätten till byggnaden som en odelad helhet. Något sådant juridiskt sätt att dela besittningsrätten till en byggnad som i Finland gäller både bostadsaktiebolag och fastighetsaktiebolag har man inte gått in för exempelvis i Sverige eller Danmark, utan där äger delägaren lägenheten och är samtidigt delägare i byggnaden. Den institution med bostadsaktiebolag och fastighetsaktiebolag som Finland gått in för är ett sällsynt undantag i en internationell jämförelse. I Finland får ett bostadsaktiebolag eller ett fastighetsaktiebolag ansöka om inteckning i en fastighet som bolaget har lagfarit eller hyrt ut (14 kap. 2 § i jordabalken). Dessutom kan enskilda delägare i bolaget använda sina aktier som lös pant och därmed som säkerhet för lån. Modellen med bostadsaktiebolag enligt den nuvarande lagstiftningen i Finland är trots sin exceptionella karaktär erkänt fungerande, och det är inte meningen att de ändringar som nu föreslås ska påverka ägarlösningarna för enskilda bostäder. 
På samma sätt som i fråga om bostadsaktiebolag är det meningen att den möjlighet enligt gällande lagstiftning att bedriva verksamhet i form av fastighetsaktiebolag och ömsesidiga fastighetsaktiebolag ska kvarstå oförändrad i samband med ändringen. Ett fastighetsaktiebolag är i praktiken ett normalt aktiebolag som administrerar fastigheter och på vilket aktiebolagslagen (624/2006) tillämpas. Ett ömsesidigt fastighetsaktiebolag som bildats för att äga och administrera en fastighet, dess byggnader och utrymmen i byggnaderna är ett i 28 kap. 2 i lagen om bostadsaktiebolag avsett annat aktiebolag än ett bostadsaktiebolag. Enligt bolagsordningen har det till syfte att äga och besitta minst en byggnad eller del av byggnad, och varje aktie ensam för sig eller tillsammans med andra aktier medför rätt att besitta en i bolagsordningen angiven lägenhet i bolagets byggnad eller någon annan del av en byggnad eller av en fastighet. På ömsesidiga fastighetsaktiebolag tillämpas bestämmelserna i lagen om bostadsaktiebolag med vissa undantag. 
I fortsättningen kommer bostadsaktiebolag och fastighetsaktiebolag naturligtvis att kunna äga och besitta även 3D-fastigheter. Besittningen av dem kommer att fördelas mellan delägarna på motsvarande sätt som för närvarande i enlighet med bestämmelserna om bolagsformen i fråga. 
2.1.5
2.1.5 Grannelagsförhållanden
Vid bedömning av de inbördes förhållandena mellan eventuella 3D-fastigheter inom samma byggnadskomplex kan en central fråga anses vara vilka konsekvenser användningen och underhållet av en 3D-fastighet har för de övriga 3D-fastigheterna inom samma komplex. I detta avseende gäller det att fästa uppmärksamhet vid bl.a. behovet av att bedöma tillämpningen av lagen angående vissa grannelagsförhållanden (26/1920) ur perspektivet för 3D-fastighetsbildning. 
Lagen angående vissa grannelagsförhållanden gäller i huvudsak olika olägenheter (immissioner) som användningen av egendom (genom antingen handlingar eller försummelser) orsakar grannar. Även annan lagstiftning innehåller bestämmelser om vissa andra typer av grannelagsförhållanden. Exempelvis på miljöolägenheter tillämpas i dagsläget miljöskyddslagen (527/2014) och lagen om ersättning för miljöskador (737/1994), och frågor som gäller sanitära olägenheter avgörs i första hand utifrån hälsoskyddslagen (763/1994). 
En central bestämmelse om olägenhet som orsakas av användningen av en fastighet finns i 17 § i lagen angående vissa grannelagsförhållanden. Enligt den paragrafen får en fastighet, byggnad eller lägenhet inte användas så att grannarna eller de som bor eller innehar fastigheter, byggnader eller lägenheter i närheten orsakas oskäligt besvär av ämnen som är skadliga för miljön, sot, smuts, damm, lukt, fukt, buller, skakning, strålning, ljus, värme eller annan motsvarande påverkan. Enligt 18 § ska den som orsakat oskäligt besvär se till att besväret upphör och ersätta den skada som besväret orsakat (för begränsningar se 19 §). Eftersom begreppet granne inte egentligen definieras i lagen angående vissa grannelagsförhållanden, blir bestämmelserna i princip direkt tillämpliga även på de inbördes förhållandena mellan 3D-fastigheter i sådana situationer som enligt gällande praxis för tillämpning av lagen kan tolkas som grannelagsförhållanden. 
Dessutom kan vissa andra bestämmelser i lagen angående vissa grannelagsförhållanden eller åtminstone de principer som framgår av dem bli tillämpliga också på inbördes förhållanden mellan 3D-fastigheter. Som exempel kan nämnas 9–11 och 13 §, som gäller skador som grannar orsakas genom grävningsarbeten och andra arbeten på en fastighet, samt 12 §, som gäller skada som grannar orsakas av att en byggnad hotar att instörta. Via de principer som framgår av bestämmelserna samt via den omfattande tolkningspraxis som gäller dem kan man i princip bedöma även de inbördes förhållandena mellan 3D-fastigheter och förhållandena mellan 3D- och 2D-fastigheter. 
2.2
Den internationella utvecklingen samt lagstiftningen i utlandet och i EU
2.2.1
2.2.1 Den internationella utvecklingen
Tredimensionella fastigheter och registrering av tredimensionella äganderättsenheter används allmänt i världen. Även utvecklingsprojekt som gäller 3D-fastighetssystem pågår som bäst i flera länder. I dag handlar det vanligen om teknisk systemutveckling, eftersom man i flera länder redan tidigare har kunnat registrera tredimensionellt bestämda äganderättsenheter. Det har varit mycket vanligt att man i jordeboken har registrerat t.ex. bostadslägenheter, dvs. tredimensionellt bestämda enheter, men dessa har inte kunnat hanteras som tredimensionella objekt i informationssystemen. Tredimensionell bestämning har kunnat grunda sig på exempelvis en plan som står nära den finländska tomtindelningen. Beroende på bakgrunden till fastighetssystemet kan en registrerad rätt till en bostadslägenhet vara antingen äganderätt eller nyttjanderätt. 
Med kataster avses ett systematiskt, offentligt och tidsenligt register över fastigheterna inom ett visst område och sådana registerenheter som motsvarar dem. 3D-katasterprojekt handlar vanligen inte om att möjliggöra bildningen av 3D-fastigheter och uppkomsten av tredimensionella äganderättsenheter, utan snarare om att utveckla katastret eller jordeboken i teknisk mening antingen till ett genuint 3D-system eller så att förutsättningarna att administrera och presentera uppgifter om 3D-objekt förbättras på annat sätt. Nivån på det tekniska genomförandet varierar från ett land till ett annat. Vissa länder strävar efter ett system där 3D-fastigheterna förs in i fastighetsregistret som tredimensionella modeller. För närvarande är det dock vanligare att 3D-fastigheterna bara presenteras med olika slags referensuppgifter och områdesavgränsningar på en traditionell fastighetsregisterkarta. 
Även fastighetsregistrens användningsändamål varierar från ett land till ett annat. I vissa länder ingår t.ex. även byggnads- och bostadslägenhetsregisteruppgifter i datainnehållet i fastighetsregistret. I Finland finns motsvarande uppgifter i Befolkningsregistercentralens datalager som är fristående från fastighetsregistret. I system som innehåller byggnads- och bostadslägenhetsregisteruppgifter kan 3D-katasterprojekt innebära att byggnaderna modellbeskrivs som 3D-objekt för att möjliggöra olika analyser av geografisk information t.ex. som grund för planläggning. I fastighetsdatasystemet i Finland förvaltas endast uppgifter om fastigheter och deras utsträckning samt inskrivningsärenden som hänför sig till fastigheter. 
2.2.2
2.2.2 Sverige
Av historiska orsaker motsvarar fastighetssystemet i Sverige fastighetssystemet i Finland, trots att det under autonomins tid efter 1809 har skett en juridisk och även annan differentiering. I Finland har man i många fall använt Sveriges motsvarande fastighetslagstiftning som exempel, och därför har länderna alltjämt i hög grad sammanfallande regleringar av fastighetssystemet. 
Den viktigaste skillnaden mellan Sveriges lagstiftning om fastighetsbildning i förhållande till Finlands är att i Sverige binds fastighetsbildningen vid ändamålsenligheten för den fastighet som bildas. Med stöd av 3 kap. 1 § fastighetsbildningslagen ska förrättningsingenjören i samband med fastighetsbildning alltid bedöma om de fastigheter som bildas kan anses varaktigt lämpade för det avsedda ändamålet (det allmänna lämplighetsvillkoret). Enligt Sveriges jordabalk är fast egendom jord, som är indelad i fastigheter. Fastigheterna avgränsas antingen endast horisontellt (2D) eller både horisontellt och vertikalt (3D). 
I Sverige trädde lagstiftning som möjliggör tredimensionell fastighetsbildning i kraft vid ingången av 2004. Tredimensionell fastighet definieras i 1 kap. 1 a § 1 punkten i fastighetsbildningslagen. Enligt definitionen handlar det om en fastighet som i sin helhet är avgränsad både horisontellt och vertikalt. En fastighet som har bestämda gränser både horisontellt och vertikalt kallas tredimensionell fastighet eller tredimensionell fastighetsutrymme. Enligt 3 kap. i fastighetsbildningslagen ska den tredimensionella fastigheten tillförsäkras de rättigheter som behövs för att den ska kunna användas på ett ändamålsenligt sätt. I Sverige kan en 3D-fastighet vara 
- en 3D-fastighet som i sin helhet är avgränsad både horisontellt och vertikalt, 
- ett 3D-skifte som ingår i en 2D-fastighet, eller 
- en lägenhet som registrerats som 3D-fastighet. 
Det allmänna lämplighetsvillkoret för fastighetsbildning gäller även när tredimensionella fastigheter bildas genom styckning där förrättningsingenjören utifrån 3 kap. 1 § i fastighetsbildningslagen ska pröva ändamålsenligheten. När det gäller plantomter prövas motsvarande omständigheter i Finland redan i samband med detaljplanläggningen. När planen och den bindande tomtindelningen följs behövs det således inte längre någon separat prövning av ändamålsenligheten i samband med fastighetsbildning inom detaljplaneområden. Med tanke på det allmänna behovet av att bilda tredimensionella fastigheter skiljer sig Sverige från Finland förutom i fråga om den fastighetsrättsliga principen för prövning av ändamålsenligheten också på så vis att arrenderätt inklusive byggnader inte kan intecknas. I Finland innebär tillräckligt långvariga avtal om arrende av mark i praktiken förhållandevis bra inteckningssäkerhet. 
I Sverige kan en tredimensionell fastighet omfatta även fler skiften än ett. Med ett tredimensionellt fastighetsutrymme avses ett skifte (volym) som ingår i en traditionell fastighet som ett utrymme som tillhör fastigheten och är avgränsat både horisontellt och vertikalt. En tredimensionell fastighet kan gränsa till antingen gränsen för en traditionell 2D-fastighet eller vara ett sådant slutet utrymme avgränsat horisontellt och vertikalt som inte gränsar till gränsen för den traditionella 2D-fastighet till vilken det tredimensionella utrymmet hör. 
Som ett särskilt villkor som kompletterar den allmänna prövningen av ändamålsenligheten föreskrivs det i 3 kap. 1 § i fastighetsbildningslagen att en tredimensionell fastighet eller ett tredimensionellt fastighetsutrymme får nybildas eller ombildas vid fastighetsreglering endast om det står klart att åtgärden är lämpligare än andra åtgärder för att tillgodose det avsedda ändamålet. Ett 3D-förfarande bör inte inledas om exempelvis gemensamma vägförbindelser, lekparker, bilplatser, trappuppgångar, hissar, ledningar och andra motsvarande konstruktioner kan genomföras genom avtal eller genom upplåtelse av servitutsrätt. I Sverige är således upplåtelse av servitutsrätt ett alternativ till att bilda en tredimensionell fastighet. Servitutsrätt kan upplåtas mellan fastigheter som avtalsservitut, officialservitut, gemensamhetsanläggningar i enlighet med anläggningslagen eller som servitutsrätt enligt ledningsrättslagen. Ett avtalsservitut kan stiftas också utan någon myndighetsåtgärd. I övriga fall är stiftandet av ett servitut alltid förenat med ett myndighetsavgörande vid en fastighetsförrättning eller i övrigt. Lagstiftningen i Sverige innehåller inte någon motsvarande princip om typtvång för servitut som den som gäller enligt markanvändnings- och bygglagen och fastighetsbildningslagen i Finland. 
I 3 kap. 9 § i fastighetsbildningslagen i Sverige ingår undantagsbestämmelser som möjliggör fastighetsbildning även i det fallet att den nya fastighet eller del av fastighet som bildas som ett resultat av förrättningen inte till alla delar uppfyller lämplighetskriteriet enligt 3 kap. 1 § i fastighetsbildningslagen. En förutsättning är då att nybildning eller ombildning innebär att den befintliga fastighetsindelningen förbättras och att åtgärden inte motverkar en mer ändamålsenlig fastighetsindelning. Utöver detta är grundprincipen i Sverige att en tredimensionell fastighet ska rymma en hel byggnad eller en del av en sådan. Ett undantag är situationer där det gäller att trygga exempelvis finansieringen för projektet och det kan antas att fastigheten får användning för sitt planerade ändamål inom en nära framtid. Då kan man också bilda en s.k. luftfastighet utan någon befintlig byggnad. I dessa fall fattar förrättningsingenjören beslut om den maximala tiden för genomförande av byggprojektet. Om projektet inte genomförs inom utsatt tid eller om den befintliga byggnaden förstörs, återgår 3D-fastigheten till fastigheten på markytan. 
Lägenheter som registreras som 3D-fastigheter bildas som lägenhetsfastigheter. Sådana fastigheter kan bildas endast i nya byggnader. En 3D-fastighet som bildas för bostadsändamål ska omfatta minst tre lägenheter. Förvaltningen av lägenheter som registrerats som 3D-fastigheter regleras genom en särskild lag, nämligen lagen om förvaltning av samfälligheter (1973:1150). 
Allmänna grannelagsrättsliga principer och miljöskyddsprinciper som gäller fastigheter generellt gäller även tredimensionella fastigheter. Huvudregeln för grannelagsrätt finns i 3 kap. 1 § i jordabalken. Enligt den paragrafen ska var och en vid nyttjande av sin eller annans fasta egendom ta skälig hänsyn till omgivningen. Denna skyldighet har accentuerats med avseende på 3D-fastigheter, eftersom byggarbeten som hänför sig till bildningen av dem, samt skötsel av dem eller vanvård inverkar speciellt kraftigt på fastigheterna invid och på byggnaderna på dem. Den som blivit lidande på grund av en dåligt underhållen fastighet har rätt till ersättning för skadan. Dessutom kompletterar inlösningsbestämmelserna i 8 kap. i fastighetsbildningslagen de grannelagsrättsliga bestämmelser i jordabalken som nämns ovan. Inlösningsbestämmelserna kan i sista hand leda till att en 3D-fastighet genom tvångsvis inlösen överförs till grannfastighetens ägare som en del av dennes fastighet eller alternativt till den kommun där fastigheten finns. Inlösen villkoras av att en anläggning som i sin helhet hör till en 3D-fastighet har skadats i sådan utsträckning att den måste ersättas med en ny och detta förhållande väsentligt försvårar användningen av en angränsande fastighet. I första hand kan grannfastighetens ägare vidta inlösningsåtgärder, men även kommunen kan begära inlösen. Om inte inlösen vidtas fogas 3D-fastigheten genom myndighetsåtgärder till de fastigheter ”inom” vilka den finns (till de urholkade fastigheterna)
Utgångspunkten är att tredimensionella fastigheter eller utrymmen bildas för ett permanent behov. I Sverige är fastighetsbildning starkt förenad med fastighetens ändamålsenlighet, och därför har man i lagen tagit in bestämmelser som gäller situationer där fastigheten eller användningen av den inte längre motsvarar ändamålet. I Sverige finns det ingen särskild reglering som gäller för hur 3D-fastigheternas gränser ska införas i fastighetsregistret. Det område där en 3D-fastighet finns redovisas på en fastighetsregisterkarta, och dessutom används en förrättningskarta av vilken 3D-fastighetens utsträckning framgår. 
2.2.3
2.2.3 Norge
I Norge fördes de första underjordiska parkeringsanläggningar redan på 1980-talet in i inskrivningssystemet som egna enheter. Den viktigaste praktiska orsaken till att inskriva parkeringsanläggningarna som egna registerenheter var då behovet av att skapa tydliga enheter för inteckning för ordnande av den finansiering som projekten behövde. I fastighetsregistret (matrikel) har man dock först från år 2010 kunnat anteckna en anläggningsfastighet (anleggseiendom) som en ny typ av registerenhet som också kan vara tredimensionellt bestämd (volym)
Som olika typer av registerenheter i fastighetsregistret kan urskiljas basfastighet (grunneiendom), den nämnda typen anläggningsfastighet, bostadsandelsfastighet (eigarseksjon), samfällt område (jordsameige) och andel i borättslag (andel i borettslag). Alla utom den sistnämnda införs i matrikeln. Motsvarigheten till Finlands fastighetsdatasystem (FDS) GAB (Grunneiendoms-, Adresse- og Bygningsregister) innehåller till skillnad från FDS även adress- och byggnadsuppgifter. 
Med undantag för vissa avtalsservitut ändras fastighetsindelningen även i Norge genom en fastighetsförrättning. De servitut som belastar fastigheten kan berättiga även personer. Servituten kan vara föremål för omsättning separat, även om de i normala fall övergår samtidigt som hela fastigheten överlåts. 
I 5 § i fastighetsregisterlagen definieras 3D-fastighet som följer: 
”b) anleggseigedom, ein bygning eller konstruksjon, eller eit avgrensa fysisk volum som er tillate utbygt, og som er utskilt som eigen eigedom. Fast anlegg på eigarlaus sjøgrunn eller i eigarlaus undergrunn kan også opprettast som anleggseigedom.” 
Det (vertikala) ägande av traditionella fastigheter som är relevant för bildandet av tredimensionella fastigheter sträcker sig i Norge så högt och så lågt som ägaren anses ha intressen. I normala fall har tolkningen varit att ägarens intressen sträcker sig ungefär 7–14 meter under markytan. Ägandet kan utvidgas när mark tas i användning på ett djupare plan än så, rent konkret exempelvis vid borrning av en borrbrunn, som kan ha ett betydligt större djup än det som nämns ovan. När 3D-fastigheter bildas under markytan erhålls äganderätten utanför den nämnda utsträckningen för äganderätten till basfastigheten i huvudsak genom inmutning. I dessa fall grundar förvärvet sig således inte på normal överlåtelse, och ägaren till basfastigheten i markplanet får ingen ersättning för det underjordiska byggandet på basis av inmutningen. 
I Norge är det en förutsättning för bildande av en tredimensionell fastighet (anläggningsfastighet) att det finns planläggning för byggnadens eller konstruktionens gränser och en i bygglagen (plan- og bygningslov) avsedd tillräcklig utredning, som således utgör grund för bildandet av anläggningsfastigheten. Detsamma gäller också när en befintlig byggnad omvandlas till en anläggningsfastighet. För fastighetsbildning krävs det också ett obligatoriskt tillstånd av kommunen. En ytterligare förutsättning för bildande av en anläggningsfastighet är att både den nya anläggningsfastigheten och den fastighet som kvarstår efter styckningen kan användas som en självständig funktionell helhet. Registrering av fastighetsgränserna för tredimensionella fastigheter grundar sig på byggnadsplaner som presenteras som yttre gränser på en tvådimensionell fastighetsregisterkarta. 
Inom krävande, stora och komplexa egendomsutvecklingsprojekt har man i Norge framhållit vikten av samarbete mellan alla parter, inbegripet även kommunala och statliga planläggnings- och fastighetsregistermyndigheter. Den slutliga strukturen för äganderättsenheter (ägararkitektur) som införs i fastighetsregistret ska då vara känd i ett så tidigt skede av projektet som möjligt. Detta omspänner hela processen ända från planläggning och bygglovsförfarande till införande av nya 3D-fastigheter i matrikeln. 
Om ett 3D-projekt som fått tillstånd inte har inletts inom tre år från det att bygglovet beviljades eller om projektet avbryts för en längre tid än två år, upphävs tillståndet och upphör 3D-fastigheten (anläggningsfastigheten) att existera. Samtidigt avförs den ur fastighetsregistret och 3D-fastigheten återgår till den fastighet eller de fastigheter ovanför eller under vilken eller vilka den hade bildats. 
Den viktigaste skillnaden i förhållande till Sveriges system är att i Norge får man inte bilda en anläggningsfastighet så att den sträcker sig till en annan fastighets område samtidigt som den är en del av basfastigheten invid. I Norge ska ett underjordiskt utrymme av detta slag som sträcker sig under grannfastigheten bilda en självständig fastighet. Vid pantsättning gäller det att beakta att hela driftsenheten med sina många olika registerenheter intecknas vid behov. En annan skillnad mot Sverige är att man i Norge inte kan bilda en anläggningsfastighet på så sätt att en byggnad eller byggnader som hör till en basfastighet omfattar flera olika 3D-fastigheter (anläggningsfastigheter). En anläggningsfastighet får inte heller omfatta flera olika skiften. 
I Norge har man sedan 2010 hittills bildat sammanlagt 505 3D-fastigheter. När behovet av tredimensionella objekt ökar och systemet har blir mera känt har antalet objekt ökat kontinuerligt, och det årliga antalet nya 3D-fastigheter har stigit i jämn takt från 20 fastigheter år 2010 till sammanlagt 102 fastigheter år 2015. 
2.2.4
2.2.4 Allmänt om utländska system
Fastighetssystemen i olika länder avviker från varandra, och därför kan utgångspunkterna för lagstiftning som gör det möjligt att exempelvis bilda 3D-fastigheter variera i till och med mycket hög grad. Även definitionerna av fastigheter och deras utsträckning avviker från varandra. I Finland, Sverige, Norge och Danmark har man av hävd ansett att till en fastighet hör förutom markområdet även de byggnader som finns där, om de ägs av markägaren. Byggnaderna hör då till fastigheten som beståndsdelar, och endast i de situationer som anges särskilt i lag förhåller det sig så att byggnaderna på en fastighetsenhet eller på ett outbrutet område inte hör till fastigheten. I vissa länder, såsom i Tyskland och Ryssland, kan en byggnad eller till och med en enskild bostadslägenhet bilda en fastighet som registreras. Då har i synnerhet arrangemanget för ägande av lägenheten som en del av fastighetssystemet ansetts vara betydelsefullt. 
Lösningarna för arrangemangen för ägande av radhus- och höghuslägenheter är vanligen nationella. Ett allmänt förfarande är att det hus (och den tomt) som omfattar lägenheter införs i fastighetsregistret som en särskild registerenhet så att varje lägenhet har andel i tomten samt i de gemensamma utrymmena och delarna, såsom trappuppgångarna. För denna fastighetsregisterenhet används olika benämningar i olika länder, såsom condominium (i vida kretsar i Europa, Kanada och Förenta staterna), strata (Australien) och sectional (Sydafrika). Inom condominium-systemet framgår av fastighetsregistret förutom basfastigheten och dess typ även varje lägenhets identifikationsnummer, storlek och läge samt gemensamma utrymmen. När det gäller lägenheter har man i fastighetsregistret lagrat dokument som visar deras utsträckning, exempelvis tvärsektioner och planritningar för varje våning. Varje lägenhetsägare får lagfart på lägenheten, vilket också är ett villkor för inteckning. Äganderätten till marken under byggnaden kvarstår hos lägenhetsägaren även om byggnaden förstörs, vilket har ansetts öka tryggheten hos systemet som ägarform. 
I Sverige, Danmark och Norge ingår ägarbostadsfastigheter (ägarlägenheter) i respektive rättssystem i en betydelse som är främmande för Finland. Ägarbostadsfastighetens delägare äger en lägenhet och är samtidigt delägare i byggnaden. I Danmark och Norge bildas en ägarbostadsfastighet genom indelning av byggnaden och införande av delningen i ett inskrivningsregister som motsvarar lagfarts- och inteckningsregistret i Finland. Något liknande system med bostadsaktiebolag som det som gäller enligt den finländska modellen har däremot inte införts någon annanstans. Förutom i Sverige och Norge är bildning av 3D-fastigheter för andra ändamål än lägenheter möjlig även i bl.a. Storbritannien, Grekland, Frankrike, Israel, Singapore och Australien. I allmänhet har en tredimensionell fastighet alltid som sin kärna en byggnad, en anläggning eller en del av dessa. Huvudregeln är att en tredimensionell fastighet inte kan innehålla enbart luft eller ett underjordiskt utrymme som inte har insprängts, utan fastigheten måste vara bebyggd. Undantagna är av praktiska skäl sådana situationer där det för byggandet är nödvändigt att fastigheten intecknas redan innan byggprojektet inleds. 
I samband med fastighetsbildning gör man i Sverige och Norge en helhetsprövning av om ändamålet eller målet med byggnaden eller anläggningen nås bäst genom att det bildas en 3D-fastighet eller på något annat sätt. Om målet kan nås även på något annat sätt, ska ingen tredimensionell fastighet bildas. I bägge länderna får tredimensionella fastigheter bildas också utanför detaljplaneområden. I Sverige och Norge används 3D-fastighetsindelning således endast för att komplettera den traditionella tvådimensionella fastighetsindelningen. Om genomförandemetoderna enligt det traditionella systemet visar sig vara otillräckliga, kan 3D-fastighetsbildning tas i bruk i andra hand. 
På bildandet av tredimensionella fastigheter tillämpas i allmänhet samma fastighetsbildningslagstiftning som på alla andra fastigheter. Det fysiska markområde som hänför sig till en fastighet är inte det centrala med tanke på fastighetsbildningen, utan det viktiga är hur de objekt som i praktiken införs i vissa register definieras och hur det regleringssystem som gäller objekten utvecklas. För en ändamålsenlig användning och skötsel av tredimensionella fastigheter har man exempelvis i Sverige också i den lag som gäller förhållanden mellan grannar tagit in specialbestämmelser som ska tillförsäkra rättigheter som är nödvändiga för användningen av fastigheterna. En bebyggd tredimensionell fastighets fasta fysiska kontakt med angränsande andra fastigheters byggnader och konstruktioner medför bl.a. sådana problem relaterade till ansvaret för ordnande av underhåll som inte förekommer i ett tvådimensionellt fastighetssystem. För inrättandet av tredimensionella fastigheter har det därför i Sverige behövts specialreglering som gäller exempelvis fastighetsägarens fullgörande av den underhållsskyldighet som gäller fastigheten. 
2.3
Bedömning av nuläget
Enligt gällande lag i Finland är tvådimensionell fastighetsindelning den enda möjligheten. Under de senaste årtiondena har utvecklingen dock medfört ett allt större behov av att dela upp äganderätten till fastigheter enligt tre utsträckningar uttryckta med koordinaterna x, y och z. De faktiska situationer där det har uppdagats behov av tredimensionell fastighetsindelning gäller i praktiken stora projekt som kräver mycket kapital och som det ofta är mycket komplicerat att genomföra och där man planerar att i byggnaderna och de övriga konstruktionerna samtidigt förlägga separata och olika slags funktioner. 
Antalet stora och komplexa byggprojekt förutspås öka i framtiden, så som har skett även på annat håll i världen. I den moderna samhällsstrukturen med en allt tätare markanvändning accentueras behovet av att utnyttja områdena på ett mångsidigt sätt och i olika plan. Dels behovet av utrymme för nybyggnad, dels målet att bevara parker och andra liknande obebyggda stadsutrymmen i markplanet kan öka behovet av att bygga under och ovanför markytan. Detta kan ses i detaljplanerna för centrumområden i stora städer där man med planer och planbestämmelser för underjordiska utrymmen har styrt byggandet till olika nivåer enligt användningsändamålet. Stora projekt genomförs i stor mängd på redan tätbebyggda områden, varvid det ofta skulle vara mest effektivt att åtskilja olika användningsändamål genom egna fastigheter även i höjdled. Parterna i projektet vill ofta på besittningsmässiga eller finansiella grunder dela upp fastigheterna med byggnader så att byggnaderna och delarna av dem, på samma sätt som självständiga fastigheter, kan ägas, besittas och användas separat som säkerhet. Dessutom kan den effektivaste modellen för att utnyttja den kvarstående befintliga infrastrukturen som en del av den nya bebyggelsen gå ut på att nybyggnadsprojekt genomförs så att utrymmen under och ovan jord utnyttjas i samband med sådana befintliga konstruktioner på markytan som ska bevaras. 
Underjordiska parkeringshallar byggs bl.a. i stadscentrumområden för att fullgöra fastigheternas bilplatsskyldigheter eller som allmänna torgparkeringar. Läget för och anläggandet av parkeringshallar baserar sig på detaljplanebestämmelser, där måltomternas bilplatser placeras i en gemensam underjordisk bilhall, vanligtvis på området för flera tomter. Allmänna underjordiska torgparkeringar finns ofta under allmänna områden, såsom torg, men de kan också finnas under byggnadskvarter. I dagens läge kan tomtägarna överlåta bilhallsutrymmen till byggherren genom avtal om arrende av mark. 
Tredimensionell fastighetsindelning kan i vissa fall bli aktuell också i samband med vissa funktioner som reserverats för trafik och transport. Sedan gammalt har exempelvis rättigheterna för underjordiska järnvägar i Helsingfors att nyttja tunnelutrymmen under ett stort antal fastigheter säkerställts genom servitutsrättigheter eller överlåtelser av nyttjanderättigheter. I ett tredimensionellt system ska tunnelutrymmen med stationer få bildas till fastigheter i detaljplaneområden, och dessa kan till sina rättsliga egenskaper jämställas med vilka självständiga fastigheter som helst och som kan omfattas av lagfart och inteckning. 
Underjordiska utrymmen föreslås kunna förvärvas för de ändamål som nämns ovan antingen genom frivilliga avtal eller vid ett förfarande som avses i inlösningslagen. Landsvägs- och järnvägstunnlar samt landsvägs- och järnvägsbroar kan finnas på sådana fastigheter som annars används för helt andra ändamål än för trafik och transport. Dessutom är det tänkbart att byggnader och anläggningar som planlagts för trafik och transport, såsom stationshallar, bussterminaler och liknande utrymmen, helt eller delvis kombineras med utrymmen som anvisats för helt andra användningsändamål, såsom affärslokaler, kontor eller bostäder. Ett konkret exempel på en helhet av detta slag utgörs av Kampens centrum i Helsingfors med bussterminaler för fjärr- och närtrafik samt en metrostation. 
I dagens läge förekommer det i praktiken också situationer där det skulle vara ändamålsenligt att dela upp byggnader och övriga konstruktioner på olika fastigheter indelade enligt användningsändamål. Byggnaden indelas då per våning eller uppdelas på något annat sätt i separata fastigheter utgående från om delar av samma byggnad används exempelvis för kommersiella syften, som kontor för ämbetsverk eller affärsverksamhet eller för bostadsändamål. Det kan antas att tredimensionell fastighetsbildning erbjuder en vid sidan om de nuvarande sätten användbar möjlighet att administrera olika delar av en byggnad av detta slag just på det sätt som är mest effektivt och ändamålsenligt för en viss del. En och samma byggnad kan således förvaltas utan något samäganderättsförhållande, exempelvis i fråga om en fastighet av ett fastighetsaktiebolag och i fråga om en annan fastighet av ett bostadsaktiebolag, varvid ansvarsfördelningen mellan de olika administrerande organisationerna kan genomföras på ett rationellt sätt för varje 3D-fastighet utgående från utgångspunkterna för varje användningsändamål. 
I samband med den typ av projekt som beskrivits i det föregående har det rent konkret allt oftare blivit aktuellt att som en begränsande faktor notera att fastighetssystemet i Finland inte än så länge vidkänner sinsemellan oavhängiga driftsenheter förlagda ovanpå varandra, dvs. vertikala driftsenheter, som fastigheter. Granskningen har alltid hållits inom samma registerenhet, dvs. inom horisontella gränser, även i det fallet att det i exempelvis detaljplanen har antecknats flera separata driftsnivåer ovanpå varandra. Markplanets juridiska status har stått som utgångspunkt när man har utrett rättigheter som upplåtits till förmån för andra och rättigheternas utsträckning. 
2.4
Alternativa lösningar
När arbetsgruppen före beredningen av propositionen behandlade behoven av och utvecklingslinjerna för ett tredimensionellt fastighetssystem (arbetsgruppspromemoria jsm 2008:1) kartlades olika metoder för utvecklandet av fastighetssystemet. På basis av arbetsgruppens analys finns det tre möjliga utvecklingsalternativ för fastighetssystemet: att i huvudsak bevara fastighetssystemet som det är, att utveckla det nuvarande fastighetssystemet så att det stöder tredimensionell fastighetsbildning samt att ändra hela fastighetssystemet så att det blir totalt tredimensionellt. 
2.4.1
2.4.1 Nuvarande modell
Om fastighetssystemet i huvudsak bevaras som för närvarande, betyder det i praktiken att man fortsätter med grund i det nuvarande systemet utan att ändra lagstiftningen och systemen enligt en tredimensionell fastighetsbildning. Enligt denna modell är det dock möjligt att sträva efter att utveckla effektiviteten t.ex. i fråga om nyttjanderätten och andra befintliga mekanismer vid genomförandet av projekt för byggande ovanför och under markytan. 
Fördelen med denna modell är att det nuvarande systemet fungerar rätt bra och att förfarandena, förutom i undantagsfall, är etablerade. Modellen medför inte heller kostnader för ändringsarbete eller inlärning av nya förfaranden i nämnvärd grad. Modellen skulle naturligt nog inte ge några direkta konkreta lösningar på de problem som föranleds av den nuvarande situationen och den icke-tillämpliga lagstiftningen, men mindre förbättringar av processerna kan även genomföras i en författningsmiljö som inte omfattar tredimensionaliteten. Eftersom antalet omfattande hybridprojekt som hanteras tredimensionellt ökar kraftigt just nu, innebär denna modell dock en risk för att de problem som föranleds av den icke-tillämpliga lagstiftningen ökar och förstoras. 
2.4.2
2.4.2 Kombinerade modell
Den andra modellen går ut på att utveckla den gällande lagstiftningen och de tvådimensionella systemen så att bildning och registrering av tredimensionella fastigheter stöds endast i specialfall. Modellen innebär att utvecklandet av den gällande lagstiftningen och systemen ska övervägas och ske så att bildandet och registreringen av tredimensionella fastigheter blir juridiskt och tekniskt möjligt då när förutsättningarna uppfylls. De nuvarande förfarandena ska dock utgöra huvudregeln och fastighetssystemet som helhet förbli tvådimensionellt. 
Modellens styrka är att grunderna för det nuvarande fastighetssystemet kan bevaras oförändrade och att det inte finns behov att göra massiva ändringar för att uppdatera rättssystemet eller informationssystemen så att de stöder tredimensionalitet. Syftet med detta alternativ är att kunna tillgodose de utvecklingsbehov som hänför sig till nya specialfall i fastighetssystemet så kostnadseffektivt som möjligt genom att möjliggöra 3D-enheter. De viktigaste fördelarna med modellen är främst att det kan bli enklare att förvalta moderna och invecklade byggprojekt så att behovet av oenhetliga och avtalsbaserade lösningar minskar. Detta förbättrar även förvaltandet av den säkerhetsmassa som hänför sig till projekten och den allmänna informationen om fastighetssystemet i samband med invecklade byggnadshelheter. Dessutom innebär modellen att kostnaderna för utvecklandet av systemen förblir rimliga.  
En nackdel med modellen kan anses vara att fastighetssystemet får ett helt nytt element, och att det krävs resurser för att skapa och lära sig nya förfaranden för detta. Även ändringarna i informationssystemen medför i viss mån kostnader, och särskilt i det inledande skedet kan det i vissa fall bli svårt att få en uppfattning om fastighetens utsträckning. Den viktigaste risken med modellen kan anses vara att det vid utvecklandet av lagstiftningen om systemet inte är möjligt att på ett uttömmande sätt förutspå alla de rättsliga återverkningarna och att man därför måste vara beredd på att lagstiftningen måste fortsätta utvecklas. 
2.4.3
2.4.3 Helt tredimensionellt modell
Det tredje alternativet går ut på att ändra hela fastighetssystemet och att ändra begreppet fastighet så att det uttryckligen blir tredimensionellt. Detta alternativ kräver en total ändring av informationssystemen och informationsmallarna för fastighetsregistret så att en fastighet faktiskt uppfattas som tredimensionell. Modellens styrka är att systemet blir enhetligt och att alla fastigheter behandlas uttryckligen som tredimensionella helheter. Resultatet blir ett system som är på toppnivå även internationellt och som ger rum för olika tekniska möjligheter till exempel i fråga om planering och visualisering. Även i denna modell minskar behovet av oenhetliga och avtalsbaserade lösningar, vilket förbättrar hanteringen av säkerhetsmassan och förtydligar stora byggnadshelheter.  
Den främsta nackdelen med modellen är att man är tvungen att reformera hela det nuvarande fastighetssystemet. Det krävs en total ändring av de informationssystem och informationsmallar som används. Kostnaderna för reformen skulle vara omfattande i förhållande till behovet. Inom den närmaste framtiden kommer det inte att finnas ett allmänt behov av tredimensionalitet i fastighetssystemet, utan behovet gäller främst stora städers omfattande byggprojekt, vars helheter innefattar tillgodoseende av behov gällande flera olika ändamål. Genomförandet och fullgörandet av omfattande ändringar kräver mycket resurser. Att fatta beslut om den lagstiftning som behövs och om de tekniska lösningarna är krävande, eftersom detta förutsätter en total omvärdering av fastighetssystemet, om den modell som ska användas inte är förenlig med egenskaperna och karaktären hos det nuvarande finländska fastighetssystemet. Att beakta modellens samtliga återverkningar i samband med utvecklandet av lagstiftningen och informationssystemen kan visa sig vara en större utmaning och dyrare än väntat. 
2.4.4
2.4.4 Vald modell
På basis av bedömningen av de alternativ som föreslås har man beslutat att en arbetsgrupp ska bereda ändringarna av lagstiftningen med grund i det alternativ som baserar sig på ett tvådimensionellt fastighetssystem som identifierar tredimensionella fastigheter (2.4.2). Enligt en helhetsbedömning finns det ett behov av en sådan modell, och jämfört med det nuvarande systemet har den klara fördelar med tanke på effektiviteten. För det första innebär modellen i detta skede en tillräckligt stor reform för att kunna tillgodose de behov som gäller den tredimensionella förvaltningen av omfattande och invecklade bygghelheter. För det andra skulle de totala kostnaderna för en övergång till ett fastighetssystem som är totalt tredimensionellt samt riskerna med en sådan förändring vara såpass stora i förhållande till den uppskattade mängd projekt som skulle dra nytta av tredimensionaliteten att man inte anser att det är realistiskt att genomföra ett sådant alternativ. 
3
Målsättning och de viktigaste förslagen
3.1
Målsättning
Målet med denna proposition är att skapa ett system där det inom detaljplaneområden är möjligt att bilda tredimensionella fastigheter som är avgränsade inte bara horisontellt utan även vertikalt, dvs. i djupled och höjdled. Avsikten är att främja byggande av utrymmen ovanför och under markytan, skapa större klarhet i möjligheterna att använda dem som säkerhet samt utöka basregistrens datainnehåll, deras informationsvärde och utnyttjandegrad och göra dem tydligare. 
De föreslagna lagändringarna fokuserar på fastighetsbildning och registerföring samt när det gäller markanvändnings- och bygglagen på ändringar av bestämmelserna om tomtindelning samt servitutsarrangemang och samregleringar. Avsikten är att lagstiftningen och registerföringssystemen ska utvecklas så att de stöder bildandet och registreringen av tredimensionella fastigheter. När de villkor som regleras genom lag är uppfyllda blir det enligt förslaget juridiskt och tekniskt möjligt att bilda och registrera tredimensionella fastigheter. Då kan det skapas större klarhet i de nuvarande förfarandena i anslutning till ägande, besittning, inteckning och byggande av utrymmen ovanför och under markytan. De befintliga tvådimensionella förfarandena och praxis kommer dock även i fortsättningen att ses som huvudregler, men vid sidan om dem föreslås bildande av tredimensionella fastigheter som en ny möjlighet, vilket i vissa situationer erbjuder ett sätt att agera som är effektivare än de traditionella modellerna. Det föreslås att bildning av tredimensionella fastigheter ska användas som ett alternativ till den nuvarande modellen baserad på tvådimensionell fastighetsbildning och avtal, och den ökar direkt valmöjligheterna under projektplaneringsstadiet. Själva fastighetssystemet föreslås kvarstå med sin tvådimensionella struktur. 
Fördelarna med att bilda tredimensionella fastigheter är bl.a. lättare arrangemang för projektfinansiering, effektivare inriktad fastighetsbeskattning, tydligare besittning av fastigheter och större genomsynlighet i ägandet. 
De beskattningsvärden för fastigheterna som ligger till grund för fastighetsbeskattningen bestäms till stor del på basis av markens användningsändamål enligt detaljplanen och på basis av byggrätten enligt detaljplanen samt på basis av byggnadstyp, använd byggrätt, byggnadens ålder och tekniska skick (Skatteförvaltningens beslut om beskattningsvärde på fastighet vid fastighetsbeskattningen A120/200/2015). Som grund för fastighetsbeskattningen överför Skatteförvaltningen uppgifter från fastighetssystemet och samkör dem med de uppgifter den fått från kommunerna om byggrätt och användningsändamål för fastigheterna. 
Ur fastighetsdatasystemet kan för fastighetsbeskattningen sökas uppgifter om fastighetens fysiska utsträckning i plankoordinatsystemet, fastighetens samägare och ägarandelar. Vidare fås uppgifter om huruvida fastighetens samägare har ingått ett avtal om delning av besittningen eller huruvida det för området finns ett giltigt avtal om arrende av mark. Ur fastighetsdatasystemet fås däremot inte någon information om vilken del av fastigheten som varje delägare har besittningsrätt till på basis av ett avtal om delning av besittningen eller ett avtal om arrende av mark. På grund av detta är det inom det nuvarande systemet ofta en krävande eller rentav omöjlig uppgift att rikta fastighetsskatten till olika skattskyldiga. Den fastighetsskattesats som kommunen beslutar om varierar enligt fastighetens användningssätt. På en och samma fastighet kan det de facto finnas funktioner av helt olika typ, exempelvis boende och affärslokaler, för vilka det borde betalas fastighetsskatt enligt olika skattesatser. Ur fastighetsdatasystemet fås dock inte för beräkning av det på användningssättet baserade beskattningsvärdet information om dessa olika användningsändamål på fastigheterna, och korrekt beskattning kan inte bestämmas till denna del. 
I dessa fall kommer tredimensionell fastighetsbildning att främja möjligheterna att rikta fastighetsskatterna till rätta aktörer. När olika slags användningsändamål för såväl marken som byggnaderna kan åtskiljas som egna fastigheter och byggnader vilka var och en har sina ägare och eventuella innehavare, kan man bättre och exaktare än för närvarande inrikta fastighetsskatteskyldigheten för varje fastighet på den rätta betalningsskyldige enligt ett noggrant fastställt användningssätt och till rätt belopp. 
I och med bildningen av tredimensionella fastigheter blir fastighetssystemet tydligare, vilket har inverkan i synnerhet i samband med projekt som inrymmer internationell företagsverksamhet. Internationella fastighetsinvesterare känner sig främmande för den nuvarande handlingsmodellen som delvis bygger på det finländska fastighetssystemet och innebär att besittningen av stora objekt ofta bygger på samägande och komplexa avtal om delning av besittningen och om samreglering baserade på detta. När det gäller objekt som intresserar internationella investerare medför tredimensionell fastighetsbildning att det införs äganderättsenheter och inteckningsobjekt som är enklare än i dag och även lättare att uppfatta. Detta kommer att minska den administrativa bördan i anslutning till administreringen av objekten och kostnaderna för den och kommer därigenom att göra objekten intressantare även på det internationella planet. 
En tredimensionell fastighet undanröjer däremot inte det behov av samarbete som gäller för olika former av verksamhet i samma byggnad. Av verksamhet på olika fastigheter följer att behovet av samarbete rentav kan öka när förläggning på olika fastigheter medför att man måste komma överens om sådant som tidigare har kunnat skötas inom en fastighet. Likaså kan verksamhet på olika fastigheter avspeglas som en ny utredningsskyldighet i myndighetsförfarandena. Avtal om samreglering, byggnadsservitut samt övriga avtal om fastighetens bebyggande, annan användning av fastigheten, besittning av den och om samarbete är lika viktiga på 3D-fastigheter som inom det nuvarande systemet baserat på delning av besittningen. Detta behov av samarbete som en förutsättning för användningen av 3D-fastigheter kommer antagligen också att återspeglas i fastigheternas värde. Det kan också återspeglas i annat, exempelvis i de utredningar som olika aktörer begär av ägarna när de utreder fastighetens användning eller dess faktiska värde som säkerhet. 
När det bildas tredimensionella fastigheter kommer olika slags nyttjanderättigheter som upplåts till förmån för en fastighet och andra nyttjanderättigheter som belastar fastigheterna att riktas till självständiga fastigheter, och de kommer att kunna införas som ständiga rättigheter i fastighetsregistret. Nyttjanderättigheter kommer att kunna upplåtas antingen som byggnads- eller fastighetsservitut eller så att det fattas beslut om samreglering. Nyttjanderättigheter föreslås kunna upplåtas även utan samtycke av ägaren till den belastade fastigheten för att projekt alltid ska kunna genomföras. Detta är av väsentlig vikt också med tanke på 3D-fastighetens värde som säkerhet. 
Bildningen och registreringen av tredimensionella fastigheter medför större genomsynlighet i det faktiska ägandet av de byggnader som finns på fastigheten. Det grundläggande syftet med propositionen är att skapa och införa ett system där äganderättsenheterna kan fastställas förutom med plankoordinater också i höjdled. De enheter som registreras i fastighetssystemet kommer då att bättre än för närvarande motsvara de faktiska ägar- och besittningsförhållandena för de byggnader eller andra konstruktioner eller utrymmen med ekonomiskt värde som finns på området. Inteckningarna kommer att gälla tredimensionellt avgränsade fastigheter i en 3D-värld. Fastighetssystemet bör således beskriva realvärlden så sanningsenligt som möjligt för att fastighetsägandet och fastighetsbesittningen ska framstå på ett tydligt sätt för en tredje part. Fastighetssystemet och fastighetsägandet kan inte på bred front i samhället basera sig på sådana avtalsbaserade lösningar som parterna från fall till fall utformat utan något egentligt stöd i lagstiftningen. 
3.1.1
3.1.1 Underjordiska byggprojekt
När man anlägger exempelvis en parkeringshall under jord sträcker sig verksamheten ofta över flera fastigheter. Man kan lösa in nyttjanderättigheter under marken eller, om verksamheten äger rum på ett område som i praktiken har endast en markägare, upprätta tredimensionella avtal om arrende av mark. Ett inskrivningsbart avtal om delning av besittningen kan sällan användas för att dela ett underjordiskt utrymme eller ange besittningen av det, eftersom det skulle förutsätta att fastigheten på markytan samägs i kvotdelar, vilket ofta är omöjligt i praktiken. I dagens läge går det inte att bilda en egen fastighet under jord som skulle vara föremål för ägande eller ett objekt som kan intecknas som säkerhet för finansiering. Underjordiska parkeringsgrottor är dock värdefulla objekt och dyra att genomföra, och många gånger förhåller det sig så att det inte är meningsfullt att genomföra dem enbart med finansiering eller garantier från den offentliga sektorn. För underjordiska utrymmen skulle det därför vara nyttigt att kunna bilda omsättnings- och inteckningsbara enheter för ägande, dvs. fastigheter. 
Underjordiska parkeringshallar är ofta föremål för olika slags rättigheter och skyldigheter (bilplatsskyldigheter, platser enligt förpliktelsen att skydda befolkningen). Dessa administreras genom avtal om nyttjanderätt mellan parterna. Om parkeringshallen som sådan har genomförts endast utifrån nyttjanderätt ger inte hallkomplexet upphov till ett inskrivningsbart objekt som skulle kunna vara exempelvis servitutspart. Behövliga nyttjanderättigheter kan då inte upplåtas som ständiga rättigheter i fastighetsregistret. Med hjälp av 3D-fastigheter som bildas under jord kan situationer av denna typ lösas via inskrivningsbara rättigheter och skyldigheter som gäller självständiga fastigheter. 
3.1.2
3.1.2 Ändringssituationer och avtal om delning av besittningen
I situationer med samägande är det en utmaning att lösa ändringssituationer, om parterna inte har någon gemensam syn på de ändringar som ska göras. Sådana ändringssituationer kan till exempel gälla ett behov att ändra en fastighets användningsändamål från till exempel kontor till bostad eller affärslokal, att utöka byggrätten när verksamheten utvidgas eller att ändra förläggningen av olika funktioner samt andelarna. I praktiken bör parterna som det är nu få till stånd ett avtal om ändringarna, överlåta kvotdelsägande eller i yttersta fall upplösa samägandet genom att realisera hela objektet. En sådan situation kan bli aktuell exempelvis när man inte lyckas nå ett avtal och ingen part kan använda den del av fastigheten som parten har besittningsrätt till. Om man genom ett avtal om delning av besittningen har kommit överens om användningen av en samägd fastighet, går det inte att upplösa samägandet i enlighet med lagen om vissa samäganderättsförhållanden (180/1958), utan realiseringen måste genomföras på något annat sätt. När det handlar om verksamhet på området för en samägd fastighet finns det inte heller några servitutsparter, dvs. fastigheter i fråga om vilka myndigheterna som en sista utväg, i händelse av att avtalsverksamheten misslyckas, exempelvis genom att stifta behövliga servitut kan främja fastigheternas möjligheter att sinsemellan lösa en ändringssituation. 
I vilket fall som helst står man under någon fas i projektets livslängd inför ändringssituationer, och det bör finnas effektiva verktyg för att hantera dem. Hanteringen av ovannämnda situationer förändras från nuläget, om man opererar mellan självständiga fastigheter. När man opererar på en fastighet utifrån ett avtal mellan parterna och har besittningsrätt till endast någon bestämd del av fastigheten krävs det i dagsläget för behandling och lösning av olika ändringssituationer i regel att alla parter som agerar på fastigheten medverkar. Detta kan vara problematiskt speciellt i situationer där de planerade ändringarna endast gäller en viss del av fastigheten och enbart den som besitter ifrågavarande del har intresse för att genomföra ändringarna.  
Ändringssituationer initierar i allmänhet flera myndighetsförfaranden. Vid förfarandena hörs de ägare och innehavare av grannfastigheterna som saken gäller. En sådan grannfastighet kan enligt förslaget också vara en 3D-fastighet som finns ovanför eller under. Ägarna till dessa fastigheter föreslås ha rätt att bli hörda och söka ändring i planläggningen, tomtindelningen samt förfarandena för bygglov och tillstånd till undantag. En del ändringssituationer kommer således även i fortsättningen att förutsätta att exempelvis ägarna till fastigheter i en och samma byggnad har en gemensam ståndpunkt. Det här gäller i synnerhet situationer där en ändring påverkar användningen av andra fastigheter eller de servitut och samregleringar som finns. I sådana fall behövs det dock inte att man är enig om inledandet av själva processen, utan behovet av ändringarna kan övervägas separat för varje enskild fastighets del. 
3.1.3
3.1.3 Bostadsbyggande
Finland har ett fungerande bostadsaktiebolagssystem, och det är inte meningen att de föreslagna ändringarna ska ingripa i det. Därför är det inte ändamålsenligt att i Finland under dagens förhållanden bilda tredimensionella fastigheter på lägenhetsnivå. Den grundläggande utgångspunkten för bildandet av en tredimensionell fastighet föreslås utgöras av dess ändamålsenlighet. De kriterier som blivit vedertagna inom tillämpningspraxis när det gäller 78 § i markanvändnings- och bygglagen och 37 § i markanvändnings- och byggförordningen föreslås stå som grund för bedömning av ändamålsenligheten. Inom byggnadskvarter föreslås den tredimensionella ändamålsenligheten bli avgjord i samband med tomtindelning, eftersom 3D-fastigheter inte kan bildas på dessa områden utan en tredimensionell tomtindelning som anger denna fastighetsbildning. Vid tomtindelningen ska tomterna ges det format och den storlek som det med avseende på byggandet, användningen av tomterna och det tekniska underhållet av dem är ändamålsenligt (37 § i markanvändnings- och byggförordningen). En onödigt tät fastighetsindelning är inte ändamålsenlig i situationer där den inte ger något mervärde. Bland annat i lagstiftningen om byggande har fastighetsgränsen förenats med rättsliga förpliktelser som ökar parternas administrativa börda och myndigheternas skyldigheter. Exempelvis sådana ansvarsförhållanden och förpliktelser mellan fastigheterna som hänför sig till användningen av fastigheten ska fastighetsägarna avtala om i detalj genom olika slags avtalsarrangemang, och dessa arrangemang övervakas delvis på tjänstens vägnar bl.a. vid bygglovsförfarande. Det är inte ändamålsenligt att sådana rättsförhållanden visavi besittning och användning av byggnaden som framgångsrikt har tillgripits i enlighet med lagstiftningen om bostads- och fastighetsaktiebolag åsidosätts i och med den nya bildningen av tredimensionella fastigheter. Utgångspunkten är således även i framtiden att besittningen av ett bostadshöghus som ägs av ett bostadsaktiebolag har delats via delägarna i bolaget i enlighet med den normala modellen enligt lagstiftningen om bostadsaktiebolag. 
Genom de tredimensionella fastigheterna skapas alltså inte något nytt system för besittningen av bostadslägenheter i stället för eller vid sidan av det fungerande bostadsaktiebolagssystemet. Via systemet blir det dock möjligt att i nödvändiga fall tydligt avskilja boende till en egen fastighet och ett eget byggnadsobjekt exempelvis inom ett projekt som innefattar byggande för behov enligt flera olika användningsändamål. Den nya handlingsmodell som uppkommer är ändamålsenlig ur perspektivet för fastighetsbeskattningen när det gäller objekt som inrymmer flera funktioner och när det gäller situationer där samma objekt kommer att omfatta olika slags boendeformer, såsom fritt finansierat byggande vid sidan om understött bostadsbyggande. 
3.1.4
3.1.4 Antalet potentiella 3D-objekt
Det kan antas att 3D-fastigheter kommer att bildas främst i större städer. De huvudsakliga objekten utgörs sannolikt av offentligt ägda underjordiska parkeringsanläggningar (bl.a. torgparkeringar), byggande av köpcenter samt byggande ovanför eller under trafikområden. För bedömning av antalet potentiella 3D-objekt har man i den utredning från Lantmäteriverket som fåtts som bakgrundsmaterial till utarbetandet av propositionen granskat de detaljplaner för Esbo stad och Helsingfors stad som trädde i kraft 2015 och analyserat om objekten enligt detaljplanerna skulle kunna genomföras genom utnyttjande av en 3D-fastighet. Uppgifterna nedan har fåtts av Helsingfors stads och Esbo stads fastighetsingenjörer. 
Antalet detaljplaner i kraft, totalt 
Esbo: 34 (inga detaljplaner för metrostations- eller köpcenterområden år 2015) 
Helsingfors: 46 
Av dessa potentiella 3D-objekt 
Esbo: 5 (underjordiska parkeringsgrottor) 
Helsingfors: 20 
Uppskattat antal 3D-fastigheter, om alla objekt genomförs som 3D-projekt 
Esbo: 5 
Helsingfors: 20–40 
Underjordiska parkeringsobjekt finns eller behövs emellertid också i många andra städer i Finland. Det innebär att enskilda 3D-fastigheter kommer att bildas även i många mindre städer. Under de första åren efter det att systemet har införts kan tiotals potentiella 3D-fastigheter bildas per år, men så som de numerära uppgifterna från Norge visar (avsnitt 2.2.3) kan det antas att antalet 3D-fastigheter som bildas årligen stiger när systemet har blivit etablerat. 
3.2
De viktigaste förslagen
Det föreslås att fastighetsbildningslagen, fastighetsregisterlagen samt markanvändnings- och bygglagen ändras så att det i Finland blir möjligt att förutom traditionella fastigheter baserade på markägande också bilda tredimensionellt bestämda 3D-fastigheter. En tredimensionell fastighet som enligt förslaget regleras i fastighetsbildningslagen och fastighetsregisterlagen kan utgöras av en tomt, ett allmänt område eller en inlösningsenhet beroende på för vilket användningsändamål området har anvisats i detaljplanen. Enligt förslaget ska en 3D-fastighet vara en självständig och permanent fastighet, varvid den omfattas av allmänna juridiska mekanismer som hänför sig till en fastighet. På 3D-fastigheterna kan tomterna således vara enheter för lagfart, omsättning och fastighetsinteckning på motsvarande sätt som när det gäller 2D-systemets fastigheter. 
En 3D-fastighet föreslås i praktiken vara en både horisontellt och vertikalt bestämd volym med stängda gränser. Den hindrar inte eller begränsar inte i sig direkt användningen eller utnyttjandet av den basfastighet som ligger till grund för den, annat än i fråga om sitt eget läge. Basfastigheten kvarstår helt oförändrad omkring den helhet som 3D-fastigheten bildar. För att ägandet eller besittningen av en 3D-fastighet ska övergå från basfastighetens ägare behövs det enligt förslaget en giltig rättslig grund, på samma sätt som en sådan för närvarande behövs när det gäller 2D-fastigheter. För att möjliggöra 3D-fastigheter föreslås inga sådana nya rättsliga grunder som skulle begränsa egendomsskyddet för basfastighetens ägare eller som skulle möjliggöra en sådan begränsning. Förslaget innebär endast att det sätt på vilket helheter som uppkommer och överförs på basis av en giltigt rättslig grund kan besittas. 
Enligt förslaget ska 3D-fastigheter kunna bildas endast inom detaljplaneområden och endast i sådana situationer där detta krävs för att byggverksamheten ska ordnas på ett ändamålsenligt sätt. När det gäller detaljplaner som utarbetats före lagändringen ska möjligheten att bilda 3D-fastigheter bedömas vid ett tomtindelningsförfarande. Vid planläggning kommer man i fortsättningen antagligen att beakta möjligheten att bilda tredimensionella fastigheter i de objekt där det anses vara ändamålsenligt. Enligt förslaget ska 3D-fastigheter kunna finnas ovanför eller under markplanet. Det föreslås också att de ska kunna vara sådana att en del av fastigheten är under och en del ovanför markplanet. Fastighetens höjdläge anges i förhållande till havsytans nivå enligt N2000-systemet. Läget har inte koordinerats med den fiktiva marknivån. 
Det väsentliga i samtliga fall är att fastighetssystemet är tydligt och tillförlitligt. I detaljplanen ska det enligt förslaget i nödvändiga fall kunna bestämmas att fastighetsindelningen inom ett visst område genomförs som tredimensionella fastigheter. Bildning av tredimensionella fastigheter föreslås vara möjligt också om fastigheterna bildas enligt en bindande tomtindelning utan att planbestämmelserna om användningsändamål och exploateringsgrad överträds och om inte något annat följer av innehållet i detaljplanen. Antalet fastigheter som förläggs ovanpå varandra bestäms enligt förslaget inom ramen för detaljplanen och den bindande tomtindelningen, och i lagstiftningen föreslås inga bestämmelser som begränsar detta. Exempelvis i ett regleringsdokument som gäller genomförande och underhåll kan man dessutom mer detaljerat komma överens om tredimensionell fastighetsindelning med den samreglering som avses i 164 § i markanvändnings- och bygglagen, dock med beaktande av detaljplanebestämmelserna och den eventuella bindande tomtindelningen. 
Det att lagstiftningen möjliggör tredimensionella fastigheter förändrar inte det som i bestämmelser på olika nivåer har föreskrivits om outbrutna områden som överlåts från en fastighet. Inte heller regleringen av fastighetsköp, överlåtelsebeskattning eller utmätning ändras, eftersom det som föreskrivits om fastigheter gäller även 3D-fastigheter. Lagstiftningen ändras endast till de delar den utan ändringar inte skulle behandla 3D-fastigheter på samma sätt som 2D-fastigheter, eller när en definition eller ett begrepp i lagen har lånats från ett begrepp i fastighetsbildningslagen, som nu föreslås bli ändrad, och definitionen eller begreppet för konsekvensens skull bör ändras i samma sammanhang som dess utgångsuppgift. Det handlar om en sådan situation exempelvis för fastighetsskattelagen, där enheter för jordinnehav betraktas som fastigheter på motsvarande sätt som enheter för jordäganderätt i fastighetsbildningslagen. 
Enligt den föreslagna 2 § i fastighetsregisterlagen ska 3D-fastigheter kunna införas som fastigheter i fastighetsregistret endast om de finns inom ett detaljplaneområde, och därför bör lagfart på 3D-outbrutna områden med anknytande inteckning inte göras utanför lagakraftvunna detaljplaneområden. I dagens läge är utgångspunkten för byggande inom ett detaljplaneområde att innan bygglov beviljas ska den tomt som används som byggplats vara införd i fastighetsregistret. Enligt 81 § i markanvändnings- och bygglagen får bygglov inte beviljas för en tomt enligt en bindande tomtindelning förrän den har införts i fastighetsregistret. Med stöd av den nya 81 a § ska bygglov dock i fortsättningen kunna beviljas för 3D-fastigheter enligt detaljplanen inom området för en bindande tomtindelning även om den tredimensionella tomten ännu inte har bildats till en fastighet eller införts i fastighetsregistret. För att byggnaden ska få tas i bruk ska det dock krävas att fastigheten har införts i registret. 
Enligt förslaget ska 3D-fastigheter alltid bildas för genomförande av ett visst byggprojekt som möjliggjorts genom en detaljplan och vid behov genom en bindande tomtindelning. Projektet konkretiseras i praktiken under bygglovsfasen, och först då kan man ange fastighetens exakta utsträckning och läget för behövliga servitut. Till skillnad från tvådimensionell fastighetsbildning gäller som särdrag för 3D-fastigheter (tomter) inom ett byggnadskvarter ofta att byggsättet karaktäriseras av att det är meningen att ytterväggarna samt de undre och övre ytorna hos en byggnad eller hos en del av den ska finnas fast i gränsytorna för den fastighet som bildas. Det innebär att det ställs mycket höga krav på precision när det gäller att exakt bestämma fastighetens utsträckning. 
Det är inte meningsfullt att en tredimensionell tomt bildas till en fastighet som införs i fastighetsregistret, om det är sannolikt att dess utsträckning inte motsvarar byggprojektet och om gränsernas sträckning måste justeras senare på grund av detta. I samband med bildande av 3D-fastigheter i byggnadskvarter är det därför viktigt att undersöka inte bara befintliga detaljplanebestämmelser och bindande tomtindelningar utan också eventuella giltiga bygglov. Eftersom den slutliga byggnaden av olika orsaker kan avvika något från den specificerade byggnaden i bygglovet, föreslås dock inte ett befintligt bygglov vara en ovillkorlig förutsättning för fastighetsbildningen. Enligt den nya 81 a § i markanvändnings- och bygglagen ska dessutom bygglov och undantag i anslutning till det kunna beviljas för ett projekt baserat på tredimensionell fastighetsindelning redan innan fastigheterna har införts i fastighetsregistret. Tillståndsförfarandet och tillståndsprövningen motsvarar det som föreskrivs i 19 kap. i markanvändnings- och bygglagen. På förutsättningarna för tillstånd ska således bl.a. 135 § i markanvändnings- och bygglagen tillämpas. 
Inom områden utanför ett byggnadskvarter (exempelvis för en parkeringsanläggning under en park) är det naturligtvis inte heller för bildande av en 3D-fastighet nödvändigt att uppställa samma villkor som i byggnadskvarter. För sådana områden behövs det således inte några bestämmelser i likhet med tomtindelningens rättsverkningar. 
Godkännande av en bindande tomtindelning utgör enligt förslaget en förutsättning för sådant byggande inom ett byggnadskvarter som baserar sig på tredimensionell fastighetsindelning. Det föreslås därför att den reglering som enligt markanvändnings- och bygglagen gäller bindande tomtindelning ändras så att bestämmelserna om tomtindelning blir tillämpliga också på området för en detaljplan för underjordiska utrymmen, dvs. 78 § 5 mom. i markanvändnings- och bygglagen föreslås bli upphävt. 
Det föreslås att bestämmelserna om hörande som gäller tomtindelning och bygglovsförfarande kompletteras. Bildandet av en tredimensionell fastighet innebär att det i en byggnad kan finnas många fastigheter vars ägare tillsammans uppför och har besittningsrätt till byggnaden. Hustekniken, konstruktionerna, passagerna och många andra byggnadslösningar betjänar flera eller alla fastighetsägare i byggnaden. Bestämmelserna om hörande kompletteras enligt förslaget så att även andra än de direkta gränsgrannarna blir hörda i samband med 3D-tomtindelning, om projektet för en fastighetsägare som finns i samma kvarter i väsentlig grad påverkar deras intressen. 
Inom områden utanför ett byggnadskvarter, exempelvis för en parkeringsanläggning under en park, krävs det enligt förslaget inte någon bindande tomtindelning för att en 3D-fastighet ska få bildas. En detaljplan för underjordiska utrymmen föreslås kunna gälla även ett område som inte har någon detaljplan för områden på marknivå. Behovet av att utarbeta en bindande tomtindelning för underjordiska utrymmen blir då en fråga som avgörs i detaljplanen. 
Den bestämmelse i 154 § i fastighetsbildningslagen som gäller ordnande av vägförbindelse bör ses över för att den ska lämpa sig även för 3D-fastigheter. Likaså omarbetas markanvändnings- och bygglagens bestämmelser om byggnadsservitut och samregleringar så att de kan användas för upplåtelse av nyttjanderättigheter som behövs på grund av tredimensionell fastighetsbildning. 
Gränserna för en 3D-fastighet som redan bildats kan genomgå en ny fastighetsbestämning på samma sätt som gränserna för vilken fastighet som helst. Rågången kan handla om att bestämma hela utsträckningen på nytt, om ärendet vid den egentliga bildningsförrättningen eller därefter har visat sig vara stridigt eller oklart. Det föreslås inte några ändringar eller kompletteringar av de bestämmelser i fastighetsbildningslagen som gäller rågång av rån som bestämts tidigare. 
Behov av att en 3D-fastighet upphör kan uppkomma på basis av en ändring av detaljplanen, ett myndighetsbehov eller en ägares viljeyttring. När det finns förutsättningar för att en fastighet ska upphöra, dvs. kraven på enhetlighet i gravationerna och i ägandet är uppfyllda, ska en 3D-fastighet kunna sammanslås med en traditionell 2D-fastihget så som föreskrivs om sammanslagning av fastigheter i 214 § i den gällande fastighetsbildningslagen. Det föreslås således inga ändringar av den paragrafen. I samband med att en 3D-fastighet upphör gäller det att reglera eventuella servitut, inteckningar och övriga rättigheter, varvid villkoren för i synnerhet panthavare, fastighetsägare och andra rättsinnehavare bör tryggas. Klarheten och tillförlitligheten i fastighetssystemet bör naturligtvis bestå också efter det att 3D-fastigheten har upphört. 
4
Propositionens konsekvenser
4.1
Ekonomiska konsekvenser
4.1.1
4.1.1 Konsekvenser för hushållen
Propositionens konsekvensbedömning bygger på de synpunkter och bedömningar om fastighetsmarknaden som gäller Lantmäteriverkets projekt för bildning av tredimensionella fastigheter, som har framförts av de sakkunniga vid Helsingfors stad, Esbo stad och Lantmäteriverket som har deltagit i projekten. Reformens konsekvenser kan bedömas i form av allmänna trender, men eftersom fenomenet är helt nytt för rättssystemet och det inte finns någon forskning om detta ännu, är det i detta skede inte möjligt att göra analyser med detaljerade ekonomiska uppskattningar av de konsekvenser som de tredimensionella fastigheterna kan få för till exempel fastighetsmarknaden eller olika aktörer inom byggbranschen. Hurdana konsekvenser detta får beror dessutom i praktiken på i hur stor omfattning det nya systemet tas i bruk i kommunerna. Även om kommunerna har deltagit aktivt i beredningen av lagen, finns det inga tillförlitliga uppskattningar av hur villiga kommunerna är att börja använda det föreslagna systemet. Det system som föreslås i Finland motsvarar inte heller Sveriges system tillräckligt mycket för att det skulle vara meningsfullt att göra bedömningarna av de ekonomiska konsekvenserna direkt på basis av Sveriges erfarenheter. 
De tredimensionella fastigheterna får begränsade konsekvenser för privatpersoner och hushållen. Även om syftet med reformen inte är att ändra bostadsaktiebolagssystemet, kan reformen indirekt ha en positiv effekt på värdet på bostadsaktieägarnas aktier i sådana fall då bostadsaktiebolagets ansvar är tydliga och kan begränsas i enlighet med fastigheternas användningsändamål. Genom att ta i bruk 3D-fastigheter kan man avgränsa ansvaren så att de t.ex. inte omfattar sådana delar som medför risker för de som bor i byggnaden, t.ex. parkeringshallar och sådana utrymmen som inte används som bostad. Därmed måste inte bostadsaktiebolagets delägare bära ansvaret för de rättsliga utmaningar som hänför sig till affärslokaler eller underjordiska fastigheter, utan ansvaret ligger hos de instanser som äger eller besitter affärslokalerna eller parkeringsutrymmena. Dessa utrymmen kan också uppges i detaljplanen eller fastställas genom avtal som sådana gemensamma lokaler i en 3D-fastighet som en större grupp av delägare ska ansvara för att underhålla. Detta minskar de andelar som ska betalas, och alla delägare drar nytta av det värde på egendomen som ökar då antalet delägare ökar. Enligt propositionen är det inte möjligt att bilda fastigheter av enskilda bostadslägenheter, och därför har propositionen inga konsekvenser för hushållen. Även bostadsaktiebolagssystemet förblir oförändrat. 
Avtal om samreglering, byggnadsservitut samt övriga avtal om fastighetens bebyggande och användning i annat syfte samt om besittning och samarbete är lika viktiga i 3D-fastigheter som inom det nuvarande system som baserar sig på delning av besittningen. Att överföringen av dessa element sker delvis med myndigheternas medverkan kan bedömas få indirekta, positiva konsekvenser för fastighetsägarnas ekonomiska ställning. 
4.1.2
4.1.2 Konsekvenser för företagen
De centrala konsekvenser som den föreslagna lagstiftningen får för företagen gäller i praktiken de byggföretag med hög omsättning som har möjlighet att genomföra sådana omfattande bygghelheter med flera användningsändamål där fördelarna med tredimensionaliteten realiseras. 
Besittningen av stora byggnadsobjekt ska när det gäller 3D-objekt basera sig på inbördes förhållanden mellan separata fastigheter i stället för ett samägandeförhållande och avtal om delning av besittningen. På detta sätt minskar såväl den administrativa bördan i samband med besittningen av objekten som de kostnader för besittningen som föranleds ägarna. Avtalen om samreglering, byggnadsservituten samt de övriga avtalen mellan fastigheter kommer dock delvis endast att överföra den administrativa bördan till en annan fas i processen, och med tanke på detta bedöms de totala konsekvenserna bli rätt neutrala. Det system som identifierar tredimensionella fastigheter kan utvidgas även till de befintliga fastighetsmassorna, varvid arrangemang för ägar- och besittningsarkitektur baserade på de nuvarande, omfattande och komplexa avtalen kan förenklas i vissa situationer. 
Inteckning av en tredimensionell fastighet och användning av den som säkerhet är ett enklare alternativ än inskrivning av avtal om delning av besittningen och inteckning av en andel utifrån detta. 3D-fastigheter öppnar möjligheter för delägare i byggnader att använda denna enklare modell. Även om säkerhetsarrangemangen underlättas måste 3D-fastigheternas ägare och panthavare dock fortsättningsvis dryfta säkerhetens värde utifrån dess omständigheter. Även för 3D-fastigheter gäller att säkerhetsvärdet är beroende av fastighetens användningsmöjligheter. Exempelvis en tom 3D-tomt i luften har antagligen inte samma säkerhetsvärde som en motsvarande tomt på marken, om inte båda kan bebyggas lika lätt, självständigt och säkert. Av karaktären hos en tomt i luften följer att den inte i praktiken kan bebyggas självständigt eller vid en självbestämd tidpunkt på samma sätt som en traditionell 2D-tomt på marken. En luftfastighets beroendeförhållanden visavi fastigheterna under och ovanför och byggandet av dem kan påverka dess värde. 
Hanterandet av de säkerhetsmassor som består av fastigheter och byggnader förbättras inom kreditgivningsverksamheten, och användningen av fastighetsobjektens säkerheter blir effektivare. Det slutliga säkerhetsvärdet på de nya fastighetstyperna fastställs på marknaden i kreditgivarnas praxis, och i och med att objekten blir fler blir det lättare att bedöma värdet. Då besittningen av stora byggobjekt baserar sig på besittning av fastigheter, som är lättare att greppa än besittningsandelar, kommer troligtvis de internationella fastighetsägarnas intresse för finländska fastigheter att öka, vilket förbättrar kapitaltillgången, minskar kostnaderna för främmande kapital och möjliggör en större finansieringsbas för stora fastighetsobjekt. Särskilt vid omfattande byggobjekt är det av stor betydelse hur stora kostnaderna för kapitalet är (över 100 mn euro). Om räntemarginalen förändras t.ex. med en tiondedel (10 räntepoäng), kan de finansieringskostnader för ett omfattande objekt som finansieras med främmande kapital sjunka med över en miljon euro under objektets livscykel. Om kapitaltillgången förbättras, förkortas i vissa fall dessutom den totala tiden för genomförandet av projekten. 
De tredimensionella enheter som registreras i fastighetssystemet kommer då bättre än för närvarande att motsvara de faktiska ägar- och besittningsförhållandena för de byggnader eller andra konstruktioner eller utrymmen med ekonomiskt värde som finns på området. Detta kan ge rum för olika slag av nya digitala tjänster av mervärde samt nya användningsobjekt, till exempel spårning inne i byggnader. 
4.1.3
4.1.3 Konsekvenser för den offentliga ekonomin
När olika slags användningsändamål i fråga om tredimensionella fastigheters marker och byggnader kan åtskiljas som egna fastigheter och byggnader med egna ägare och eventuella innehavare, kan man bättre och exaktare än för närvarande inrikta fastighetsskatteskyldigheten för varje fastighet till den rätta betalningsskyldige enligt ett noggrant fastställt användningssätt och till rätt belopp. Detta främjar fastighetsbeskattningens allmänna godtagbarhet. Ändringen bedöms inte få någon omedelbar effekt på intäkterna från fastighetsskatten, eftersom intäkterna i praktiken är mera beroende av kommunens skattesats samt användningsändamålen enligt fastighetsplanerna. 
Propositionen ökar för sin del och indirekt kostnadseffektiviteten för Lantmäteriverkets myndighetsverksamhet på lång sikt genom att möjliggöra bildande av och lagfart på 3D-fastigheter och på så vis skapa större klarhet i användningen av dem som inteckningsobjekt. Det är svårt att uppskatta de exakta kostnads- och resurskraven för genomförande och planering av systemet som möjliggör 3D-fastigheter. När det gäller de register som förs av Lantmäteriverket uppkommer kostnader av ändringarna i fastighetsdelen i fastighetsdatasystemet (FDS), applikationerna för fastighetsregisterföring i förrättningsproduktionssystemet (det s.k. JAKO-systemet) och FDS samt i inskrivningssystemet för fastigheter. Med tillhörande arbeten har ändringarna beräknats medföra kostnader till ett belopp av ungefär 1 miljon euro för Lantmäteriverket. Då behövs det inga helt nya delar i informationssystemen. I praktiken kommer kostnaden i fråga på lång sikt att kunna täckas genom fastighetsförrättningsavgifterna och de inkomster som fås av lagfart, inskrivning av en särskild rättighet samt inteckningar. 
De kommuner som för ett fastighetsregister ska själva stå för de kostnader som ändringen medför i anslutning till revidering av kommunernas egna informationssystem. Kostnaderna för de register som kommunerna för beräknas bli ringa. De totala kostnaderna för kommunerna för införande, testning och anpassningsarbeten i informationssystemen har beräknats uppgå till ungefär 200 000 euro. Av de statliga organisationerna blir Skatteförvaltningen och Befolkningsregistercentralen tvungna att göra smärre anpassningsarbeten i sina system, om de ämnar utnyttja 3D-fastighetsuppgifterna i sin verksamhet. 
Det är meningen att lagstiftningsåtgärder som gäller det system som möjliggör tredimensionella fastigheter och åtgärder som hänför sig till utvecklande av systemet ska genomföras så att de kostnader som uppkommer är skäliga i proportion till systemets framtida användningsområde. Hela systemet bör bevaras som ett klart och logiskt system, och för detta är kraven på att fastighetsägarnas rättsskydd ska bestå och på att fastighetssystemets klarhet och tillförlitlighet ska kvarstå i oförändrad form mycket viktiga. Ett fastighetssystem som på detaljplaneområden identifierar tredimensionella fastigheter minskar behovet av liknande komplexa och omfattande avtal om delning av besittningen och om arrende av mark som de som finns i dag. Systemet skapar större klarhet när det gäller att verkställa stora projekt och främjar därmed effektiviteten och kostnadsmotsvarigheten i den ekonomiska verksamheten samt minskar de administrativa kostnaderna. För att systemet ska fungera kan det dock i samband med stora projekt, dels för genomförandet, dels för samregleringar enligt 164 § i markanvändnings- och bygglagen, förutsättas att det upprättas regleringsdokument mellan markägarna, den berörda kommunen och de byggherrar som engagerat sig i projektet. 
Vid bedömningen av 3D-systemets ekonomiska konsekvenser för kommunernas del är det viktigt att beakta att största delen av kommunerna i praktiken inte kommer att genomföra några tredimensionella projekt, och att dessa därför inte behöver göra ändringar i sina informationssystem eller processer med anledning av tredimensionaliteten. Man antar att tredimensionaliteten kommer att gagna främst sådana kommuner som har någon typ av urbant centrum. Detta kan dessutom intressera de kommuner som har behov av t.ex. torgparkering, av lösningar för trafikknutpunkter, av parkeringshus eller av andra eventuella hybridobjekt. I Finland består dessa främst av de s.k. urbana kommunerna, som enligt Statistikcentralen var 58 till antalet år 2016. Under det inledande skedet har man bedömt att mindre än hälften av dessa kan komma att vara intresserade av att utnyttja det tredimensionella systemet vid sin markanvändning. 
Kommunerna har ingen skyldighet att bilda tredimensionella fastigheter. Särskilt om kostnaderna för ibruktagandet av systemet uppskattas överskrida den nytta som systemet medför, kan detta vara av betydelse när ändamålsenligheten som helhet bedöms vid tomtindelningar. Å andra sidan kan möjligheten att i urbana områden bilda fastigheter särskilt av sådana lokaler som finns under markytan öka antalet överlåtnings- och inteckningsbara enheter i lokaler. I och med detta kan underjordiska lokaler säljas mera effektivt än tidigare, vilket ur ägarens (ofta städer) perspektiv underlättar finansierandet av de underjordiska lokalerna samt främjar användningen av de underjordiska lokalerna så att dessa kan bebyggas effektivt. 
I denna proposition är prognosen att det inte kommer att bildas numerärt sett många fastigheter, eftersom de uppskattade fördelarna är störst inom städernas centrumområden och vid hybridbyggande samt i samband med vissa underjordiska objekt. Det är svårt att förutse hur villiga fastighetsägarna, byggherrarna eller kommunerna i övrigt är att utnyttja 3D-fastigheter. Med hjälp av 3D-fastigheter kan man göra besittningen av byggnader genomsynligare och underlätta användningen av delar av byggnader som säkerhet, vilket är en orsak att använda dem. Genom 3D-fastighetsdelning kan man indirekt försöka hantera även olika slags ansvarssituationer eller bereda sig på framtida behov exempelvis genom att själv behålla äganderätten till ett 3D-område även om fastigheten i övrigt överlåts vidare eller vice versa. Det verktyg som den nya lagstiftningen möjliggör kan föra med sig vissa oförutsedda användningssätt när verksamma branschaktörer sätter sig in i verktyget och upptäcker situationer där det är nyttigt att använda det. 
4.2
Konsekvenser för myndigheterna
Genomförandet av ett system som identifierar tredimensionella fastigheter så att det gäller enbart en vid planläggningen på förhand bestämd del av detaljplaneområden påverkar inte myndigheternas verksamhet i någon betydande grad, eftersom det kan antas att antalet 3D-fastigheter på riksnivå kommer att vara begränsat. Begränsade lagändringar som gäller det system som identifierar tredimensionella fastigheter skapar dock tillfälle att i vissa situationer förenhetliga myndighetspraxis i samband med olika slags byggprojekt ovanför och under markytan. Konsekvenserna sträcker sig framför allt till planläggning, fastighetsbildning, byggverksamhet samt inskrivning av rättigheter i lagfarts- och inteckningsregistret. 
Införande av 3D-fastigheter medför inte att samhället får några nya typer av processer att följa utöver de nuvarande. Tredimensionella fastigheter kommer att bildas enligt samma processer som alla andra fastigheter. 3D-tomter kommer att anvisas genom en tomtindelning och registreras genom en fastighetsförrättning på samma sätt som 2D-tomter. Regleringar och servitut mellan fastigheterna kommer att fastställas och registreras i fastighetsregistret på samma sätt som för närvarande. För uppförande av byggnader ska det på samma sätt som för närvarande krävas att bygglov söks och att ansökan innehåller tillräckliga utredningar om besittningen av byggplatsen och om att övriga förutsättningar för bygglov är uppfyllda. 3D-fastigheter ska kunna lagfaras och intecknas, på samma sätt som traditionella fastigheter, och ska kunna omsättas på samma sätt som alla andra fastigheter. 
Delning eller sammanslagning av utrymmen i en byggnad mellan ägarna ändras enligt förslaget som process. Ändringar i ägarförhållandena mellan utrymmen under byggnadens livslängd föreslås utgöras av fastighetsköp eller andra förvärv. Det är tänkbart att på gammalt vis dela utrymmen i mindre delar och upplåta nya besittningsområden med hjälp av ägande i kvotdelar och avtal om delning av besittningen. Det är dock antagligen ett tydligare och klarare alternativ att överlåta utrymmen som outbrutna områden till en annan ägare. Om lagenliga förutsättningar för tomtindelning föreligger, kan områdena styckas till egna fastigheter eller fogas till en befintlig fastighet invid det outbrutna området, exempelvis till en 3D-fastighet som köparen redan äger. Innan outbrutna områden kan styckas behövs det ytterligare en ny tomtindelning, i enlighet med gränserna för de outbrutna områdena. 
Övergången till tredimensionella fastigheter kräver i viss mån ett nytt grepp även när det gäller planeringen och genomförandet av byggprojekt. Fastighetsgränserna inom en byggnad kan öka utredningsbehoven till exempel i fråga om sådana ömsesidiga beroendeförhållanden mellan fastigheter som påverkar byggandet och användningen av fastigheten. Fastighetsägarna borde i ett tidigt skede av byggandet komma överens t.ex. om de gemensamma arrangemangen gällande konstruktioner och teknik, färdsel- och nyttjanderättigheter samt energilösningar och brandtekniska lösningar inklusive förverkligandet av dem. Det kan även uppstå nya behov att genom avtal säkerställa underhållet av byggnaderna och byggnadsdelarna t.ex. genom fördelning av ansvaret för underhållet. Ändringen kan i vissa fall leda till att de som bedriver verksamhet blir tvungna att ingå flera eller mera omfattande och invecklade avtal om byggnadsservitut och samreglering. I dessa situationer flyttas tyngdpunkten i avtalet sannolikt till ett tidigare skede i processen. Detta kan innebära att tidtabellen för ändringar i byggnaden förändras. Vid bygglovsförfarandet bör man lämna en tillräcklig utredning om det som nämns ovan, så att det är möjligt att bedöma uppfyllandet av förutsättningarna för beviljandet av bygglovet. Således kan de interna ärendena gällande byggobjektet lyftas fram vid myndighetsförfarandena mer än förut. Detta kan till exempel gälla byggnadernas interna tomtindelning samt sådana servitut och regleringar som myndigheterna stiftar och som gäller överskridning av interna fastighetsgränser. 
Även om inga nya myndighetsprocesser skapas medför lagstiftningsändringarna dock att man inom all myndighetsverksamhet bör uppgradera den egna processen så att den är förenlig med den nya lagen. Detta kommer att belasta myndigheterna temporärt, tills nya rutiner har utformats. Likaså kommer nya tolkningsfrågor att belasta myndigheternas tidsanvändning, tills läget har stabiliserats. När 3D-fastigheter införs kommer det att uppkomma nya tolkningsfrågor inom alla lagstiftningssektorer som på ett eller annat sätt berör fastigheter. I många äldre lagar talar man exempelvis om jordägare eller markägare, som vanligen som termer är synonyma med fastighetsägare. Ibland kan dock ett uttryck med förleden jord- eller mark- vara sådant att det länkas konkret till jorden eller marken och inte lämpar sig för ett luftutrymme.  
För 3D-fastigheter ska det inte bestämmas någon areal genom tomtindelning eller fastighetsbildning. Även detta kan medföra nya lagtolkningssituationer. Om en rättslig verkan är kopplad till det fysiska markområdet eller fastighetens areal, gäller det att avgöra från fall till fall hur detta ska tillämpas när det gäller 3D-fastigheter. I vissa bestämmelser har fastighet och byggnad behandlats nästan som synonymer. Även i dessa situationer förändras tolkningsmiljön. Tidigare har lagstiftaren styrts av en föreställning om en byggnad på en fastighet, och lagtexten har anpassats till detta. En ny tolkningssituation kan vara att en byggnad inte finns på området för en fastighet, utan det finns flera fastigheter inuti en byggnad. Exempelvis anslutningsskyldigheterna som gäller vatten och avlopp eller avfallshantering har angetts fastighetsvis, men i praktiken gäller de vanligen bebyggda fastigheter, dvs. omfattar byggnader och byggnadernas användare. 
Förslaget innebär att 3D-fastigheter är en sådan möjlighet inom detaljplanläggning som kan användas vid behov. Exempelvis områden för centrumfunktioner är områden där man genom planbestämmelser kan förlägga användningsändamål till olika våningar. Medvetenhet om 3D-fastigheter som en tänkbar grund för fastighetsindelning kan stödja planlösningen och underlätta genomförandet av den. Vissa komplicerade planlösningar, såsom utsprång, kan slopas när det blir möjligt att bilda en 3D-fastighet i luften. För dem som äger våningarna högst upp behöver man inte heller längre bilda artificiella tomter för att varje våningsplan ska vara ägare till åtminstone en liten fastighetsareal. Planerna kan förenklas, och en så bra läsbarhet som möjligt kan eftersträvas för plankartorna. Planerna kommer dock fortfarande att vara 2D-planer, och därför kan inte heller 3D-fastigheter presenteras autentiskt i 3D-form. Beskrivningen av användningen av 3D-fastigheter ska även i fortsättningen i hög grad basera sig på verbala planbestämmelser. 
Planläggare som utformar planbestämmelser bör komma ihåg vilka slags planbestämmelser som inte lämpar sig för 3D-fastigheter. 3D-fastigheter har exempelvis inte någon areal, varvid en arealbaserad planbestämmelse vanligen inte fungerar i samband med dem. En arealbaserad planbestämmelse kan rentav förhindra att en 3D-fastighet bildas inom ett område. Dessutom bör planläggaren beakta 3D-fastigheternas speciella karaktär. I praktiken kan de första våningarna i en byggnad tekniskt genomföras självständigt innan våningarna ovanför (3D-fastigheterna) byggs, men inte tvärtom. Ur planläggarens synvinkel kan situationen förutses och, om så önskas, tas om hand genom bestämmelser om genomförandet. 
Tomtindelning kommer att ha en avgörande roll vid bildandet av 3D-fastigheter inom ett byggnadskvarter, eftersom de enligt förslaget inte ska kunna bildas utan en tomtindelning. Av 3D-fastigheternas karaktär följer att deras gränser ofta är desamma som hela byggnadens eller en byggnadsdels gränser. Tomtindelningens betydelse förändras en aning på grund av dessa egenskaper. Den myndighet som ansvarar för tomtindelningen måste samarbeta mer med byggnadstillsynen för att den planerade byggnaden med sina fastighetsindelningar i tillräcklig grad ska motsvarar gränserna enligt tomtindelningen. Avsaknaden av areal medför nya tolkningssituationer när man vid tomtindelning dryftar hur byggrätten ska fördelas i höjdled mellan fastigheterna. Vid tomtindelning kommer det också att vara nödvändigt att avgöra vilket alternativ som är det ändamålsenligaste, 2D- eller 3D-fastighetsindelning, och hur man ska agera om fastighetsägarna inom området inte är överens om detta. 
Även byggnadstillsynsmyndigheten ställs inför nya tolkningssituationer när en byggnad kan inrymma flera fastigheter. Begrepp som byggnad, byggplats, besittning av byggplatsen och granne kan avvika från nuläget i en ny tolkningssituation. När det gäller byggnader med flera fastigheter och ägare kan det bli svårt att bestämma byggnadens interna rättigheter och skyldigheter fastighetsvis, trygga fastighetsägarnas självständighet och definiera behov av att stifta servitut. 3D-fastigheter ska enligt förslaget kunna inrättas genom tomtindelning utan någon explicit detaljplanebestämmelse, varvid exempelvis frågan om tillträde till fastigheten inte har lösts i någon detaljplan. Inte heller vid tomtindelningen tas det ställning till tillträde, och därför kan det bli en fråga som avgörs under bygglovsfasen. 
I fortsättningen kommer interna angelägenheter i ett byggnadsobjekt att få en mer framträdande plats inom byggnadstillsynsförfaranden. Det beror på att fastighetsgränserna inom en byggnad ökar utredningsbehoven. I dessa situationer gäller exempelvis vid bygglovsförfarande att frågan om huruvida förutsättningarna för bygglov är uppfyllda, i högre grad än tidigare är beroende av nyttjanderättigheter och andra rättigheter som hänför sig till andra fastigheter. Om bygglov inte söks för hela byggnadskomplexet på en och samma gång, kan det bli nödvändigt att vid tillståndsförfarandet för en enskild fastighet presentera exempelvis tekniska lösningar och stadsbildslösningar med en större räckvidd än den egna fastigheten. 
Åtminstone en del av byggbestämmelserna om tekniska krav som gäller byggandet har utformats utifrån tanken att en byggnad utgör en byggnadsteknisk helhet som avgränsas genom byggnadens mantel. En sådan bestämmelse riktas till hela byggnaden oberoende av fastighetsindelningen. I en byggnad med flera 3D-fastigheter ansvarar alla fastighetsägare i byggnaden för att förpliktelserna uppfylls. Det blir en krävande uppgift att behandla nya frågor av detta slag vid bygglovsförfarande och tillsyn över byggarbeten. Bygglovsprocessen och antalet utredningar som krävs av den sökande kan förändras i anslutning till de orsaker som nämns ovan eller på grund av att det föreslås vara möjligt att bygga på 3D-fastigheter redan innan tomten har införts i fastighetsregistret. Även när det gäller tillsyn under byggarbetstiden kan det i 3D-objekt bli aktuellt att beakta fler tillståndsvillkor än tidigare när det gäller servituts- och samreglering, vilket till denna del ökar byggnadstillsynsmyndighetens arbetsbörda. 
Lagändringen förändrar inte byggnadstillsynens nuvarande roll i byggnadsservituts- och samregleringsärenden. Ändringen innebär att byggnadstillsynsmyndighetens arbetsmängd ökar när det gäller servitut och samregleringar, eftersom det kommer att stiftas fler servitut och ingås fler avtal om samreglering än för närvarande. Servituts- och samregleringsärendena kommer också att var mer omfattande och mer invecklade än för närvarande. 
Bildandet av tredimensionella fastigheter kommer huvudsakligen att ske genom styckningsförrättningar i byggnadskvarter enligt en detaljplan och enligt en bindande tomtindelning. I praktiken kommer 3D-fastigheter i mycket begränsad omfattning att kunna bildas även genom klyvningsförrättningar i situationer av samägande. Liksom för närvarande kommer tvångsvisa markförvärv att ske enligt inlösningslagen främst vid projekt under markytan. Inlösen av ett tredimensionellt underjordiskt utrymme med äganderätt i stället för nyttjanderätt kommer att bli ett juridiskt genomförandesätt i stadscentrum (inom detaljplaneområden), exempelvis för genomförande av metrobanor eller andra underjordiska järnvägar eller trafiktunnlar. Projekt ovan jord kommer till en början att genomföras inom det tvådimensionella fastighetssystemet med nuvarande metoder för markförvärv och markhantering inom detaljplaneområden, varvid man antingen planlägger bara områden som tillhör det offentliga samfundet, gör frivilliga affärer eller tillämpar ett inlösningsförfarande enligt inlösningslagen. Även förrättningsslag som regleras i fastighetsbildningslagen är gångbara, i synnerhet inlösen av en tomtdel enligt 62 § eller reglering av byggnadsmark. Egentliga byggprojekt som stöder sig på det tredimensionella fastighetssystemet föreslås bli genomförda i form av samarbete mellan byggherren, planläggaren och fastighetsbildningsmyndigheten, exempelvis i form av en projektplan, samt genom frivilliga regleringsdokument eller regleringsavtal. Om ett regleringsavtal är en fungerande lösning kan samma avtal innehålla även i 164 § i markanvändnings- och bygglagen avsedda trafikförbindelseavtal och andra avtal som ingås genom samreglering för fastigheter, samt fastighets- och byggnadsservitut. 
Uppgifterna i fastighetsdatasystemet och i synnerhet uppgifterna i fastighetsregistret används på bred front i olika basregister och andra register, antingen genom att uppgifterna kopieras regelbundet eller så att de används via ett gränssnitt. I alla dessa system gäller det att i förekommande fall beakta de nya uppgifter som behövs för en 3D-fastighet eller ett 3D-outbrutet område, av vilka en del dock är enbart ändringar i kodsystemet. Befolkningsdatasystemet (BDS), fastighetsdatasystemet (FDS) samt företags- och organisationsdatasystemet utgör basregister. Befolkningsdatasystemet innehåller uppgifter om finska medborgare och utländska personer som bor i Finland varaktigt, om byggnader, om byggprojekt samt om lägenheter och lokaler. Uppgifterna i fastighetsregistret står som utgångspunkt vid tredimensionell fastighetsindelning. Vid sidan om Lantmäteriverket och de kommuner som för fastighetsregister finns det myndigheter som för register, såsom byggnads- och lägenhetsregistret (BLR), vid Patent- och registerstyrelsen, Skatteförvaltningen, Folkbokföringsförvaltningen och Statistikcentralen. Inom alla system där det behövs uppgifter om tredimensionella fastigheters utsträckning behövs det ändringar för att 3D-egenskaper ska kunna presenteras. Genom det förenklade genomförandesätt som nu planeras kan arbetsmängden begränsas och kostnaderna därmed reduceras. Ändringarna hänför sig till att lägga till vissa egenskaps- och lägesuppgifter, komplettera kodsystemet samt kopiera fastighetsregistermaterial och vidareförmedla materialet som överföringsfiler och gränssnittstjänster. Ändringar behöver också göras i verktygen för förandet av fastighetsregistret och i informationstjänstprodukterna. I de sistnämnda fallen bör egenskaperna hos ämbetsverkens system breddas för att den nya informationen ska kunna utnyttjas. 
4.3
Konsekvenser för miljön
Lagreformen bedöms inte få betydande, direkta konsekvenser för miljön. I och med reformen får aktörerna en ny modell för det praktiska genomförandet och administrerandet av vissa slags projekt. Konsekvenserna gäller i första hand utvecklandet av administrationen i fråga om kommande och befintliga byggobjekt och det mervärde som detta utvecklande ger. Möjliggörandet av tredimensionaliteten bedöms inte få några stora och direkta konsekvenser för hurdana byggnadshelheter kommunerna genomför, och därför kan man inte bedöma till exempel hur den föreslagna lagstiftningen inverkar på landskaps- eller stadsbilden eller på den byggda miljön. Syftet med tredimensionaliteten är således att erbjuda en fungerande metod för förvaltningen till exempel av högs byggnader, även om förbättringen av finansieringsmöjligheterna eller förtydligandet av förvaltningen av bygghelheterna inte till fullo kan lösa den fråga i planläggningen som gäller den allmänna ändamålsenligheten med byggandet som hör till en lagenlig planlösning. 
4.4
Samhälleliga konsekvenser
Fastighetsägarnas ställning påverkas av reformen främst till de delar fastigheten är belägen på ett område där det är sannolikt att dess tredimensionella utsträckning skulle tas i bruk oberoende av reformen av den gällande lagen. Möjligheten att bilda tredimensionella fastigheter ger inte i sig ägare av traditionella fastigheter nya användningsmöjligheter. Den får inte heller några direkta konsekvenser för verkställandet av fastighetsägarnas egendomsskydd. 
När det gäller utnyttjandet av fastigheterna är det redan nu möjligt för fastighetsägaren att vid behov utnyttja de helheter av fastigheten som finns ovanför eller under markytan. Om det på grund av fastighetens läge, storlek eller dess övriga egenskaper inte tidigare har funnits behov av sådan verksamhet inverkar inte möjligheten att bilda tredimensionella fastigheter på uppkomsten eller förekomsten av detta behov. För största delen av fastighetsägarna i Finland får lagreformen därmed inga konsekvenser. Till de delar basfastigheten är belägen till exempel i ett centrum där det även annars är möjligt eller vanligt att genomföra byggprojekt med flera användningsändamål, erbjuder bildandet av tredimensionella fastigheter en ny metod för att med tanke på projektet i fråga kunna förvalta fastighetens totala utsträckning så effektivt som möjligt. 
De tredimensionella fastigheternas konsekvenser för basfastighetsägarnas egendomsskydd bedöms närmare i detaljmotiveringens avsnitt 4 om förhållande till grundlagen samt lagstiftningsordning. 
Systemet som identifierar tredimensionella fastigheter kommer att förenkla förvaltningen av stora projekt inom fastighets- och byggbranschen, och detta bedöms främja byggandet av kompletterande objekt ovanför eller under de befintliga fastigheterna. Åtgärder som främjar kompletterande byggande ingår i de mål som Sipiläs regering har satt upp i dess regeringsprogram. 
5
Beredningen av propositionen
Vid Tekniska högskolan (det nuvarande Aalto-universitetet) gjordes år 2004 en licentiatundersökning om behovet av ett 3D-fastighetssystem. I undersökningen klarlades om det nuvarande tvådimensionella fastighetssystemet genererar praktiska problem för användningen av utrymmen ovanför och under markytan. Fastighetsingenjörernas klubb vid Suomen kuntatekniikan yhdistys – Finlands kommuntekniska förening ry föreslog den 23 mars 2005 genom ett initiativ till jord- och skogsbruksministeriet att fastighetsbildnings- och registreringslagstiftningen ska utvecklas med beaktande av de lösningar i fråga om tredimensionella markanvändningsarrangemang som man i praktiken redan bestämt sig för. 
Efter vissa förberedande åtgärder tillsatte jord- och skogsbruksministeriet den 11 maj 2006 en arbetsgrupp på bred basis för att utreda behovet av och utvecklingslinjerna för ett tredimensionellt (3D) fastighetssystem i Finland. Arbetsgruppens promemoria utgavs som jord- och skogsbruksministeriets publikation MMM 2008:1. Efter det har arbetet för att upprätta ett 3D-fastighetssystem fortsatt med en kartläggning av juridiska problem daterad den 11 april 2011, som hade beställts som en expertutredning från Helsingfors universitet, samt genom fortsatta utredningar inom Lantmäteriverkets interna projekt. I dessa har i ett senare skede deltagit fastighetsingenjörsrepresentanter för de stora städerna Helsingfors, Esbo och Tammerfors som ansvarar för fastighetsregisterföring. Inom projekten har experter hörts på bred front. 
Den 10 augusti 2015 tillsatte jord- och skogsbruksministeriet en arbetsgrupp för att bereda en lagstiftningsgrund för tredimensionell fastighetsbildning. Arbetsgruppen samlades tolv gånger och denna proposition har beretts vid jord- och skogsbruksministeriet utgående från arbetsgruppens arbete. 
Utkastet till propositionen sändes på remiss till justitieministeriet, finansministeriet, miljöministeriet, arbets- och näringsministeriet, kommunikationsministeriet, inrikesministeriet, Högsta förvaltningsdomstolen, närings-, trafik- och miljöcentralerna, Lantmäteriverket, Trafikverket, Skatteförvaltningen, Patent- och registerstyrelsen, Befolkningsregistercentralen, Finavia, Aalto-universitet, Helsingfors universitet, Åbo universitet, Lapplands universitet, Östra Finlands universitet, Helsingfors stad, Esbo stad, Tammerfors stad, Åbo stad, Uleåborgs stad, Jyväskylä stad, Kuopio stad, S:t Michels stad, Vanda stad, Lahtis stad, Kouvola stad, Björneborgs stad, Joensuu stad, Villmanstrands stad, Tavastehus stad, Vasa stad, Rovaniemi stad, Seinäjoki stad, Kotka stad, Salo stad, Finlands Kommunförbund rf, Finlands näringsliv rf, Finanssialan Keskusliitto - Finansbranschens Centralförbund ry, Centralförbundet för lant- och skogsbruksproducenter (MTK) rf, Svenska Lantbruksproducenternas centralförbund SLC rf, Jordägarnas Förbund rf, Finlands Fastighetsförbund rf, Byggnadsinspektionsföreningen RTY rf, Maanalaisten tilojen rakentamisyhdistys MTR ry, Byggnadsindustrin RT rf, RAKLI ry, Rakennustietosäätiö ry och Miljörättsliga Sällskapet i Finland rf. 
Även andra än de som fått begäran om utlåtande har fått lämna in yttranden. Utlåtanden lämnades in av sammanlagt 30 olika remissinstanser. 
Största delen av remissinstanserna ansåg att lagstiftningen om tredimensionell fastighetsbildning behövs och är ändamålsenlig. Särskilt de möjligheter som gäller byggandet under jorden ansågs vara fördelaktiga. Ingen remissinstans motsatte sig de lagändringar som möjliggör 3D-fastighetsbildning, och ingen ställde principiella krav på att det bör göras omfattande ändringar i det föreslagna systemet. De fäste dock särskilt uppmärksamhet vid de utmaningar som uppstår då en byggnad uppdelas i flera fastigheter och verksamheten inne i byggnaden överskrider fastighetsgränserna. I huvudsak gällde yttrandena detaljer eller begrepp i utkastet till propositionen, och ändringsförslagen gällde främst preciseringar. 
På basis av utlåtandena har man i motiveringen till propositionen preciserat den rättsliga ställningen hos en tredimensionell fastighet samt propositionens konsekvenser till de delar de gäller kommunerna. Dessutom har man kompletterat motiveringen när det gäller lagstiftningsordningen genom att särskilt precisera de föreslagna ändringarnas eventuella påverkningsmekanismer i fråga om egendomsskyddet enligt grundlagen. 
Efter remissrundan ändrades även nya 164 a § i propositionen som gäller den samreglering som är nödvändig i samband med en tredimensionell fastighet så att man lade till en bestämmelse om att samreglering i första hand ska förordnas på initiativ av fastighetsägarna och så att dessa har en möjlighet att påverka beslutet. Motiveringen till 194 § om besvärsrätt i fråga om separat tomtindelning preciserades till de delar som gäller avgränsandet av tillämpningsområdet för besvärsrätten och särskilt vad gäller förhållandet till de nya bestämmelserna om hörande i 79 och 133 §. 
Utkastet till regeringspropositionen har bedömts av rådet för bedömning av lagstiftningen under oktober-november 2017. Rådet för bedömning av lagstiftningen gav sitt utlåtande den 9 november 2017. I utlåtandet rekommenderade man en strukturell omformning av propositionen, flera kvantitativa konsekvensbedömningar samt allmänna preciseringar av propositionens konsekvensbedömningar. Efter detta har man kompletterat propositionens konsekvensbedömningar utgående från rådets utlåtande så uttömmande som möjligt, särskilt vad gäller de ekonomiska konsekvenserna. Man har även klargjort bakgrunden till konsekvensbedömningarna i propositionen. 
6
Samband med andra propositioner
Bestämmelserna i 2 § i fastighetsregisterlagen har ändrats genom lag 375/2006 till den del bestämmelserna gäller vägrättigheter. Den lagen trädde i kraft vid ingången av 2017 och har beaktats i denna proposition. 
DETALJMOTIVERING
1
Lagförslag
1.1
Fastighetsbildningslagen
2 §. Paragrafen innehåller de definitioner som används i lagen. I 1 mom. 1 punkten ingår definitioner av fastighet och fastighetens utsträckning. Dessa definitioner har dock utformats utgående från fastighetsindelning som baserar sig på ett tvådimensionellt fastighetssystem. Med fastighet avses enligt gällande lag en sådan självständig enhet för jordäganderätt som med stöd av fastighetsregisterlagen (392/1985) ska införas som fastighet i fastighetsregistret. I punkten definieras fastighet således genom en hänvisning till fastighetsregisterlagen och skyldigheten enligt den lagen att i fastighetsregistret införa vissa enheter som fastigheter. 
Definitionen inrymmer i sin nuvarande form ett villkor om att den helhet som införs i registret med stöd av fastighetsregisterlagen ska vara en enhet för jordäganderätt. Kravet grundar sig dock inte på fastighetsregisterlagen, utan ingår enbart i fastighetsbildningslagen. 
Inom det traditionella tvådimensionella fastighetssystemet har kravet på fastighetens samband med ett konkret markområde varit logiskt, eftersom man med fastigheter i praktiken har avsett endast sådana delar på marken som specificerats på ett visst sätt. Kravet på ett markområde är dock problematiskt med tanke på de tredimensionella fastigheterna. Det föreslås att fastighetsregisterlagen ska ändras så att det blir möjligt att i registret som fastigheter införa även sådana både horisontellt och vertikalt avgränsade helheter som inte alls inrymmer något egentligt markområde (tredimensionella fastigheter). 
Det är meningen att fastighetsbegreppet enligt fastighetsbildningslagen även i fortsättningen ska kvarstå som förenligt med fastighetsregisterlagen via en likadan hänvisningsbestämmelse som den nuvarande. Tredimensionella fastigheter som avses i fastighetsregisterlagen är således i fortsättningen fastigheter också ur perspektivet för fastighetsbildningslagen. Till 2 § 1 mom. 1 punkten i fastighetsbildningslagen fogas enligt förslaget därför ett omnämnande av att med fastighet avses i lagen förutom enheter för jordäganderätt även andra enheter som införs som fastigheter i fastighetsregistret. Detta bevarar ett likadant samband mellan fastighetsbildningslagens och fastighetsregisterlagens fastighetsbegrepp som för närvarande och gör det möjligt att tillämpa den gällande regleringen av fastigheter i stor sett i oförändrad form. 
Ändringen påverkar inte den definition av fastighetens utsträckning som ingår i samma punkt. En tredimensionellt bestämd fastighets utsträckning sammanfaller nämligen definitionsmässigt helt och hållet med det som gäller för traditionella fastigheter i markplanet. 
Det föreslås att enligt fastighetsregisterlagen ska tomter, allmänna områden och inlösningsenheter kunna vara tredimensionella fastigheter. Inte heller i ett fall med tredimensionella fastigheter ska en lagakraftvunnen detaljplan vara förknippad med en omedelbar fastighetsbildningseffekt, utan varje 3D-fastighet ska alltid bildas till en i fastighetsregisterlagen avsedd registerenhet vid en fastighetsförrättning, i praktiken styckning. 
Tredimensionella fastigheter ska enligt förslaget inte kunna bildas någon annanstans än inom detaljplaneområden. Det att utarbetandet av detaljplaner är en uppgift uteslutande för kommunen hindrar i praktiken att 3D-fastigheter bildas inom andra områden. I en detaljplan kan man dessutom på ett naturligt sätt bestämma det läge som med koordinater (x, y, z) angetts för ett utrymme ovanför eller under markytan, och dess utsträckning kan följaktligen anges på ett allmänt förståeligt sätt. Detaljplanen föreslås i normala fall bli slutgiltigt genomförd i byggnadskvarteret efter godkännande av den bindande tomtindelningen och efter styckning uteslutande utifrån tomtindelningen. Via processen blir de bindande procedurbestämmelserna om den växelverkan, det hörande och den miljökonsekvensbedömning som hänför sig till utarbetandet av detaljplaner ett led i planeringsarbetet och stärker intressebevakningen för tredje parter. När detaljplanen är utformad för detta kan man enligt förslaget i fortsättningen skapa sakrättsligt nya fastighetsenheter. I praktiken ska gränserna för en sådan enhet anges mycket exakt i en bindande tomtindelning, som också kan utarbetas separat. Gränserna för en 3D-fastighet som bildats vid en fastighetsförrättning anger vanligen vad som hör till 3D-fastigheten som beståndsdelar. Detta gäller exempelvis en sådan del av en byggnad som finns ovanför markytan och innanför gränserna för en 3D-fastighet trots att byggnaden som en helhet har fogats till marken för basfastigheten nedanför 3D-fastigheten. 
En underjordisk 3D-fastighet föreslås inte omfatta enbart ett insprängt utrymme under jord, utan till fastigheten ska som beståndsdelar hänföras vissa avgränsande väggar, taket och golvet, vilkas tjocklek anges med koordinater eller motsvarande bestämmelser i detaljplanen, med beaktande av säkerhetsaspekter. På så vis nås två mål. Dels är en tredimensionell fastighet som införts i fastighetsregistret inte ett öppet utrymme, utan ett föremål som kan definieras fysiskt, dels inrymmer en underjordisk 3D-fastighet av detta slag en omgivande zon som förblir orörd och tryggar bevarandet av fastigheten. 
Utsträckningen för en tredimensionell fastighet ovanför markytan (basfastighetsindelningen) baserar sig på den horisontella områdesreservering som angetts i detaljplanen och på den vertikala byggrätt (våningsyta och antal våningsplan) som angetts i detaljplanen. I ett byggnadskvarter preciseras 3D-fastighetens utsträckning vid tomtindelningen. 3D-fastighetens slutliga, exakta läge bestäms först under planerings- och genomförandefasen för byggandet. För 3D-fastigheter föreslås som identifikationsuppgifter i fastighetsregistret bli införda bl.a. uppgifter om fastighetens horisontella geometri, fastigheterna under och ovanför, höjdläge samt en separat bifogad fil med en tredimensionell modell av 3D-fastigheten. 
Enligt förslaget ska en underjordisk tredimensionell fastighet juridiskt avskiljas till en egen registerenhet från äganderätten till basfastigheten antingen genom ett avtal med basfastighetens ägare (överlåtelse som avses i 2 kap. 1 § i jordabalken) eller undantagsvis vid en inlösningsförrättning med stöd av lagen om inlösen av fast egendom och särskilda rättigheter (603/1977). Även inlösen av en tomtdel enligt 62 § i fastighetsbildningslagen föreslås vara en möjlighet, så även inlösningsförfaranden enligt 62 a och 62 b §. Enligt förslaget avskiljs en underjordisk fastighet eller en fastighet ovanför basfastigheten tekniskt vid en fastighetsförrättning, oftast genom styckning. Vid behov ska styckning vara en möjlighet också för ägarens egna behov. När det är fråga om upplösning av ett samäganderättsförhållande ska också en klyvningsförrättning vara en möjlighet vid sidan om ett avtal om upplösning eller reglering av samägandeförhållandet med tillhörande styckningsförrättning. 
20 §. I paragrafen definieras innehållet i och syftet med styckning samt vad som avses med samstyckning. I och med att det föreslås bli möjligt att bilda tredimensionella fastigheter föreslås det också att regleringen av styckning samt outbrutna områden ändras så att den lämpar sig även för styckning av tredimensionellt bestämda helheter. För fastighetssystemets enhetlighet och funktion är det viktigt att tredimensionellt bestämda fastigheter till sina juridiska egenskaper också i detta sammanhang är så lika traditionella fastigheter som möjligt. Till 1 mom. föreslås därför bli fogat ett omnämnande av att på en registerenhet kan förutom ett område med bestämda gränser även ”en helhet med bestämd utsträckning horisontellt och vertikalt” bildas till en särskild fastighet eller överföras till en förefintlig fastighet genom styckning. 
Bildande av tredimensionellt bestämda fastigheter föreslås i enlighet med 2 § i fastighetsregisterlagen anknyta till en detaljplan samt en tomtindelning. Tredimensionella fastigheter föreslås i allmänhet kunna bildas endast om inte något annat följer av planen, och tomter endast om de ingår i en bindande tomtindelning. Tredimensionella överlåtelser av en del av en fastighet baserar sig enligt förslaget i praktiken alltid på en stark uppfattning om innehållet i planläggningen. Inte heller när det gäller tredimensionellt bestämda outbrutna områden föreslås det att lagstiftningen ska ålägga fastighetsinskrivningsmyndigheten skyldighet att bedöma fastighetsbildningsmöjligheterna för outbrutna områden som är i omsättning. Risken för att en slutlig tredimensionellt bestämd fastighet inte kan bildas av ett outbrutet område bärs således av överlåtelseparterna själva på samma sätt som när det gäller traditionella fastigheter. 
Vid bildandet av en tomt är det enligt andra meningen i 20 § genom beslut av förrättningsmännen möjligt att i ringa grad avvika från tomtindelningen enligt vad som närmare föreskrivs genom förordning. När 3D-fastigheter bildas genom styckning från en tvådimensionell ”basfastighet” eller från flera tvådimensionella ”basfastigheter”, bör denna bestämmelse när det gäller 3D-fastigheter tolkas så att avvikelser är möjliga endast inom området för samma basfastighet eller samma basfastigheter. 
25 §. Fastighetsbildningslagen tillämpas också på fastighetsförrättningar som gäller samfällda skogar, om inte något annat föreskrivs särskilt. Paragrafen innehåller bestämmelser som tryggar panthavarens rättsliga ställning vid styckning på ett samfällt område. Eftersom 37 § i lagen om samfällda skogar (109/2003) innehåller en egen bestämmelse om tryggande av panthavarens rättsliga ställning när ett område överlåts från en samfälld skog eller en samfälld skog säljs, behöver inte 25 § 1 och 2 mom. i fastighetsbildningslagen tillämpas vid styckning av en samfälld skog som sålts eller av ett område av en samfälld skog som överlåtits. Den tidigare lagen om samfällda skogar (37/1991) upphävdes i sin helhet genom den lag om samfällda skogar (109/2003) som trädde i kraft den 1 mars 2003, och därför föreslås det att den hänvisande bestämmelsen i 3 mom. ändras så att det hänvisas till den gällande lagen om samfällda skogar och motsvarande bestämmelser i den. 
85 §. Det föreslås att paragrafens gällande lydelse ändras tekniskt så att hänvisningen till den upphävda lagen om samfällda skogar (37/1991) ändras så att det hänvisas till den gällande lagen om samfällda skogar (109/2003). 
154 §. I gällande lag föreskrivs det i enlighet med den fastighetsrättsliga typtvångsprincipen noggrant om de servitutstyper som kan stiftas genom fastighetsförrättningar och införas i fastighetsregistret. När det i en detaljplan bestäms om bildande av en tredimensionell fastighet ovanför eller under jord, bör man i samband med utarbetandet av planen i första hand avgöra sådana arrangemang som behövs för att trygga en ändamålsenlig användning av den tredimensionella fastigheten. I synnerhet när det gäller 3D-fastigheter kommer ordnande av förbindelser ofta att vara en fråga som avgörs separat. 
Förbindelsearrangemang som gäller 3D-fastigheter kan ordnas genom sådan samreglering av fastigheter som avses i 164 § i markanvändnings- och bygglagen eller i den föreslagna 164 a § i den lagen. Om en förbindelse kan ordnas med utnyttjande av en byggnad eller en konstruktion som finns på en annan fastighet, blir det aktuellt med ett byggnadsservitut enligt 158 § i markanvändnings- och bygglagen. 
För ordnande av förbindelser är det dock i vissa situationer ändamålsenligt att använda sådana fastighetsservitut enligt fastighetsbildningslagen som är förenade med rätt att använda en annan fastighets område på ett visst sätt. För att möjliggöra detta föreslås det att 154 § 1 mom. 11 punkten i fastighetsbildningslagen omformuleras så att det område som behövs för vägförbindelse till en fastighet inom ett detaljplaneområde ska kunna vara även tredimensionellt bestämt i fortsättningen. 
1.2
Fastighetsregisterlagen
2 §. I 1 mom. anges enheter som införs som fastigheter i fastighetsregistret. Hittills har fastigheterna utan undantag varit enbart på markägande baserade fysiska markområden som specificerats på ett visst sätt och angetts i markplanet. 
Enligt den föreslagna ändringen ska man som fastigheter i registret i fortsättningen kunna införa också helheter som är avgränsade både horisontellt och vertikalt och där det inte ingår något egentligt i markplanet bestämt markområde. För att helheten ska införas i registret ska den enligt förslaget också finnas inom ett detaljplaneområde, och om det är fråga om en tomt ska den ingå i en bindande tomtindelning. 
Av de fastighetsslag som är kända för närvarande kan, bestämda på det sätt som nämns ovan, i registret i fortsättningen införas tomter, allmänna områden och inlösningsenheter. Enheter införda som avgränsade både horisontellt och vertikalt vidkänns enligt förslaget som tredimensionella fastigheter (3D-fastigheter). De fastighetsslag som nämns ovan kommer i praktiken att täcka alla de situationer där bildning av tredimensionella fastigheter är en ändamålsenlig lösning. Under den första fasen är det inte nödvändigt att möjliggöra tredimensionell bildning för de övriga fastighetstyper som förtecknas i 2 §. 
En förutsättning för att en 3D-fastighet ska införas i registret föreslås vara att den fastighet som avses bli registrerad finns inom ett detaljplaneområde. Enligt förslaget ska lagen inte förutsätta att planen innehåller ett uttryckligt omnämnande av att det är möjligt att bilda 3D-fastigheter inom planområdet. Ett sådant krav skulle rent konkret förutsätta att planen ändras för att möjliggöra 3D-fastigheter alltid när det handlar om en plan som har utarbetats före lagstiftningen om tredimensionella fastigheter, eftersom de gamla planerna naturligt nog inte kan innehålla beslut om tillämpning av tredimensionalitet i området. Ett sådant förfarande är inte meningsfullt för att fördelarna med det nya systemet ska bli verklighet. 
Den enda begränsning för bildande av tredimensionella fastigheter som följer av planläggningen är enligt förslaget att bildandet av tredimensionella fastigheter inte får strida mot genomförandet av den detaljplan som redan finns. Denna princip föreslås bli inskriven i 2 § så att det i 2 mom. konstateras att tredimensionella kan bildas, ”om inte något annat följer av innehållet i detaljplanen”. Det handlar om en sådan situation exempelvis när områdets användningsändamål enligt planen är kvartersområde för småhus där exploateringsgraden i praktiken inte möjliggör tredimensionell fastighetsbildning utan en planändring. Den befintliga planen ska i praktiken bedömas i förhållande till tredimensionaliteten från fall till fall, och den planerade tredimensionella lösningen uppfylla förutsättningarna i lagstiftningen precis som vid tvådimensionella lösningar. 
Den föreslagna formuleringen av bestämmelsen utgör den grundläggande bestämmelsen om tredimensionellt bestämda fastigheter. Begreppet tredimensionellt bestämd fastighet introduceras här i lagstiftningen med målet att definiera det så att det till sin juridiska karaktär så nära som möjligt motsvarar begreppet traditionell tvådimensionellt bestämd fastighet och att de bestämmelser om fastigheter som redan ingår i gällande lagstiftning i allt väsentligt ska kunna tillämpas på begreppet. Om inga särskilda eller tvingande skäl följer av sakens natur bör 3D-fastigheter behandlas juridiskt helt på samma sätt som traditionella 2D-fastigheter. Förslaget att definiera 3D-fastigheter i samma bestämmelse och på motsvarande sätt som andra enheter som införs som fastigheter i registret innebär att det samlade system som uppkommer blir så tydligt som möjligt att tillämpa och minimerar behovet av ytterligare ändringar i lagstiftningen. 
1.3
Markanvändnings- och bygglagen
78 §.Tomtindelning. I paragrafen föreskrivs det om tomtindelning. I slutet av 2 mom. föreslås en ny mening, av vilken möjligheten till tredimensionell tomtindelning och fastighetsbildning framgår. I den föreslagna meningen konstateras det att den bindande tomtindelningen kan vara helt eller delvis tvådimensionell eller tredimensionell. I en bindande tomtindelning kan man göra många slags och även blandade lösningar som gäller tomternas horisontella och vertikala gränser. Systemet är smidigt till denna del. 
Det föreslås att det sista momentet i paragrafen upphävs. Enligt momentet får bestämmelserna om tomtindelning inte tillämpas på området för en detaljplan för underjordiska utrymmen. Förslaget innebär att även områden som i detaljplaner för underjordiska utrymmen reserverats för byggverksamhet kan indelas i tomter, om detta är nödvändigt för att reglera markanvändningen. 
Reformen föreslås eftersom stadsstrukturen allt oftare utvidgas under jord. Användningen av ett underjordiskt utrymme uppges vanligen tredimensionellt i detaljplanen så att områdets, exempelvis ett trafikområdes, vertikala förhållande och höjdläge i förhållande till andra funktioner på olika våningsplan inom samma område och i förhållande till verksamhet på markplanet anges genom planbestämmelser. Med hjälp av bildning av tredimensionella fastigheter kan dessa underjordiska utrymmen delas upp i tredimensionella äganderättsenheter med iakttagande av de i planen och tomtindelningen angivna kvarters- och fastighetsgränserna. 
79 §. Utarbetande av separat tomtindelning. I paragrafen föreskrivs det om separat tomtindelning. När en separat tomtindelning bereds ska enligt 2 mom. ägare och innehavare av området för tomtindelningen och angränsande fastigheter höras, liksom också ägaren och innehavaren till en fastighet mittemot vars bebyggande eller användning på annat sätt beslutet i väsentlig mån kan påverka. 
Med anledning av tredimensionell fastighetsbildning föreslås det att ett nytt 3 mom. fogas till paragrafen. Det nuvarande 3 mom. som gäller behörigheten för den som utarbetar tomtindelningen blir samtidigt 4 mom. Paragrafens bemyndiganden att utfärda förordning flyttas till nya 5 mom. Enligt det nya 3 mom. ska även andra än i 2 mom. avsedda fastighetsägare utanför tomtindelningen höras, om beslutet i väsentlig mån kan påverka den berörda fastighetens bebyggande eller användning på annat sätt. Det nya momentet tillämpas endast om tomtindelningen görs i ett kvarter som redan har en tredimensionell tomtindelning. Denna begränsning skrivs enligt förslaget in i bestämmelsen. I bestämmelsen framförs likaså att en fastighet som eventuellt omfattas av hörande kan finnas ovanför, under eller bredvid området för tomtindelningen. Information om fastigheternas läge avgränsar i praktiken inte momentets tillämpningsområde men för fram det faktum att tredimensionella fastigheter kan finnas under och ovanpå varandra eller parallellt, även utan att ha kontakt med markytan. De behöver inte heller gränsa till varandra. 
Ett syfte med den nya regleringen är att säkerställa att man vid separata tomtindelningsförfaranden hör även andra än ägarna till de fastigheter som direkt gränsar till området för tomtindelningen, om villkoret om väsentlig påverkan uppfylls. Bestämmelsen behövs för att säkerställa att ägarna till fastigheterna ovanför, under och parallellt med projektet hörs i synnerhet när fastigheterna finns eller kan finnas i samma byggnad och fastigheternas användning är beroende av användningen av fastigheterna inom området för tomtindelningen. 
I 2 mom. finns en bestämmelse om bemyndigande att utfärda förordning om utarbetande av tomtindelning. Bestämmelsen har använts som bestämmelse om bemyndigande för 37 § i markanvändnings- och byggförordningen. I den paragrafen föreskrivs det om skyldighet att vid tomtindelningen se till att varje tomt gränsar till ett gatuområde. Vidare föreskrivs det om de närmare grunder med hjälp av vilka tomternas form och storlek bestäms. Med anledning av tredimensionell fastighetsbildning bör förordningen ändras i fråga om kravet på att gränsa till ett gatuområde, eftersom det inte är meningen att förbindelserna till fastigheterna i samma byggnad alltid ska regleras så att varje fastighet har självständig passage direkt till ett gatuområde. De undantag från kravet på körförbindelse som för närvarande ingår i paragrafen är inte tillräckliga för byggnader som inrymmer 3D-fastigheter. Bestämmelsen bör följaktligen ändras så att förordningens krav i fråga om körförbindelser inte alls tillämpas på 3D-fastigheter. Rent konkret kommer fastighetsägarna inom området för tomtindelningen att komma överens om förbindelserna inom byggnaden, och myndighetstillsynen över ansvaret för dem blir en angelägenhet för faser som infaller senare än tomtindelningen, nämligen fasen för bygglovsförfarande och fasen för fastighetsbildning. 
Med stöd av samma bemyndigande att utfärda förordning har även 38 § i markanvändnings- och byggförordningen utfärdats. Den paragrafen gäller tomtindelningskartor. Det krav på att en tomtindelningskarta ska ange tomternas arealer som för närvarande ingår i paragrafen bör också strykas med avseende på 3D-fastigheter, eftersom det inte går att ange några arealer för 3D-fastigheter som har en sådan form att arealerna inte kan räknas ut på ett entydigt sätt. 
81 a §.Undantag från tomtindelningens rättsverkningar till följd av tredimensionella fastigheter. Till lagen fogas enligt förslaget en ny 81 a §, som gäller 3D-fastigheter och där det föreskrivs om vissa rättigheter att avvika från tomtindelningens rättsverkningar enligt 81 §. Enligt 81 § 1 mom. får en byggnad inte uppföras i strid med en bindande tomtindelning, och enligt 2 mom. 2 punkten får bygglov inte beviljas för en tomt enligt en bindande tomtindelning förrän den har införts i fastighetsregistret. I den nya paragrafen föreslås undantag från dessa bestämmelser när det handlar om ett projekt där 3D-fastigheter ingår och om dess bygglovsförfarande. 
En 3D-fastighet ovan jord och bebyggande av den kan avvika från en traditionell tomt och bebyggandet av den. Traditionellt ska en byggnad uppföras på området för en tomt på ett visst avstånd från tomtgränserna, och till en tomt hör vanligen ett gårdsområde och andra utomhusområden. Som en form av tredimensionell tomtindelning föreslås att den byggnad som ska uppföras eller redan har uppförts delas upp i äganderättsenheter så att en byggnad inrymmer flera fastigheter. De kan finnas ovanpå varandra eller bredvid varandra eller gå in i varandra i byggnaden. En sådan fastighet har i allmänhet inga utomhusområden, och rent konkret går det inte att uppföra en byggnad eller en del av en byggnad på fastigheten helt självständigt utan att utnyttja eller ta hänsyn till fastigheterna ovanför och nedanför. Tredimensionell fastighetsbildning innebär att det i en byggnad kan finnas flera fastighetsägare, som var och en äger endast sitt eget utrymme med tillhörande konstruktioner. 
Vid bygglovsprövningen kontrollerar man att tomtindelningen iakttas och att ägaren har besittningsrätt till hela byggplatsen. Inom ett område för tredimensionell tomtindelning bör dessa krav tolkas med hänsyn till det sätt att äga som beskrivs ovan. Kraven på ägarbesittning och iakttagande av tomtindelningen uppfylls när ägaren till en 3D-fastighet har besittningsrätt till sitt utrymme och när den del av byggnaden enligt bygglovsansökan som berör utrymmet finns inom dess gränser. Man bör hålla denna utgångspunkt i minnet när man tolkar 81 och 81 a § inom ett område för tredimensionell tomtindelning. 
I paragrafens 1 mom. föreslås en bestämmelse om att det i projekt där en 3D-fastighet ingår trots 81 § 1 mom. ska vara tillåtet att i ringa mån avvika från tomtindelningen, om de ägare till grannfastigheterna till vilkas nackdel gränsen överskrids ger sitt samtycke till detta. Samtidigt ska parterna i praktiken dock oftast komma överens om att besittningen av byggplatsen ska utvidgas i enlighet med 81 § 3 mom. Bestämmelsen behövs på grund av den tredimensionella fastighetsbildningens karaktär, där byggnadens konstruktioner och tomt i allmänhet i praktiken har samma gränser, om målet är att dela upp den kommande byggnaden i flera fastigheter. Under bygglovsfasen kan det uppdagas byggtekniska eller andra behov av att uppföra till exempel en mellanvägg som visar en gräns som avviker en aning från gränserna enligt tomtindelningen. Om man samtidigt någonstans går utanför gränserna för en tomt enligt tomtindelningen befinner man sig omedelbart på grannens sida. För en ökad flexibilitet föreslås det att gränserna enligt tomtindelningen i sådana fall ska kunna frångås med samtycke av grannen utan att tomtindelningen först ska ändras. Den en aning ändrade sträckningen kan fastställas genom fastighetsbildning under de förutsättningar som anges i 20 § i fastighetsbildningslagen, dvs. det kan bestämmas att gränserna för den fastighet som bildats ska motsvara den rätta sträckningen, som ändrats under byggandet. I slutet av momentet föreslås en informativ hänvisning till 20 § i fastighetsbildningslagen. 
Den ovannämnda möjligheten att avvika i ringa mån behöver inte tillämpas i praktiken, om projektet framskrider så att tomtindelningen och bygglovsförfarandet genomförs parallellt och om man vid tomtindelningen använder samma ritningar som vid bygglovsförfarandet. Ett sådant tillvägagångssätt är förnuftigt i praktiken, om byggprojektet avancerar som en helhet och om parterna vill ge plats för flexibilitet i byggprojekteringen. En alltför tidig tomtindelning medför i dessa situationer ett behov av att ändra tomtindelningen, om behovet att ändra gränserna är större än ringa. 
I paragrafens 2 mom. föreslås en bestämmelse om undantag från kravet att bygglov inte får beviljas för en tomt enligt en bindande tomtindelning förrän den har införts i fastighetsregistret. Avsikten är att tillåta byggande före registreringen så att den faktiska placeringen av byggnaden och dess innerväggar och andra konstruktioner kan beaktas vid registreringen av byggnaden i enlighet med 20 § i fastighetsbildningsförordningen. Vid en fastighetsförrättning som verkställs för att bilda en tomt kan enligt 20 § i fastighetsbildningsförordningen med sakägarnas medgivande göras mindre justeringar av en tomts gränser jämfört med den bindande tomtindelningen på grund av att tomtens eller byggnadsytans lämplighet med tanke på byggnadsprojektet eller befintliga byggnader, konstruktioner, trädbestånd, planteringar, vägförbindelser, underjordiska ledningar eller andra motsvarande orsaker förutsätter avvikelse från tomtindelningen. I 2 mom. föreslås också en bestämmelse enligt vilken byggnaden inte får tas i bruk förrän tomten har införts i fastighetsregistret. Bestämmelsen behövs för att säkerställa att tomten registreras genast när tomtens gränser har preciserats i och med byggandet. Byggnadstillsynsmyndigheten redogör för förutsättningarna för ibruktagandet och ger genom den slutsyn som avses i 155 § i denna lag lov att använda byggnaden. Delvis motsvarar bestämmelsen om fastighetsregistrering som förutsättning för ibruktagandet av byggnaden den bestämmelse som finns i 5 § i lagen om försök med förenklade bygg- och planbestämmelser (1257/2010). Enligt den kan bygglov i de kommuner som nämns i den bestämmelsen beviljas innan tomtindelningen utarbetats och tomten styckats. I bygglovet ska då anges att byggnaden inte får tas i bruk förrän tomten införts i fastighetsregistret. 
128 §.Tillstånd för miljöåtgärder. I paragrafens 1 mom. 4 punkt gjordes det genom ändringen av markanvändnings- och bygglagen 230/2017 en ändring som var ämnad att vara teknisk. Efter det att ändringen trädde i kraft lade man dock märke till att detta kunde tolkas som en ändring av bestämmelsens innehåll. I och med ändringen betyder en tillämpning i enlighet med bestämmelsens ordalydelse att kravet om tillstånd för miljöåtgärder alltid gäller på ett område där byggande inte är tillåtet på grund av generalplanen eller en ändring av generalplanen. Så var inte fallet enligt den gamla ordalydelsen. Eftersom syftet med lagändringen 230/2017 inte var att ändra bestämmelsens innehåll, föreslås det att paragrafens 1 mom. 4 punkt ändras så att den motsvarar den ordalydelse som gällde före ikraftträdandet av lagändringen 230/2017. 
133 §.Hörande och utlåtanden. I paragrafen föreskrivs det om hörande av grannarna vid ett bygglovsförfarande. Det föreslås att ett nytt 2 mom. fogas till paragrafen. I momentet utvidgas begreppet granne på ett sådant sätt som behövs på grund av tredimensionell fastighetsbildning. De nuvarande 2–4 mom. blir samtidigt 3–5 mom. 
Med granne avses enligt det gällande 1 mom. ägaren eller innehavaren av en fastighet eller ett annat område som ligger invid eller mittemot. Den bestämmelsen kvarstår enligt förslaget oförändrad. Enligt det föreslagna 2 mom. kan en granne utöver det som anges i 1 mom. också vara ägaren eller innehavaren av en fastighet som ligger ovanför eller under byggplatsen, även om denne inte är direkt gränsgranne. På motsvarande sätt kan ägaren eller innehavaren av en med byggplatsen parallell fastighet som ligger i samma kvarter vara granne, även om det inte handlar om en direkt gränsgranne. Det föreslås dock begränsningar för tillämpningen av det nya momentet. För det första föreslås momentet bli tillämpat endast om det byggs i ett kvarter som har en tredimensionell tomtindelning. Med andra ord befinner man sig i ett kvarter där man kan bilda eller redan har bildat tredimensionella fastigheter. Den andra begränsningen hänför sig till att begreppet granne som ska höras kopplas till hur pass väsentliga konsekvenser projektet har. Såsom granne betraktas endast ägaren eller innehavaren av en sådan fastighet vars bebyggande eller användning i annat syfte i väsentlig mån kan påverkas av beslutet. 
På grund av tredimensionell fastighetsbildning kan det uppkomma en situation där ett projekt i väsentlig mån påverkar användningen av en fastighet som ligger i samma byggnad eller vars konstruktioner är anslutna till samma byggnad och som finns ovanför eller under eller bredvid. Användningen av fastigheterna kan byggnadstekniskt, på grund av samregleringar eller av någon annan orsak vara starkt sammankopplad. Vid förfarandet är det nödvändigt att höra en sådan starkt sammankopplad fastighetsägare, om det tillståndspliktiga projektet i väsentlig mån påverkar byggandet eller användningen av fastigheten. På motsvarande sätt kan samma situation gälla en obebyggd fastighet, om det utifrån en detaljplan eller något annat myndighetsbeslut går att sluta sig till att fastigheternas bebyggande eller användning i annat syfte i väsentlig mån bygger på samarbete mellan dem och på gemensamma regleringar. 
I paragrafen görs det en språklig ändring så att frasen ” innehavarna av grannfastigheterna” ändras till ”grannarna”.  
158 a §.Servitut som är nödvändigt på grund av en tredimensionell fastighet. I paragrafen föreslås en bestämmelse om ett nytt servitut som är nödvändigt på grund av tredimensionell fastighetsbildning. Ett sådant byggnadsservitut ska enligt förslaget kunna stiftas utan ett i 158 § 1 mom. avsett samtycke av dem som saken gäller. Vid stiftandet av servitutet ska i övrigt iakttas vad som föreskrivs i 158 §. Ett servitut kan således stiftas endast om det främjar ett ändamålsenligt byggande eller en ändamålsenlig användning av fastigheten, servitutet är nödvändigt för innehavaren av servitutsrätten och det kan säkerställas att det inte medför betydande olägenhet för den belastade fastigheten. 
Ett servitut kan vara nödvändigt på grund av den tredimensionella fastigheten bland annat när det i samma byggnad finns flera fastigheter som går in i varandra eller ligger ovanpå varandra eller parallellt. I praktiken kan dessa fastigheter ofta inte användas självständigt, utan bebyggandet, den dagliga användningen och underhållet av dem förutsätter rätt att använda grannfastigheterna, exempelvis för att färdas och för att förlita sig på konstruktioner. 
Av tradition har ett tvångsservitut kunnat stiftas med stöd av 159 §, om detaljplanen förutsätter det, bl.a. för att ordna trafikförbindelse. Samma detaljplanegrund kan användas även när det gäller tredimensionella fastigheter, om den tredimensionella karaktären baserar sig på en detaljplan. Det kan dock finnas situationer där man i planen ännu inte har tagit ställning till fastighetsbildningen, utan beslut om tredimensionalitet som en form för att genomföra fastigheterna fattas först genom en separat tomtindelning. För dessa situationer behövs det en självständig tvångsservitutsgrund som hänför sig till 3D-fastighetsbildning. 
Utgångspunkten är fortfarande att man genom servituts- och samregleringsavtal mellan fastigheterna kommer överens om fastigheternas inbördes nyttjanderättigheter och andra rättigheter. Rätt att ansöka om tvångsservitut eller tvångssamreglering gäller i praktiken för sådana situationer där man av någon anledning undantagsvis inte når någon överenskommelse. 
Närmare bestämmelser om byggnadsservitut finns i 80 § i markanvändnings- och byggförordningen. Den paragrafen innehåller en uttömmande förteckning med åtta punkter om de typer av servitut som kan stiftas med stöd av den förordningen. Paragrafen bör ändras så att ett servitut som tjänar 3D-fastighetsbildning fogas som en ny typ av servitut till förteckningen. En byggnads interna fastighetsdelning kan föranleda behov av att stifta nya typer av servitut som kan garantera de fastigheter som finns i byggnaden tillräcklig säkerhet när det gäller fastighetens användningsmöjligheter också vid ägarbyten och när ingen överenskommelse nås. 
164 a §.Samreglering som är nödvändig på grund av en tredimensionell fastighet. Det föreslås att en tredimensionell fastighet fogas till lagen som en ny grund för samreglering. Samreglering föreslås vara möjlig, om en sådan är nödvändig på grund av en tredimensionell fastighet. Liksom vid genomförande av en detaljplan kan myndigheten på basis av denna bestämmelse införa samreglering på grundval av ett avtal mellan samtliga parter eller på ansökan av endast en part. Det kräv inte nödvändigtvis att alla de som deltar i samregleringen ger sitt samtycke, även om det på basis av erfarenheterna av samregleringen enligt 164 § i vanliga fall verkar vara så att ansökan baserar sig på enighet och innehåller ett samtycke från samtliga parter.  
Ett behov av samreglering kan uppkomma när tredimensionella fastigheter exempelvis går in i varandra eller ligger ovanpå varandra eller parallellt i samma byggnad. En sådan fastighet kan vanligen inte användas om inte bebyggandet, den dagliga användningen och det framtida underhållet åtminstone delvis kan skötas genom att man utnyttjar konstruktioner och utrymmen för andra fastigheter som finns i samma byggnad, antingen självständigt eller tillsammans med andra fastighetsägare. De fastigheter som nyttjar en samreglering kan vara två- eller tredimensionellt avgränsade, förutsatt att en 3D-fastighet som finns inom området ligger till grund för behovet av reglering. 
Om 3D-fastigheter har beaktats redan i detaljplanen, kan genomförandet av detaljplanen vara ett alternativ som grund för regleringen. Eftersom beslut om användning av 3D-fastigheter kan fattas utan något uttryckligt omnämnande i detaljplanen, är denna grund dock inte tillräcklig för att täcka alla situationer där samreglering behövs. 
Vid samregleringen iakttas i övrigt vad som föreskrivs i 164 § 2–4 mom. I 2 mom. i den paragrafen finns bestämmelser om regleringsplanen, i 3 mom. föreskrivs det om förutsättningarna för ett förordnande om samreglering och om de ersättningar som ansluter sig till regleringen, och i 4 mom. föreskrivs det om registreringen av rättigheter som stiftats genom samreglering. Dessa bestämmelser föreslås i fortsättningen bli tillämpade även på sådan samreglering som tillämpas på grund av en tredimensionell fastighet. 
164 b §.Ändring och upphävande av samreglering. Det föreslås att en ny paragraf som gäller ändring och upphävande av samreglering fogas till lagen. Enligt förslaget ska kommunens byggnadstillsynsmyndighet besluta om saken, dvs. samma aktör som svarar för stiftande av samreglering och även för stiftande, ändring och upphävande av byggnadsservitut. 
I det föreslagna 1 mom. föreskrivs det om grunderna för ändring och upphävande av samreglering. Grunderna är desamma som de grunder för ändring och upphävande av servitut som gäller enligt 160 §. Lagtekniskt genomförs detta genom en hänvisning till 160 §. 
Enligt 160 § 1 mom. kan ändring eller upphävande av ett byggnadsservitut basera sig på ett avtal mellan dem som saken gäller. Byggnadstillsynsmyndigheten kontrollerar då förutom att det finns ett avtal också att åtgärden inte försvårar ett ändamålsenligt byggande, en ändamålsenlig användning eller skötsel av fastigheten eller genomförandet av detaljplanen. Enligt 2 mom. i samma paragraf är det möjligt att ändra eller upphäva ett servitut också utan samtycke av rättsinnehavaren, om servitutet har blivit onödigt, den olägenhet som servitutet orsakar har blivit oskälig och ändringen inte orsakar rättsinnehavaren betydande olägenheter eller om servitutet betydligt försvårar genomförandet av detaljplanen. De grunder enligt 160 § som beskrivs ovan är på så sätt generella till sin karaktär att de lämpar sig väl även när det gäller att ändra eller upphäva samregleringar. 
Den nya 164 b § föreslås gälla alla samregleringar enligt markanvändnings- och bygglagen, dvs. i 103 k § avsedd samreglering av dagvattenhantering, i 164 § avsedd samreglering till följd av genomförandet av detaljplanen och i 164 a § avsedd samreglering som är nödvändig på grund av tredimensionell fastighetsbildning. 
En hänvisning till 164 a och 164 b § bör fogas till 81 § i markanvändnings- och byggförordningen. I den paragrafen föreskrivs det om införande av byggnadsservitut och samreglering i fastighetsregistret. En bestämmelse om det bemyndigande att utfärda förordning som behövs för detta föreslås i 164 b § 2 mom. 
194 §.Besvärsrätt i fråga om separat tomtindelning. En sådan ändring av besvärsrätten som föranleds av tredimensionell fastighetsbildning föreslås bli fogad till paragrafen. Besvärsrätt i fråga om godkännande av en separat tomtindelning har enligt gällande lydelse i paragrafen 1) ägaren och innehavaren av en fastighet som är belägen i samma kvarter och som gränsar till det område som ska delas genom tomtindelningen, 2) ägaren och innehavaren av en fastighet som är belägen mittemot och vars bebyggande eller användning i annat syfte beslutet i väsentlig mån kan påverka, samt 3) kommunen. 
Det föreslås att 2 punkten ändras så att den gäller även en annan ägare och innehavare än ägaren och innehavaren av en fastighet som är belägen mittemot, om beslutet i väsentlig mån kan påverka den ägarens eller innehavarens intressen och rättigheter. Ändringen innebär att besvärsrätten kan gälla bland annat för sådana ägare vars fastighet finns i samma byggnad som den fastighet som omfattas av tomtindelningen samt vars ställning påverkas väsentligt av beslutet. Likaså kan besvärsrätten gälla för de ägare vars fastigheter ännu inte har bebyggts när byggandet i sinom tid genomförs som flera fastighetsägares projekt i byggnaden. En sådan situation framgår vanligen av detaljplanen eller tomtindelningen. 
Fastighetsägaren ska ha besvärsrätt även om fastigheten inte gränsar till området för en tomtindelning, om beslutet i väsentlig mån kan påverka fastighetens bebyggande eller användning i annat syfte. Syftet med ändringen av bestämmelsen är att utvidga besvärsrätten till de nya situationer som kan uppstå vid 3D-fastighetsbildning och där det inte finns något egentligt grannskap men däremot ett motiverat behov av egendomsskydd. Bestämmelsens ordalydelse omfattar dock inte enbart 3D-situationer. Besvärsrätt har alla de fastighetsägare och fastighetsinnehavare vars byggande eller användning av fastigheterna kan påverkas väsentligt av beslutet. I den avgränsas användningsområdet således inte endast till 3D-situationer såsom i de nya bestämmelserna om hörande i 79 § och 133 §. En mera allmän grund för väsentlig påverkan har valts för att bestämmelsen ska vara enhetlig med vissa lagbestämmelser om besvärsrätten och med tanke på den i grundlagen och förvaltningsprocesslagen föreskrivna rätt som den berörda har att söka ändring i beslutet, om beslutet har en omedelbar verkan på personens rättigheter, skyldigheter eller intressen. Både i 192 § om bygglov och i 193 § om beslut i fråga om undantagsbeslut och avgöranden som gäller planeringsbehov innehåller en motsvarande besvärsgrund i anknytning till väsentlig påverkan. 
1.4
Lagen om parcellers ombildande till självständiga lägenheter
1 §. Enligt den föreslagna paragrafen upphävs lagen av den 31 december 1926 om parcellers ombildande till självständiga lägenheter (340/1926), som trädde i kraft den 1 januari 1927. 
Parcellsystemet infördes genom 1864 års förordning som gällde delning av jord och upphävdes vid utgången av 1926 då den förordning angående skiftesväsendet (82/1916) som hade utfärdats den 26 oktober 1916 och trätt i kraft 1917 upphävdes genom den lag som nu föreslås bli upphävd. I hela landet bildades ungefär 75 000 parceller under den tid systemet gällde, dvs. under tiden den 19 december 1864–31 december 1926. Parcellerna var jordrättsligt och med avseende på jordskatterna osjälvständiga, ofta små lägenheter som det på den tiden var lagstiftningsmässigt mycket friare att bilda än egentliga lägenheter. Parcellerna var för det mesta avsedda som bostäder och som villor. När jordskatten för stomlägenheten förblev oförändrad trots avskiljandet av en parcell skulle parcellägaren betala sin andel av stomlägenhetens jordskatt som gåvoskatt till stomlägenhetens ägare. När jordskatten upphävdes genom lag 295/1924 blev också frågan om att avskaffa parcellsystemet aktuell som ett led i totalreformen av beskattningssystemet. 
Åtgärderna för att ombilda parceller som bildades under parcellsystemets giltighetstid till självständiga lägenheter har slutförts genom lagen om parcellers ombildande till självständiga lägenheter, och därför föreslås lagen bli upphävd. 
2 §. I paragrafen föreskrivs det om ikraftträdandet av lagen. Lagen föreslås träda i kraft år 20 . 
2
Närmare bestämmelser och föreskrifter
Enligt den föreslagna nya 164 b § i markanvändnings- och bygglagen får bestämmelser om registrering av ändring och upphävande av samreglering utfärdas genom förordning av statsrådet. 
3
Ikraftträdande
De föreslagna lagarna avses träda i kraft den 20 . 
4
Förhållande till grundlagen samt lagstiftningsordning
4.1
Egendomsskydd
Propositionen syftar till att möjliggöra tredimensionell fastighetsindelning genom att för detaljplaneområden ta i bruk sådan bindande tomtindelning enligt planbestämmelserna som är lämplig för detta. 
I samband med lagreformen står i synnerhet bestämmelserna om egendomsskydd i 15 § i grundlagen i centrum, där det i 1 mom. föreskrivs att vars och ens egendom ska vara tryggad, vilket betyder att det är fastighetsägarens egendom som ska skyddas. Det som är viktigt i den föreslagna lagstiftningen med tanke på egendomsskyddet är de bestämmelser om markanvändning och byggande som ger ägaren rätt att ingripa i sina befogenheter att nyttja sin egen egendom. 
Vidare gäller att det ingripande i ägarens befogenhet som detaljplanläggningen och fastighetsbildningen innebär inte i praktiken förändras från nuläget genom att lagstiftningen möjliggör tredimensionell fastighetsindelning. Reformen förändrar det sätt på vilket fastigheter bildas, både fysiskt och begreppsmässigt. Den förändrar dock inte de förutsättningar som gäller vid överlåtelse av befintliga fastigheters egendom eller vid begränsning av fastighetens nyttjande. Vad gäller äganderätten innehåller denna proposition inga förslag till ändringar i äganderättens uppkomstmekanismer, skydd, överlåtelse eller begränsningsförutsättningar. 
Utgångspunkten för genomförandet av projekt baserade på tredimensionell fastighetsindelning ska enligt förslaget i första hand vara ett sådant ägande av basfastigheten, dvs. en 2D-fastighet, vars utsträckning ovanför och under jord motsvarar den nuvarande uppfattning om utsträckningen för äganderätten till jord- och vattenområden som utformats inom rättspraxis och rättsvetenskap. Ägaren till en tredimensionell fastighet kommer alltid med stöd av den lagenliga grunden att härleda sin rätt från basfastighetens ägare, som är överlåtare vid överlåtelse av fastigheten och äger den basfastighet som omfattas av en eventuell styckningsförrättning eller klyvningsförrättning. En tredimensionell fastighet föreslås vara entydig och stängd vad gäller volym och gränser, varvid eventuella rättigheter runtom den tredimensionella fastigheten alltjämt berättigar basfastighetens ägare, om inte ägaren har vidtagit andra rättsliga åtgärder som gäller dessa rättigheter. För att möjliggöra 3D-fastighetsbildning föreslås inga sådana nya rättsliga grunder i lagstiftningen som skulle begränsa själva egendomsskyddet för basfastighetens ägare eller som skulle möjliggöra en sådan begränsning. 
Enligt grundlagens 15 § 2 mom. ska det bestämmas genom lag om expropriation av egendom för allmänt behov mot full ersättning. Fastställande av en tredimensionell detaljplan innebär inte direkt att exempelvis äganderätten till ett underjordiskt utrymme överförs från basfastighetens ägare genom att detaljplanen vinner laga kraft. Så som generellt inom ett detaljplaneområde behövs det för överföring av äganderätten vid genomförande av fastighetsindelning antingen en frivillig överlåtelse av den rätte ägaren (vanligen den som har lagfart) eller inlösning på lagliga grunder av en sådan ägare mot full ersättning eller något annat sådant förfarande för överföring av äganderätten som redan nu baserar sig på markanvändnings- och bygglagen, såsom när det gäller gatuområden (se 94 § i markanvändnings- och bygglagen). Även den detaljplan som fastställs för att gälla ovanför eller under den befintliga detaljplanen ska enligt förslaget betraktas som jämförbar med den första detaljplanen. I lagstiftningen föreslås inga nya grunder för inlösning när tredimensionella fastigheter ska bildas, och således förändras inte det konstitutionella nuläget i fråga om grunderna för inlösning. 
Markanvändnings- och bygglagen ändras enligt förslaget så att det föreskrivs att ett byggnadsservitut som är nödvändigt på grund av tredimensionell fastighetsbildning får stiftas som ett tvångsservitut utan överenskommelse mellan dem som saken gäller (158 a §). Även ett förordnande om samreglering som är nödvändig på grund av tredimensionell fastighetsbildning ska få utfärdas utan samtycke av ägaren till den fastighet vars användning förordnandet belastar (164 a §). Bestämmelserna begränsar grannfastighetsägarnas rätt att använda sin fastighet men behövs för att tredimensionella fastigheter i alla lägen ska kunna användas på ett sätt som är ekonomiskt förnuftigt även i övrigt. 
I och med tredimensionell fastighetsbildning kan det uppkomma fastigheter vars användning helt eller delvis baserar sig på rätt till färdsel genom en annan fastighet och på andra lösningar som belastar användningen av en annan fastighet. Sådana situationer kan till exempel uppstå då man bildar självständiga fastigheter i de översta våningarna i en byggnad med flera våningar. I allmänhet kan man i sådana situationer avtala om servituten och samregleringarna, och därför blir det i praktiken aktuellt att överväga tvångsservitut eller tvångsreglering endast om man inte kan nå en överenskommelse. De ovannämnda rättigheterna förutsätter inte i praktiken inlösning av egendomen, utan det handlar om att begränsa användningen av egendomen. Detta ska bedömas via de allmänna förutsättningar för begränsning av grundläggande fri- och rättigheter som har utvecklats i grundlagsutskottets tolkningspraxis. 
Enligt den gällande lagstiftningen (159 § i markanvändnings- och bygglagen) kan ett tvångsservitut stiftas, om detaljplanen kräver det och om servitutet är nödvändigt för innehavaren av servitutsrätten. Även samreglering (164 § i markanvändnings- och bygglagen) har i gällande lag kopplats till detaljplanen så att ett förordnande om samreglering kan utfärdas om genomförandet av detaljplanen kräver det och om samregleringen på ett bestående sätt främjar användningen av flera fastigheter. Servitut och samreglering kan tillämpas endast om åtgärden är skälig för de fastigheter som belastas. Bortsett från detaljplanegrunden föreslås samma förutsättningar gälla för de föreslagna byggnadsservitut och samregleringar som är nödvändiga på grund av tredimensionell fastighetsbildning. Då det enligt de föreslagna bestämmelserna är de gällande bestämmelserna i markanvändnings- och bygglagen som ska tillämpas på servitut och samreglering som behövs vid tredimensionell fastighetsbildning, kan man konstatera att man har föreskrivit på lagnivå om grunderna för begränsningen av grundläggande fri- och rättigheter i tillräcklig grad med avseende på exakthet och noggrann avgränsning. 
Servituten eller samregleringarna ska vara nödvändiga för innehavarna av rätten. I praktiken är det servitut och den samreglering som stiftas vid tredimensionell fastighetsbildning ofta en förutsättning för att över huvud taget kunna använda fastigheten på ett förnuftigt sätt. De intressen som ligger bakom servituten består således i att det blir möjligt att använda marken och verkställa planläggningen och fastighetsindelningen samt att den fastighetsägare som innehar rätten har en möjlighet att nyttja sin egendom. Med beaktande av den höga tröskeln för tillämpningen och de ovannämnda bakomliggande intressena kan begränsningarna anses vara proportionella i förhållande till målen och det rättsgoda som ska skyddas. 
Dessutom bör det noteras att ett servitut får stiftas endast om det inte medför betydande olägenhet för den belastade fastigheten. Motsvarande samreglering villkoras av att den på ett bestående sätt främjar användningen av de berättigade fastigheterna och inte orsakar någon fastighet oskälig belastning. I fråga om både servitut och samreglering föreslås det att motsvarande begränsningar gällande orsakande av oskälig belastning, som skyddar den nuvarande ställningen hos ägaren och innehavaren av den belastade fastigheten, således även ska gälla de rättigheter som stiftats med anledning av tredimensionella fastigheter. De begränsningar av användningen av egendomen som då tillämpas gäller därmed inte äganderättens kärnområde. 
På ovannämnda grunder bedöms den lagstiftning som möjliggör tredimensionell fastighetsbildning inverka på fastighetsägarnas skydd enligt 15 § i grundlagen. De möjligheter som man vid gällande fastighetsbildning har att begränsa fastighetsägarens egendomsskydd kvarstår i princip oförändrade, och i detta sammanhang föreslås det inga ändringar av dem. Av ovannämnda skäl är de föreslagna bestämmelserna nödvändiga för att möjliggöra tredimensionell fastighetsbildning, och med tanke på tryggandet av egendomsskyddet enligt 15 § i grundlagen är de även godtagbara. 
4.2
Ansvar för miljön
Enligt 20 § i grundlagen bär var och en ansvar för naturen och dess mångfald samt för miljön och kulturarvet. Bestämmelsen får sitt närmare innehåll genom den materiella lagstiftningen. Enligt 2 mom. ska det allmänna verka för att alla tillförsäkras en sund miljö och att var och en har möjlighet att påverka beslut i frågor som gäller den egna livsmiljön. 
Detaljplanläggning och dess planbestämmelser påverkar den fysiska miljön. De ovannämnda krav i grundlagen som gäller planläggning ingår i de gällande bestämmelserna i markanvändnings- och bygglagen. Enligt markanvändnings- och bygglagen (se 54 §) ska vid utveckling av samhället hänsyn tas till en sparsam användning av naturresurserna och till att detaljplanläggningen orsakar miljön så ringa olägenheter som möjligt. Vid detaljplanering som gäller ett helt nytt område och vid betydande ändringsprojekt som gäller ett befintligt samhälle ska konsekvenserna för miljön bedömas och behövliga skyddsåtgärder vidtas. Miljöaspekter ska beaktas också när detaljplanen genomförs. 
Kommunen i egenskap av detaljplanläggningsansvarige ska i enlighet med kraven i bestämmelserna ovan bära ansvar för miljön i samband med planläggningen. De ändringar som nu föreslås förändrar inte regleringen om ansvaret för miljön, och regleringen vid tredimensionell planläggning ska till fullo motsvara den reglering som gäller vid sedvanlig planläggning. Med tanke på miljöansvaret förändrar de föreslagna bestämmelserna således inte det konstitutionella nuläget i fråga om lagstiftningen om markanvändning och byggande. 
4.3
Rättsskydd
Enligt 21 § i grundlagen har var och en rätt att på behörigt sätt och utan ogrundat dröjsmål få sin sak behandlad av en domstol eller någon annan myndighet som är behörig enligt lag samt att få ett beslut som gäller hans eller hennes rättigheter och skyldigheter behandlat vid domstol eller något annat oavhängigt rättskipningsorgan. Enligt 2 mom. ska offentligheten vid handläggningen, rätten att bli hörd, rätten att få motiverade beslut och rätten att söka ändring samt andra garantier för en rättvis rättegång och god förvaltning tryggas genom lag. 
Den detaljplan som ligger som grund för en tredimensionell fastighetsindelning samt den bindande tomtindelning som genomförs redan i samband med detaljplanläggningen ska vara föremål för en behandlingsprocess som motsvarar det nuvarande detaljplaneförfarandet. Även garantierna för det rättsskydd som gäller detaljplanläggningen och fastighetsbildningen ska i praktiken motsvara de garantier som tillämpas vid sedvanlig tvådimensionell markanvändning. Det föreslås att rättigheterna att bli hörd och att söka ändring i samband med tomtindelning och bygglovsförfarande kompletteras så att fastighetsägare tillförsäkras rätt att bli hörda och att söka ändring när användningen av deras fastighet i väsentlig mån kan påverkas av ett beslut. I gällande lag har dessa rättigheter delvis begränsats genom formella avgränsningar gentemot direkta gränsgrannar och fastigheter mittemot. En sådan avgränsning garanterar inte ett tillräckligt rättsskydd i de situationer med tredimensionell fastighetsbildning där fastigheterna ligger i samma kvarter utan att direkt vara varandras gränsgrannar. I dessa fall kan en fastighets användning vara starkt beroende av användningen till exempel av en annan fastighet i samma byggnad och av de samregleringar och servitut som har stiftats för att hantera situationen. Om en ändring av tomtindelningen eller en åtgärd som kräver bygglov i väsentlig mån påverkar användningen av en annan fastighet i samma kvarter ska innehavaren av denna, i egenskap av den som saken gäller i sak, ges rätt att bli hörd och rätt att söka ändring i beslutet. Ibland kan detta behov hänföra sig även till en obebyggd fastighet, om det av detaljplanen framgår att fastigheterna sannolikt kommer att förläggas till samma byggnad. På basis av detta föreslås kompletteringar i markanvändnings- och bygglagens 79 § om separat tomtindelning, 133 § om hörande i bygglovsärenden och 194 § om besvärsrätt i fråga om separat tomtindelning. 
I framtiden ska det enligt förslaget vara möjligt att genom bindande tomtindelning ta ställning till tredimensionell fastighetsindelning vid planläggning av vissa avgränsade detaljplaneområden. Tomtindelningen kan också fastställas genom en separat process. Varje fastighetsägare och kommuninvånare har rätt att göra en anmärkning under planens beredningsskede och rätt att förvaltningsprocessvägen anföra kommunalbesvär över detaljplanebeslutet. När det gäller separat bindande tomtindelning blir den som saken egentligen gäller hörd under utarbetningsprocessen och har rätt att förvaltningsprocessvägen överklaga genom förvaltningsbesvär. Behörighetsvillkoret enligt 37 § 3 mom. i markanvändnings- och byggförordningen gäller för den som utarbetar en separat tomtindelning, vilket bidrar till ett ökat rättsskydd för dem som har del i saken. 
Vid en fastighetsförrättning som gäller bildande av en tredimensionell fastighet kan sakägarna utgöras av fastighetens ägare och övriga vars intresse eller rätt förrättningen gäller. Förrättningsbesluten gäller enligt förslaget bl.a. gränsernas sträckning, fastighetens övriga utsträckning och ibland även inlösningsersättningar. Den sakägare som är missnöjd med de beslut som förrättningsingenjören, som agerar med tjänstemannafullmakt, har fattat vid fastighetsförrättningen får överklaga hos jorddomstolen och, efter att ha fått besvärstillstånd, hos högsta domstolen. 
Med stöd av vad som anförts ovan anser regeringen att lagförslagen kan behandlas i vanlig lagstiftningsordning. 
Med stöd av vad som anförts ovan föreläggs riksdagen följande lagförslag: 
Lagförslag
1. 
Lag 
om ändring av fastighetsbildningslagen 
I enlighet med riksdagens beslut 
ändras i fastighetsbildningslagen (554/1995) 2, 20, 25, 85 och 154 §, av dem 2 § sådan den lyder delvis ändrad i lagarna 322/1999, 914/2011 och 1134/2013, 20 § sådan den lyder i lagarna 322/1999 och 914/2011, 25 § sådan den lyder delvis ändrad i lag 1188/1996 samt 154 § sådan den lyder delvis ändrad i lagarna 1159/2005 och 914/2011, som följer: 
2 § 
I denna lag avses med 
1) fastighet en sådan självständig enhet för jordäganderätt eller annan enhet som med stöd av fastighetsregisterlagen (392/1985) ska införas som fastighet i fastighetsregistret, och med annan registerenhet avses en annan fristående enhet som med stöd av den lagen ska införas i fastighetsregistret; en fastighet inbegriper det område som hör till den, andelar i samfällda områden och i gemensamma särskilda förmåner samt de servitutsrättigheter och enskilda särskilda förmåner som hör till fastigheten (fastighetens utsträckning), 
2) samfällt område ett område som hör till två eller flera fastigheter gemensamt enligt andelar som bestäms på vissa grunder, 
3) tomt en fastighet som bildats enligt den bindande tomtindelningen och införts som tomt i fastighetsregistret, 
4) allmänt område en fastighet i kommunens ägo som bildats av ett område som i detaljplanen avsatts till gatuområde, torg eller öppen plats, rekreationsområde, trafikområde, område för fritid och turism, skyddsområde, faroområde, specialområde eller vattenområde, eller av en del av ett sådant område, och som införts som allmänt område i fastighetsregistret, 
5) registerby en helhet som bildas av de registerenheter som i jordregistret hade införts i samma by, 
6) jordrättslig by en bolby som funnits före storskiftet, en därmed jämförbar grupp av hemman, ett hemman som varit enstaka, eller en annan motsvarande äganderättsenhet som bör anses vara ursprunglig och som hänför sig till ett jordområde som inte delats genom storskifte, samt 
7) vattenrättslig by en bolby som funnits före storskiftet, en därmed jämförbar grupp av hemman, ett hemman som varit enstaka, donationsjord som inrättats före storskiftet, överloppsjord som avskilts åt staten vid storskiftet, ett nytt hemman som grundats på överloppsjord efter storskiftet, statens skogsmark som lämnats utanför storskiftet eller en annan motsvarande enhet för äganderätt till ett vattenområde när enheten ska anses vara ursprunglig och äganderätten till enheten inte har delats. 
20 § 
På en registerenhet kan ett område med bestämda gränser eller en helhet med bestämd utsträckning och bestämt läge både horisontellt och vertikalt (outbrutet område) bildas till en särskild fastighet eller överföras till en förefintlig fastighet genom styckning. En tomt som följer den bindande tomtindelningen bildas genom styckning eller någon annan fastighetsbildningsförrättning. Vid bildandet av en tomt är det genom beslut av förrättningsmännen möjligt att i ringa grad avvika från tomtindelningen enligt vad som närmare föreskrivs genom förordning. 
Den fastighet som bildas genom styckning kan omfatta flera outbrutna områden antingen från samma fastighet eller flera fastigheter eller från ett samfällt område (samstyckning). Den tomt eller det allmänna område som bildas genom styckning kan även omfatta hela fastigheter. 
Ett samfällt område som överlåtits bildas till en fastighet eller överförs till en förefintlig fastighet genom styckning. Av ett samfällt strömfall eller av en del därav kan genom styckning bildas en strömfallslägenhet
25 § 
På ett samfällt område får styckning förrättas, om inga inteckningar belastar delägarfastigheterna eller om bara gemensamma inteckningar till samma belopp och med samma företrädesrätt belastar dem eller om bara en delägarfastighet utöver av dessa inteckningar belastas av inteckningar med sämre företrädesrätt än de gemensamma inteckningarna. 
På ett samfällt område får styckning förrättas också när styckningsfastigheten befrias från ansvar för inteckningarna i delägarfastigheterna antingen helt eller så att den belastas endast av sådana inteckningar som avses i 1 mom. 
Styckning av en samfälld skog som sålts enligt 33 § 1 eller 2 mom. i lagen om samfällda skogar (109/2003) eller av ett område som har överlåtits från en samfälld skog får förrättas trots vad som föreskrivs i 1 och 2 mom. 
85 § 
För skiftesdelägare som avtalar om detta, får av sådana ägor som tillfaller dem och är lämpliga för skogsbruk bildas en samfälld skog som avses i lagen om samfällda skogar, med iakttagande i tillämpliga delar av 10 kap. 
154 § 
Till förmån för en fastighet kan på en annan registerenhets område som ständigt servitut stiftas rätt 
1) att ta hushållsvatten, 
2) att leda hushållsvatten samt att förlägga och använda en vattenledning för hushållsvatten och tillhörande anordningar och konstruktioner, 
3) att avleda vatten för torrläggning av mark, 
4) att förlägga och använda en avloppsledning och andra till avledande och hantering av avloppsvatten hörande anordningar och konstruktioner, 
5) att förlägga och använda en telefon-, el-, gas- och värmeledning eller annan dylik ledning samt tillhörande anordningar och konstruktioner, 
6) att använda ett område som behövs för fordons- eller båtplats, brygga, badplats, lagring av trävirke eller lastplats samt, på detaljplaneområde, att använda ett område som behövs för en gemensam gårdsplan, 
7) att använda ett markområde som behövs för fiske, 
8) att ta sten, grus, sand, lera, torv eller andra med dessa jämförbara marksubstanser, 
9) att förlägga och använda konstruktioner som behövs för befolkningsskyddet, 
10) att förlägga och använda en plats för avfallsinsamling eller en för fastigheterna gemensam värmecentral, samt 
11) till ett område som behövs för vägförbindelse inom ett detaljplaneområde; området för vägförbindelsen kan även bestämmas tredimensionellt. 
Om det på grund av en emotsedd förändring i förhållandena eller av andra särskilda skäl inte ska anses vara ändamålsenligt att stifta en rätt som avses i 1 mom. i form av ständigt servitut, kan rätten stiftas i form av tidsbestämt servitut. Vid förrättningen ska en tidpunkt bestämmas fram till vilken det tidsbestämda servitutet gäller. Vid behov kan vid förrättningen även bestämmas en händelse som föranleder att ett tidsbestämt servitut upphör före utgången av den utsatta tiden. 
Bestämmelser om byggnadsservitut finns i 158 § i markanvändnings- och bygglagen.  
Denna lag träder i kraft den 20 . 
2. 
Lag 
om ändring av 2 § i fastighetsregisterlagen 
I enlighet med riksdagens beslut 
ändras i fastighetsregisterlagen (392/1985) 2 §, sådan den lyder i lagarna 559/1995, 274/1998, 448/2000 och 375/2016, som följer: 
2 § 
I fastighetsregistret införs som fastigheter 
1) lägenheter, 
2) tomter, 
3) allmänna områden, 
4) statens skogsmarker, 
5) skyddsområden som i enlighet med naturvårdslagen (1096/1996) eller tidigare gällande lagstiftning har inrättats på områden som tillhör staten (skyddsområde), 
6) områden som har avskilts genom inlösning (inlösningsenhet), 
7) områden som har avskilts för allmänna behov, 
8) fristående tillandningar, samt 
9) allmänna vattenområden. 
Av de fastigheter som avses i 1 mom. kan tomter, allmänna områden och inlösningsenheter vara i sin helhet avgränsade både horisontellt och vertikalt (tredimensionella fastigheter). Tredimensionella fastigheter införs i registret, om de finns inom ett detaljplaneområde och om inte något annat följer av innehållet i detaljplanen. För att en tredimensionell tomt ska kunna införas i registret krävs det dessutom att den ingår i en bindande tomtindelning. 
Som andra registerenheter införs i fastighetsregistret samfällda områden samt biområden som enligt lagen om allmänna vägar (243/1954) och 58 § 2 mom. i landsvägslagen (503/2005) besitts med vägrätt. 
Denna lag träder i kraft den 20 . 
3. 
Lag 
om ändring av markanvändnings- och bygglagen 
I enlighet med riksdagens beslut 
ändras i markanvändnings- och bygglagen (132/1999) 78 och 79 §, 128 § 1 mom. 4 punkten, 133 och 194 §, av dem 79 § sådan den lyder delvis ändrad i lag 476/2004, 128 § 1 mom. 4 punkten sådan den lyder ändrad i lag 230/2017 samt 133 § sådan den lyder delvis ändrad i lag 1589/2009, och  
fogas till lagen nya 81 a, 158 a, 164 a och 164 b § som följer: 
78 § 
Tomtindelning 
Ett område som ingår i ett byggnadskvarter indelas i detaljplanen i tomter, om det behövs för att reglera markanvändningen (tomtindelning). Tomtindelningen kan vara bindande eller riktgivande. Tomtindelningen ska vara bindande när områdets centrala läge, kvarterets exploateringsgrad eller fastighetssystemets klarhet kräver det. Tomtindelningen anges på detaljplanekartan och dess bindande karaktär anges i detaljplanen. 
Av ett byggnadskvarter kan det bildas en eller flera tomter. Tomtindelning kan också utarbetas för en del av kvarteret, om det inte hindrar eller försvårar en lämplig tomtindelning i kvarterets övriga delar. Tomtindelningen kan också utarbetas så att den är bindande för en del av planområdet eller kvarteret. Den bindande tomtindelningen kan vara helt eller delvis tvådimensionell eller tredimensionell. 
Om så bestäms i detaljplanen eller om en bindande tomtindelning behöver utarbetas eller ändras, kan för byggnadskvarteret eller en del av det utarbetas en separat tomtindelning, som alltid är bindande. 
Tomtindelningen ska vara ändamålsenlig och i den ska i mån av möjlighet markägandeförhållandena beaktas. 
79 § 
Utarbetande av separat tomtindelning 
Detaljplanen tjänar till ledning när en separat tomtindelning utarbetas. Då tomtindelningen utarbetas kan den i siffror i planen angivna totala byggrätten delas upp på de tomter som bildas. Över en separat tomtindelning ska en karta utarbetas. 
En separat tomtindelning utarbetas och godkänns av kommunen. När en separat tomtindelning bereds ska ägare och innehavare av området för tomtindelningen och angränsande fastigheter höras, liksom också ägaren och innehavaren till en fastighet mittemot vars bebyggande eller användning på annat sätt beslutet i väsentlig mån kan påverka. 
När en separat tomtindelning görs i ett kvarter med en gällande tredimensionell tomtindelning ska utöver vad som anges i 2 mom. också ägaren och innehavaren till fastigheten ovanför, under eller parallellt med området för tomtindelningen höras, om beslutet i väsentlig mån kan påverka fastighetens bebyggande eller användning i annat syfte. 
Den som utarbetar en separat tomtindelning ska vara behörig för uppdraget. 
Närmare bestämmelser om hörande vid separat tomtindelning, om utarbetande av tomtindelning och om behörigheten hos den som utarbetar en tomtindelning utfärdas genom förordning av statsrådet. 
81 a § 
Undantag från tomtindelningens rättsverkningar när det gäller tredimensionella fastigheter 
Trots vad som föreskrivs i 81 § 1 mom., är det tillåtet att vid behov i ringa mån avvika från tomtindelningen till nackdel för ägaren eller innehavaren av en grannfastighet, om byggandet gäller ett projekt som innefattar en tredimensionell fastighet. En förutsättning är dessutom att ägaren eller innehavaren till grannfastigheten ger sitt samtycke till avvikelsen. Bestämmelser om rätten att avvika från tomtindelningen när en fastighet bildas finns i 20 § i fastighetsbildningslagen. 
Trots vad som föreskrivs i 81 § 2 mom. 2 punkten får bygglov beviljas innan tomten har införts i fastighetsregistret, om byggandet gäller ett projekt som innefattar en tredimensionell fastighet. Byggnaden får dock inte tas i bruk förrän registeranteckningen har gjorts. 
128 § 
Tillstånd för miljöåtgärder 
Sådant jordbyggnadsarbete och sådan trädfällning eller någon annan härmed jämförbar åtgärd som förändrar landskapet får inte vidtas utan tillstånd (åtgärdsbegränsning) 
4) på ett område där byggförbud enligt 53 § för utarbetande av detaljplan gäller eller beträffande vilket så har bestämts för utarbetande av generalplan eller ändring av generalplanen. 
133 § 
Hörande och utlåtanden 
Grannarna ska underrättas om att en ansökan om bygglov anhängiggjorts, om detta inte med beaktande av projektets ringa betydelse eller läge eller planens innehåll är uppenbart onödigt med tanke på grannens intresse. Med granne avses ägaren eller innehavaren av en fastighet eller ett annat område som ligger invid eller mittemot. Samtidigt ska det även på byggplatsen på lämpligt sätt tillkännages att ärendet är anhängigt 
När byggplatsen finns i ett kvarter med en gällande tredimensionell tomtindelning, avses med granne utöver det som anges i 1 mom. även ägaren eller innehavaren av fastigheten ovanför, under eller parallellt i samma kvarter och vars bebyggande eller användning i annat syfte i väsentlig mån kan påverkas av beslutet. 
På byggplatsen ska det vid behov förrättas syn för att utreda hur byggnaden passar in i miljön, bedöma konsekvenserna av byggandet och höra grannarna. Sökanden och grannarna ska underrättas om tidpunkten för synen. 
Om bygglov söks för ett område enligt naturvårdslagen som anges närmare genom förordning av statsrådet och som är av betydelse för naturvården eller för ett område som i landskapsplanen har reserverats som rekreations- eller skyddsområde, ska närings-, trafik- och miljöcentralens utlåtande inhämtas om ansökan. 
Närmare bestämmelser om meddelande om och tillkännagivande av tillståndsansökan samt om framställande av anmärkning utfärdas genom förordning av statsrådet. 
158 a § 
Servitut som behövs på grund av en tredimensionell fastighet 
Ett byggnadsservitut som behövs på grund av en tredimensionell fastighet får med avvikelse från 158 § 1 mom. stiftas utan överenskommelse mellan dem som saken gäller, med iakttagande i övrigt av vad som föreskrivs i 158 §. 
164 a § 
Samreglering som behövs på grund av en tredimensionell fastighet 
Om samreglering för flera fastigheter behövs på grund av en tredimensionell fastighet, kan kommunens byggnadstillsynsmyndighet i samband med byggande eller annars med stöd av ett avtal mellan samtliga fastighetsägare eller på en fastighetsägares initiativ och efter att ha hört de andra ägarna och innehavarna av fastigheterna bestämma att ett kvartersområde eller en del av det eller en lägenhet som ansluter sig till fastigheten ska användas gemensamt. Vid samregleringen iakttas vad som föreskrivs i 164 § 2—4 mom. 
164 b § 
Ändring och upphävande av samreglering 
Kommunens byggnadstillsynsmyndighet beslutar om ändring och upphävande av samreglering med iakttagande av vad som i 160 § föreskrivs om ändring och upphävande av servitut. 
Bestämmelser om registrering av ändring och upphävande av samreglering får utfärdas genom förordning av statsrådet. 
194 § 
Besvärsrätt i fråga om separat tomtindelning 
Besvärsrätt i fråga om godkännande av en separat tomtindelning har 
1) ägaren och innehavaren av en fastighet som är belägen i samma kvarter och som gränsar till det område som ska delas genom tomtindelningen, 
2) andra ägare och innehavare av fastigheter vars bebyggande eller användning i annat syfte beslutet i väsentlig mån kan påverka, och 
3) kommunen. 
Denna lag träder i kraft den 20 . 
4. 
Lag 
om upphävande av lagen om parcellers ombildande till självständiga lägenheter 
I enlighet med riksdagens beslut föreskrivs: 
1 § 
Genom denna lag upphävs lagen om parcellers ombildande till självständiga lägenheter (340/1926). 
2 § 
Denna lag träder i kraft den 20 . 
Helsingfors den 1 februari 2018 
Statsminister
Juha
Sipilä
Jord- och skogsbruksminister
Jari
Leppä
Senast publicerat 1.2.2018 11:16