Regeringens proposition
RP
304
2018 rd
Regeringens proposition till riksdagen med förslag till lagar om ändring av inkomstskattelagen och 3 § i lagen om beskattning av begränsat skattskyldig för inkomst
PROPOSITIONENS HUVUDSAKLIGA INNEHÅLL
I propositionen föreslås ändringar i inkomstskattelagen och lagen om beskattning av begränsat skattskyldig för inkomst. 
Propositionen hänger delvis samman med regeringens proposition till riksdagen med förslag till lag om placeringsfonder och vissa lagar som har samband med den. I den föreslås bland annat att den privaträttsliga regleringen rörande specialplaceringsfonder flyttas till lagen om förvaltare av alternativa investeringsfonder och att delfondsstrukturer tillåts i placeringsfonder. 
Bestämmelserna om placeringsfonder i inkomstskattelagen ska preciseras. Placeringsfonder ska också i fortsättningen betraktas som skattefria samfund, men i inkomstskattelagen ska det föreskrivas närmare om villkoren för skattefriheten. 
Enligt förslaget ska inkomstskattelagen kompletteras med en särskild bestämmelse om skattefrihet för specialplaceringsfonder och villkoren för den. Om en placeringsfond eller specialplaceringsfond består av en eller flera delfonder, ska på delfonderna tillämpas vad som föreskrivs om placeringsfonder eller specialplaceringsfonder. 
Bestämmelserna om skattefrihet för placeringsfonder och specialplaceringsfonder ska också tillämpas på motsvarande avtalsbaserade utländska fonder. 
I lagen om beskattning av begränsat skattskyldig för inkomst ska det enligt förslaget införas bestämmelser om källskattefrihet för utdelning som betalas utländska fonder som motsvarar sådana finska placeringsfonder eller specialplaceringsfonder som är fria från skatt. 
Lagarna avses träda i kraft våren 2019. Lagarna tillämpas första gången vid beskattningen för 2020. 
MOTIVERING
1
Nuläge
1.1
Allmänt
De föreslagna ändringarna i skattelagstiftningen hänger delvis samman med regeringens proposition till riksdagen med förslag till lag om placeringsfonder och vissa lagar som har samband med den, vilken har avgetts till riksdagen den 22 november 2018 (RP 243/2018 rd). 
1.2
Bestämmelser om inkomstbeskattningen av placeringsfonder
Enligt 3 § 4 punkten i inkomstskattelagen (1535/1992) betraktas placeringsfonder som samfund. Enligt 20 § 1 mom. 2 punkten är placeringsfonder likväl befriade från inkomstskatt. Vid placering i fonder är föremålet för beskattningen av inkomsten följaktligen inte fonden utan den som äger en andel i fonden. De vinstandelar som fonden delar ut är för andelsägarna inkomster som beskattas som kapitalinkomster. Vid inlösen av fondandelar tillämpas bestämmelserna om överlåtelsevinst. 
Inkomster som en placeringsfond får från sina placeringsobjekt, såsom räntor, utdelning eller överlåtelsevinster, är skattefria för fonden och omvandlas när de passerar genom fonden till beskattningsbara vinstandelar (avkastningsandelar) eller överlåtelsevinster (tillväxtandelar). Särskilda drag i beskattningen av olika inkomstslag är inte synliga för den slutliga inkomsttagaren det vill säga ägaren av fondandelen. 
Enligt 32 § i inkomstskattelagen är vinstandelar beskattningsbar kapitalinkomst. Kapitalinkomster beskattas enligt en skattesats på 30 procent. Till den del av den skattskyldiges kapitalinkomst överskrider 30 000 euro tillämpas dock en skattesats på 34 procent. Överlåtelsevinst som ägare får vid inlösen av andelar i placeringsfonder är skattepliktig kapitalinkomst på samma sätt som annan kapitalinkomst. När överlåtelsevinsten beräknas dras anskaffningsutgiften och tecknings- och inlösenavgiften av. Från det överlåtelsepris som en skattskyldig som inte är ett samfund, ett öppet bolag eller ett kommanditbolag får likväl alltid 20 procent dras av som anskaffningspresumtion eller 40 procent om säljaren har ägt fondandelarna i över tio år. När ägaren har formen av ett samfund, beskattas vinstandelen och överlåtelsevinsten enligt en samfundsskattesats på 20 procent. 
Begreppet placeringsfond har inte definierats i skattelagstiftningen. I inkomstskattelagen finns inte heller någon hänvisning till definitionen i lagen om placeringsfonder (48/1999). I rätts- och beskattningspraxisen har en placeringsfond i inkomstskattelagen ansetts avse en placeringsfond enligt lagen om placeringsfonder. I praktiken har de ändringar som under årens lopp gjorts i lagen om placeringsfonder inverkat på innehållet i begreppet placeringsfond också i fråga om beskattningen. 
1.3
Källskatteförfarandet
En utländsk fond eller, om den utländska fonden i Finland anses vara en transparent enhet, den som investerat i den utländska fonden betraktas i Finland som begränsat skattskyldig. Den som är begränsat skattskyldig är skyldig att betala skatt i Finland endast på inkomst som den skattskyldige förvärvat här. Överlåtelsevinster för aktier och ränteinkomster är i allmänhet skattefri inkomst för begränsat skattskyldiga i Finland. När en utländsk fond investerar i Finland har Finland beskattningsrätt närmast för dividendinkomster och fastighetsinkomster, såsom hyresinkomster. 
Bestämmelser om det beskattningsförfarande som tillämpas på inkomster som en begränsat skattskyldig har i Finland finns i lagen om beskattning av begränsat skattskyldig för inkomst (627/1978, källskattelagen). Stats- och kommunalskatt för en begränsat skattskyldig uppbärs såsom slutlig skatt genom innehållning vid inkomstens källa (källskatt) eller bestäms i den ordning som gäller enligt lagen om beskattningsförfarande (1558/1995). Enligt 3 § 1 mom. i källskattelagen ska källskatt betalas bland annat på dividend. På fastighetsinkomst tas skatt ut enligt den ordning som anges i lagen om beskattningsförfarande. 
Den som betalar inkomsten, det vill säga bolaget som delar ut vinst, är skyldig att sköta uppbörden av källskatten. Källskatt ska tas ut när en källskattepliktig utdelning betalas ut eller antecknas på konto mottagaren tillgodo. För beskattningen ska den som är begränsat skattskyldig för utbetalaren visa upp en utredning om sitt namn, sin födelsetid och eventuellt personnummer eller organisationsnummer i hemviststaten. Om inkomsttagaren innan betalningen erläggs visar upp en utredning om sin hemvist och om grunderna för att tillämpa ett skatteavtal, kan skatteavtalet tillämpas vid uppbörden av källskatt. Skatteförvaltningen kan på ansökan utfärda ett källskattekort för en begränsat skattskyldig för tillämpning av bestämmelserna om källskatt. 
Har för mycket källskatt tagits ut, kan skatten rättas under betalningsåret endast av den finska betalaren av utdelning eller det kontoförande institut verksamt i Finland och bemyndigat av betalaren som har skött utbetalningen. Om uppbörden inte rättas under utbetalningsåret, kan mottagaren hos Skatteförvaltningen ansöka om att den källskatt som betalats för mycket återbetalas efter betalningsåret. Sedan den 1 januari 2017 har ansökan om återbetalning av källskatt som betalats för mycket kunnat göras inom tre år från utgången av det kalenderår under vilket skatten har tagits ut. Tidigare var motsvarande frist fem år. På källskatt som ska återbetalas betalas ränta med stöd av 11 § 4 mom. i källskattelagen. Bestämmelsen om ränta på återbetalningen har tillämpats sedan 2014, men det har även varit möjligt att ansöka om ränta för återbetalningar som gäller tidigare år inom de frister som angetts för begäran om omprövning. 
Om beskattningen verkställs i den ordning som anges i lagen om beskattningsförfarande, sker det utifrån den deklaration som den skattskyldige, det vill säga inkomsttagaren, lämnat. Den som är begränsat skattskyldig för en fastighetsinkomst är följaktligen skyldig att lämna en skattedeklaration i Finland. 
1.4
Privaträttsliga bestämmelser om placeringsfonder
I lagen om placeringsfonder föreskrivs det om fondplaceringar som uppfyller avtalsrättsliga bestämmelser. Genom den lag om placeringsfonder som trädde i kraft 1999 upphävdes den förra lagen (480/1987) med samma namn. Rådets direktiv 85/611/EEG om samordning av lagar och andra författningar som avser företag för kollektiva investeringar i överlåtbara värdepapper (fondföretag) (fondföretagsdirektivet eller UCITS-direktivet), och senare ändringar i direktivet har genomförts i lagen om placeringsfonder. I lagen om placeringsfonder föreskrivs det förutom om placeringsfonder enligt fondföretagsdirektivet även om specialplaceringsfonder som baserar sig på nationell lagstiftning. Efter att Europaparlamentets och rådets direktiv 2011/61/EU om förvaltare av alternativa investeringsfonder samt om ändring av direktiv 2003/41/EG och 2009/65/EG och förordningarna (EG) nr 1060/2009 och (EU) nr 1095/2010 (AIFM-direktivet) satts i kraft är specialplaceringsfonden numera en av de rättsliga formerna för AIF-fonder. 
Med fondverksamhet avses enligt 2 § 1 punkten i lagen om placeringsfonder anskaffning av medel från allmänheten för kollektiva investeringar och investering av medlen huvudsakligen i finansiella instrument eller i fastigheter och fastighetsvärdepapper eller andra investeringsobjekt samt förvaltning av placeringsfonder och specialplaceringsfonder och marknadsföring av fondandelar. En placeringsfond är inte en självständig juridisk person utan en fristående förmögenhetsmassa som ägs av dem som investerat i fonden tillsammans. En placeringsfonds tillgångar ska uppgå till minst två miljoner euro och den ska ha minst 50 andelsägare. En placeringsfond förvaltas av ett fondbolag i aktiebolagsform. 
Begreppet placeringsfond definieras i 2 § 2 punkten som tillgångar som anskaffats genom fondverksamhet och investerats i enlighet med 11 kap. i lagen och de bestämmelser som har fastställts i Finland samt förpliktelser som följer av dessa tillgångar. I 11 kap. föreskrivs det om placering av en placeringsfonds medel i placeringsobjekt som uppfyller kraven i fondföretagsdirektivet. 
Den som placerat medel i en placeringsfond har rätt till en fondandel. Med fondandel avses i lagen om placeringsfonder ett värdepapper i värdepappersmarknadslagens (746/2012) mening. I fondens stadgar kan det bestämmas att fonden har både avkastnings- och tillväxtandelar. Fondandelarna kan vara indelade i serier som avviker från varandra när det gäller det belopp som fondbolaget debiterar en placeringsfond som ersättning för förvaltningen av denna. På yrkande av fondandelsägare ska fondbolaget på det sätt och vid de tidpunkter som närmare bestäms i placeringsfondens stadgar lösa in andelar i en placeringsfond som bolaget förvaltar. 
Placeringsfondernas investerarkår är stor. Placeringar i placeringsfonder marknadsförs för privatpersoner ofta också som månadssparande, där den månatliga betalningen kan vara väldigt låg (några tiotal euro). I den rapport av arbetsgruppen för utvärdering av skattebehandlingen av olika investeringsformer (Skattebehandlingen av olika investeringsformer –arbetsgruppsrapport, finansministeriets publikationer 14/2018, på finska) som publicerades den 4 maj 2018 bedömdes att fysiska personers genomsnittliga placeringar i placeringsfonder är tre gånger större än deras medianplacering, som ligger nära finländarnas genomsnittliga månadsinkomst, det vill säga omkring 2 500 euro. De placerare som till sin profil är förmögnare har alltså vanligen större placeringar. 
Placeringsfonderna kan delas in enligt placeringsobjekt. Aktiefonder investerar som namnet säger huvudsakligen i aktier. Räntefonder investerar sina medel i värdepapper med ränteavkastning, såsom masslån. Räntefonderna kan ytterligare delas in i fonder med kort, medellång och lång ränta. En penningmarknadsfond är till exempel en typ av korträntefond. Blandfonderna placerar i både aktier och objekt som ger ränteavkastning. Fondandelsfonder, det vill säga fonder av fonder, är fonder som investerar i andra fonder. Andelar i börshandlade fonder, det vill säga ETF:er (exchange traded funds), köps och säljs vanligen på börsen. Indexfonderna är som namnet säger fonder som följer ett index, det vill säga till fonden köps automatiskt aktier som ingår i dess referensindex. 
I lagen om placeringsfonder föreskrivs det också om specialplaceringsfonder med vilka avses tillgångar som anskaffats genom fondverksamhet och investerats i enlighet med specialplaceringsfondens stadgar och 12 kap. i lagen samt förpliktelser som följer av dessa tillgångar. I 3 a § i lagen om placeringsfonder anges vilka bestämmelser om placeringsfonder som också ska tillämpas på specialplaceringsfonder. På specialplaceringsfonderna tillämpas inte den princip om spridning av riskerna som anges i lagen om placeringsfonder. Specialplaceringsfonder som investerar i fastigheter och fastighetsvärdepapper kan avvika även från principen om kontinuerlig emission av fondandelar, regeln om kontinuerlig inlösensskyldighet och reglerna för beräkning av värdet. På ett fondbolag som förvaltar en specialplaceringsfond eller en annan AIF-fond tillämpas lagen om förvaltare av alternativa investeringsfonder (162/2014, AIFM-lagen eller lagen om förvaltare av alternativa investeringsfonder) enligt vad som föreskrivs om detta i 1 kap. 5 § i den lagen. 
En specialplaceringsfond är en sådan AIF-fond som avses i AIFM-direktivet. De AIF-fonder som avses i AIFM-direktivet är i Finland ofta kapitalfonder i kommanditbolagsform, men AIF-fonder kan också ha en annan rättslig form. AIFM-direktivet reglerar i huvudsak förvaltningen av de AIF-fonder som erbjuds professionella placerare och de krav som ställs på förvaltarna. Begreppen professionell och icke-professionell investerare definieras närmare i lagen om investeringstjänster. AIFM-direktivet gör det möjligt att nationellt tillåta marknadsföring av AIF-fonder även till icke-professionella placerare. I Finland har det varit möjligt att marknadsföra AIF-fonder i form av specialplaceringsfonder till icke-professionella kunder redan innan AIFM-direktivet utfärdades. 
I internationella sammanhang särskiljs de olika typerna av fonder ofta genom hänvisningar till antingen fondföretagsdirektivet eller AIFM-direktivet oberoende av vilken juridisk form fonden har. Det att benämningarna placeringsfond och specialplaceringsfond i Finland uttryckligen refererar till fondernas juridiska form har sin grund i lagstiftningens historia. I Finland hänvisas det ofta till exempel till en AIF-fond i form av ett kommanditbolag för att skilja den från specialplaceringsfonder även om båda kan kallas AIF-fonder. Finländare kan även investera i fonder enligt UCITS- eller AIFM-direktivet som är registrerade i utlandet och vars rättsliga strukturer kan vara mycket varierande. 
1.5
Hur lagstiftningen om placeringsfonder har utvecklats
Tillkomst av placeringsfondslagstiftningen 
Den gamla lagen om placeringsfonder, som till stora delar var kopierad från motsvarande svenska lag, trädde i kraft den 1 september 1987. Det ursprungliga målet för beskattningen av placeringsfonder var att investeringsverksamhet via placeringsfonder i beskattningen skulle behandlas så likt direkta aktieplaceringar som möjligt. Enligt förarbetena till lagstiftningen om placeringsfonder skulle fonderna om det inte fanns en särskild lagstiftning bli tvungna att betala inkomstskatt, vilket skulle göra fondsparandet ofördelaktigt i beskattningshänseende jämfört med det direkta aktiesparandet. För att säkerställa placeringsfondernas verksamhetsförutsättningar var det således nödvändigt att förhindra dubbel beskattning. I lagförslaget gick man in för lösningen att helt befria placeringsfonderna från såväl skatt enligt inkomst som skatt enligt tillgångar. Varje placeringsfond är därför ett separat skattefritt samfund. Lösningen motiverades med att den är enkel och klar med hänsyn till skatteuppbörden (RP 9/1987 rd). 
När det föreskrevs om skattefrihet ingick det i lagen om placeringsfonder också en huvudregel om en skyldighet att regelbundet betala avkastning. I motiveringarna till lagen konstaterades följande i fråga om placeringsfondernas skattefrihet och skyldighet att dela ut avkastning: ”Ifall placeringsfonden beskattades för den inkomst som den inte delar ut till fondandelsägarna skulle inkomstskatt eventuellt innebära att skattebördan ökar jämfört med direkt aktiesparande. Då avkastningen av placeringsfondernas inkomstskatt sannolikt i praktiken vore obefintlig eller mycket ringa och då placeringsfondsverksamheten dessutom är underställd myndigheternas noggranna uppsikt är det mera ändamålsenligt att helt befria placeringsfonderna från beskattning. Detta är motiverat förutom för att förenkla beskattningen också därför att enligt lagförslaget ska mera än hälften av placeringsfondens vinst under räkenskapsperioden årligen utdelas till fondandelsägarna, om inte finansministeriet beviljar undantag från detta stadgande. Då en placeringsfond sålunda skulle vara en sparform underställd offentlig övervakning, skulle fonden inte kunna användas såsom ett samfund för undvikande av beskattning, dit man skattefritt samlar flera års vinstmedel. Placeringsfondens vinst blir således utdelad till fondandelsägarna och beskattningen sker efter att fondandelsägaren får lyfta sin vinstandel från fonden. Fondandelsägarna beskattas för den oskiftade vinst som lämnats i fonden för att trygga dess verksamhet på samma sätt som för dylik vinst som lämnats i aktiebolaget, det vill säga i samband med försäljningen av fondandelar” (RP 238/1986 rd, s. 9). 
Viktiga ändringar i lagen om placeringsfonder 
I samband med att avtalet om Europeiska ekonomiska samarbetsområdet (EES-avtalet) sattes i kraft 1994 sattes även Europeiska ekonomiska gemenskapens fondföretagsdirektiv i kraft i Finland. Direktivet, som hör till EES-avtalets regelverk, möjliggjorde marknadsföring i Finland av andelar i ett utländskt fondföretag med säte i Europeiska ekonomiska samarbetsområdet (EES-stat) på grundval av en auktorisation som företaget fått i sin hemviststat oberoende av dess rättsliga struktur. Samtidigt föreskrevs det också att en placeringsfond fick ha tillväxtandelar utan att ansöka om undantagstillstånd hos finansministeriet. Ändringen motiverades med att en uppluckring av regleringen av skyldigheten till vinstutdelning behövdes för att det skulle bli lättare att bilda olika fonder (RP 309/1992 rd, s. 19). 
I lagen om placeringsfonder infördes år 1996 krav på placeringsfonder i fråga om minimikapital och minsta antal andelsägare. Kravet på antalet andelsägare motiverades bland annat med att fondverksamheten per definition handlar om kollektivt investerande av medel som samlats in av en icke begränsad skara placerare och att placeringsfonderna inte ska kunna användas som redskap för att uppnå något annat syftemål. Därför skulle en placeringsfond alltid ha minst 50 andelsägare. Det är ansågs dock inte ändamålsenligt att förhindra att det grundas placeringsfonder vilkas verksamhet bygger på olika placeringsidéer om det kan visas att det enda syftet med verksamheten inte är till exempel att kringgå beskattning. Därför kunde finansinspektionen av särskilda skäl bevilja undantag från minimikravet på 50 andelsägare (RP 59/1996 rd). 
År 1996 utvidgades också möjligheten att använda tillväxtandelar genom att det blev tillåtet att erbjuda både tillväxt- och avkastningsandelar i samma placeringsfond. 
Samma år blev det möjligt att med tillstånd av statsrådet inrätta specialplaceringsfonder. Att inrättandet av specialplaceringsfonder legaliserades motiverades med att det skulle göra det lättare att sköta finansieringen av små och medelstora företag. Följande gång lagstiftningen om specialplaceringsfonder ändrades på ett betydande sätt var år 2007. Då möjliggjordes att antalet andelsägare är under 50 i specialplaceringsfonder som huvudsakligen investerar sina tillgångar i fastigheter och fastighetsvärdepapper. Antalet andelsägare skulle emellertid vara minst tio, medan minimiteckningsbeloppet var en miljon euro. Samtidigt föreskrevs det om fastighetsfonders obligatoriska vinstutdelning (3/4 av vinsten för räkenskapsperioden) som motiverades med att obligatorisk vinstutdelning internationellt är ett allmänt krav för fonder för kollektiva fastighetsinvesteringar. Som en följd av den obligatoriska vinstutdelningen begränsas också effekten av uppskjuten beskattning till högst den del av vinsten för räkenskapsperioden som inte ska utdelas till delägarna (RP 102/2006 rd, s. 33). Bestämmelserna, som trädde i kraft 2007, har lett till att specialplaceringsfonder som investerar i hyresbostäder (bostadsfonder) har inrättats. Dessa är i praktiken specialplaceringsfonder med minst 50 andelsägare. 
I samband med genomförandet av Europaparlamentets och rådets direktiv 2009/65/EG om samordning av lagar och andra författningar som avser företag för kollektiva investeringar i överlåtbara värdepapper (fondföretag) (UCITS IV-direktivet) år 2011 infördes skilda definitioner för begreppen placeringsfond och specialplaceringsfond i lagen om placeringsfonder. Definitionerna i 2 § i lagen preciserades så att placeringsfond avser endast placeringsfonder enligt UCITS-direktivet. Samtidigt ändrades definitionen av fondverksamhet så att den täcker förvaltning av placeringsfonder och specialplaceringsfonder och marknadsföring av fondandelar. 
Även gränsöverskridande fusioner blev möjliga efter det att UCITS IV-direktivet satts i kraft den 1 januari 2012. I förarbetena till lagen bedömdes då att det på grund av gränsöverskridande fusioner framöver eventuellt kommer att uppstå fler sådana situationer där placeringsfonders eller deras andelsägares kontakt till skattemakten i Finland bryts. Finansministeriet skulle därför senare utreda placeringsfondernas och deras andelsägares skattefrågor vid gränsöverskridande fusioner, med beaktande av också EU-lagstiftningen (RP 113/2011 rd, s. 54). 
I samband med att UCITS IV-direktivet sattes i kraft blev det också möjligt att en UCITS-placeringsfond har sin hemvist i en annan EU-stat än hemviststaten för det fondbolag som förvaltar fonden. 
Senare utveckling av lagstiftningen om specialplaceringsfonder 
När AIFM-direktivet införlivades 2014, ändrades det minsta antalet andelsägare i specialplaceringsfonder igen. Genom lagändringen möjliggjordes till och med specialplaceringsfonder för en investerare (single investor fund). Ändringen grundade sig på en reaktion som gällde den europeiska värdepappersmyndighetens (European Securities and Markets Authority, ESMA) riktlinjer för tolkningen av uttrycket antal investerare i AIFM-direktivet (riktlinjer om nyckelbegrepp i direktivet om förvaltare av alternativa investeringsfonder 13 augusti 2013, ESMA/2013/611). Enligt riktlinjerna är det möjligt att inrätta AIF-fonder med en enda investerare. Dessutom möjliggjordes två andra undantag från kravet att antalet andelsägare ska vara minst 50. Ändringarna motiverades bland annat med en avsikt att förbättra konkurrenskraften hos den finländska marknaden för placeringsfonder. Det hänvisades också till att det på EU:s centrala fondmarknader i Luxemburg och Irland hade inrättats fonder som riktade sig till institutionella och professionella investerare. De viktigaste skillnaderna jämfört med fonder som riktar sig till icke-professionella investerare är att andelsägarna är färre, investeringsmöjligheterna mera omfattande, verksamheten mångsidigare och definitionen av spridningskravet liberalare. Vidare kan fonder som riktade sig till institutionella och professionella investerare inrättas snabbt, utan omfattande byråkrati och med lättnader i informationsskyldigheten. Det föreslogs att dessa egenskaper som är typiska för AIF-fonder skulle införas i Finland speciellt i fråga om specialplaceringsfonder som riktar sig till professionella investerare. Enligt förarbetena till lagen var avsikten med de krav som gällde minsta antalet investerare och minimikapital för placeringen att fortfarande förhindra att förmögna personer inrättar specialplaceringsfonder för individuell förvaltning av sina tillgångar. Avsikten var dessutom att skapa ett alternativ till placeringsförsäkringar och utländska investeringar i samband med individuell portföljförvaltning (RP 94/2013 rd, s. 202). 
Samtidigt utsträcktes vinstutdelningskravet (3/4 av vinsten för räkenskapsåret) i lagen om placeringsfonder, som tidigare hade gällt endast specialplaceringsfonder som i huvudsak investerat i fastigheter och fastighetsvärdepapper, till att gälla alla specialplaceringsfonder med färre än 50 andelsägare. Enligt motiveringarna i regeringspropositionen kan sådana specialplaceringsfonder följaktligen inte verka som tillväxtfonder. Det konstateras att en jämn avkastning, som tidigare varit ett drag som kännetecknat sparande, skulle bli möjlig för specialplaceringsfonder som riktar sig till en snäv grupp av placerare. Avsikten med förslaget var också att säkerställa att specialplaceringsfondernas verksamhet fortfarande skulle ha karaktären av kollektiva investeringar och inte möjliggöra individuell portföljförvaltning om placeringen är under två miljoner euro (RP 94/2013 rd, s. 205). 
De krav som anger minsta antalet andelsägare i en placeringsfond eller en specialplaceringsfond och fondens minimikapital kan beskrivas som följer: 
Minimiantal av andelsägare 
Källa: Rapport av arbetsgruppen för utvärdering av skattebehandlingen av olika investeringsformer, finansministeriets publikationer 14/2018, på finska 
Som beskrivits ovan får en placeringsfond enligt lagen om placeringsfonder inte avvika från dessa minimikrav. 
För specialplaceringsfonder finns det däremot fyra olika undantag från det minsta antalet andelsägare. Om man avviker från minimiantalet andelsägare, ska andelsägarna vara professionella investerare eller med sådana jämförbara förmögna fysiska personer. Enligt 2 § 21 punkten i gällande lag om placeringsfonder förstås med professionell investerare en sammanslutning som avses i 1 kap. 23 § 1 mom. 1—4 punkten i lagen om investeringstjänster (747/2012), institutionella investerare som avses i 1 kap. 23 § 1 mom. 5 punkten i den lagen samt andra investerare, om de skriftligen har meddelat ett fondbolag eller ett fondföretag eller dess ombud att de på grund av sin yrkesskicklighet och investeringserfarenhet är professionella investerare och om de uppfyller minst två av följande krav: a) investeraren har på marknaden i fråga gjort i genomsnitt minst tio transaktioner av betydande storlek per kvartal under de närmast föregående fyra kvartalen, b) värdet av investerarens placeringstillgångar överstiger 500 000 euro, c) investeraren arbetar eller har arbetat professionellt inom finanssektorn minst ett år i uppgifter som kräver kunskap om de planerade transaktionerna. Med en förmögen privatperson som kan jämställas med professionella placerare avses placerare enligt Europaparlamentets och rådets förordningar om europeiska riskkapitalfonder och om europeiska fonder för socialt företagande (high net worth individuals). 
En specialplaceringsfond som huvudsakligen investerar i fastigheter eller fastighetsvärdepapper behöver bara ha tio andelsägare, om samtliga andelsägare enligt reglerna för fonden ska teckna fondandelar för minst en miljon euro. För andra specialplaceringsfonder räcker tio andelsägare. Om varje andelsägare ska teckna fondandelar för minst 500 000 euro, kan specialplaceringsfonden likväl ha färre än tio andelsägare under förutsättning att fondens sammanlagda kapital enligt stadgan är minst två miljoner euro. I praktiken uppfylls detta villkor till exempel när fyra andelsägare tecknar andelar för 500 000 euro var. Om det i en sådan specialplaceringsfonds stadgar bestäms att minst en andelsägare ska teckna fondandelar för minst två miljoner euro, räcker det emellertid att fonden har en andelsägare. 
De undantag som gäller för specialplaceringsfonder kan beskrivas som följer: 
Källa: Rapport av arbetsgruppen för utvärdering av skattebehandlingen av olika investeringsformer, finansministeriets publikationer 14/2018, på finska 
1.6
Gränsöverskridande situationer
1.6.1 Skattebehandlingen av utländska placeringsfonder – Finland som källstat för inkomst 
Allmänt 
Fondmarknaderna har utvecklats snabbt, och även den gränsöverskridande placeringsverksamheten har vuxit betydligt bland annat som ett resultat av EU:s gemensamma inre marknad och euroområdets gemensamma valuta. Den internationella fondverksamheten har ofta beröringspunkter även med Finland, och placeringsverksamheten sker inte längre inom en stats gränser. 
När en utländsk placeringsfond investerar i Finland är den källskatt som fonden ska betala i Finland för utdelning som den får på grundval av avkastningen från ett placeringsobjekt en central fråga. Ränteinkomster och överlåtelsevinster för aktier som en begränsat skattskyldig får från Finland är i allmänhet skattefria på grundval av intern finsk lagstiftning. Finland har i allmänhet beskattningsrätt endast för utdelningsinkomster och fastighetsinkomster från Finland. Den källskatt som tas ut på utdelning på grundval av Finlands interna lagstiftning kan enligt källskattelagen vara 30, 20, 15 eller 0 procent beroende på inkomsttagaren och företaget som betalar utdelningen. Bestämmelserna i ett skatteavtal kan dock kräva att källskatten sänks exempelvis till femton eller noll procent. 
Bestämmelsen om skattefrihet för placeringsfonder i inkomstskattelagen har ansetts gälla endast finska placeringsfonder. Utländska placeringsfonder är alltså skattskyldiga för de inkomster som de får i Finland. Principen om fri rörlighet för kapital enligt fördraget om Europeiska unionens funktionssätt (FEUF) kan emellertid förhindra att källskatt tas ut. I Finlands interna lagstiftning finns det inga särskilda bestämmelser om utländska samfunds eller förmögenhetsmassors skatterättsliga ställning. 
UCITS-direktivet möjliggör tre olika rättsliga strukturer för fondföretag: avtalsbaserad placeringsfond, placeringsbolag med rörligt kapital och fond i trustform. I direktivet är överbegreppet för dessa olika fonder fondföretag. Placeringsfonder som inrättas i Finland endast bara vara avtalsbaserade. I en många stater finns det olika fonder som inte är placeringsfonder i fondföretagsdirektivets mening utan så kallade AIF-fonder. Dessutom kan det finnas fonder som inte klassificeras som AIF-fonder, såsom fonder i tredjeländer. Sådana fonders juridiska form beror på lagstiftningen i fondens hemviststat. När skattebehandlingen av en utländsk placeringsfond bedöms, är det viktigt att fastställa vilket slags finska aktörer fonden ska jämställas med. I praktiken jämställs en utländsk placeringsfond med ett finskt aktiebolag, en finsk placeringsfond eller en finsk sammanslutning. 
Tillämpning av skatteavtal på utländska placeringsfonder 
När en utländsk placeringsfond investerar i ett finskt placeringsobjekt, är en av de frågor som ska lösas huruvida fonden har rätt till eventuella skatteavtalsförmåner. För att ett skatteavtal ska kunna tillämpas ska placeringsfonden kunna anses vara en person som är bosatt i en avtalsstat. Med att bo i en avtalsstat avses i skatteavtal i allmänhet att personen enligt lagstiftningen i staten i fråga är skattskyldig där. I skatteavtalen kan det dessutom förutsättas till exempel att mottagaren av en utdelningsinkomst är den så kallade verkliga förmånstagaren (beneficial owner). 
Till stöd för bedömningen av om ett skatteavtal kan tillämpas på en utländsk placeringsfond i Finland finns det en del rättspraxis. Om fonden till sin rättsliga form till exempel är ett bolag, kan det vara lättare för fonden att få skatteavtalsförmåner, men detta är ändå inte det avgörande kriteriet. I rätten har till exempel luxemburgska aktiebolag med variabelt kapital som bedriver fondverksamhet (Société d’investissement á capital variable, SICAV) ansetts vara berättigade till skatteavtalsförmåner, även om de är befriade från skatt enligt Luxemburgs interna lagstiftning. I fråga om avtalsbaserade arrangemang har det i finsk rättspraxis ansetts att de ska behandlas från fall till fall. I rättspraxis har avtalsbaserade tyska placeringsfonder som är skattskyldiga i sin hemviststat och som är jämförbara med finska placeringsfonder betraktats som skatteavtalssubjekt med hemvist i skatteavtalsstaten. Ur skatteavtalsperspektiv kan en utländsk placeringsfond även anses transparent, varvid ett skatteavtal mellan placerarna och placeringsobjektets hemviststat kan vara tillämpligt. 
EU-rättens betydelse 
EU-rätten kan helt och hållet förhindra att källskatt tas ut. Under de senaste drygt tio åren har unionsrätten och de krav om jämställande som grundar sig på den fått en viktigare roll än skatteavtalen och deras tillämpning. Källbeskattning av vinstutdelning strider allmänt taget mot unionsrätten när utländska utdelningsmottagare som objektivt befinner sig i en jämförbar situation skattemässigt råkar i ett sämre läge än finska utdelningsmottagare. 
På grund av Europeiska unionens domstols (EUD) praxis ändrades källskattelagen i fråga om källbeskattningen av vinstutdelning 2008 genom att ett nytt 5 mom. fogades till 3 §. Detta hade sin grund i tanken att källskatt inte ska behöva betalas i Finland på utdelning som ett finskt samfund betalar ett begränsat skattskyldigt samfund om utdelning som betalas mellan motsvarande finska samfund är skattefri. Ändringen har betydelse för utländska placeringsfonder i situationer där en utländsk placeringsfond är jämförbar med ett finskt aktiebolag. SICAV-bolag är typiska exempel på sådana fonder. 
Enligt 3 § 5 mom. i källskattelagen ska källskatt inte betalas på dividend som betalas till ett i Finland begränsat skattskyldigt samfund som motsvarar ett samfund enligt 33 d § 4 mom. i inkomstskattelagen eller 6 a § i lagen om beskattning av inkomst av näringsverksamhet (360/1968, näringsskattelagen) och dividenden är skattefri enligt dessa bestämmelser om den betalas till ett inhemskt samfund. Det förutsätts också att samfundet har hemvist inom Europeiska ekonomiska samarbetsområdet och att rådets direktiv 2011/16/EU om administrativt samarbete i fråga om beskattning och om upphävande av direktiv 77/799/EEG, sådant det lyder ändrat genom rådets direktiv (EU) 2015/2376 om ändring av direktiv 2011/16/EU vad gäller obligatoriskt automatiskt utbyte av upplysningar i fråga om beskattning, eller ett avtal om handräckning och utbyte av information i skatteärenden inom Europeiska ekonomiska samarbetsområdet gäller dividendtagarens hemviststat. Dessutom förutsätts det att källskatt enligt dividendtagarens utredning i praktiken inte i sin helhet kan gottgöras i dividendtagarens hemviststat på grundval av ett dubbelbeskattningsavtal mellan Finland och dividendtagarens hemviststat. 
När denna bestämmelse i källskattelagen tillämpas ska det i praktiken först undersökas skattebelastningen på utdelning till bolag i en rent inhemsk situation. Enligt huvudregeln i 6 a § i näringsskattelagen är vinstutdelning som ett samfund får inte skattepliktig inkomst för samfundet, det vill säga utdelning som ett onoterat aktiebolag delar ut till ett annat aktiebolag är inte skattepliktig. Däremot är utdelning som offentligt noterade bolag delar ut skattefri bara när mottagaren är ett annat börsbolag eller ett sådant onoterat bolag som äger minst tio procent av det noterade bolaget. I paragrafen föreskrivs det också särskilt om förutsättningarna för att utdelning från ett bolag som hemvist i en EES-stat men inte omfattas av moder- och dotterbolagsdirektivet ska vara skattefri och om skattebehandlingen av utdelning på kredit- och pensionsanstalternas placeringstillgångar. Om ett utländskt samfund som tar emot utdelning kan jämställas med ett finskt mottagarsamfund för vilket motsvarande utdelning är skattefri och övriga föreskrivna villkor är uppfyllda, ska källskatt inte tas ut på utdelningen. 
Syftet med den aktuella bestämmelsen i källskattelagen är att undanta utdelning som är skattefri i Finland från skatt även i gränsöverskridande situationer inom EES-området. Enligt rättspraxis hindrar principen om fri rörlighet för kapital i artikel 63 i FEUF att källskatt tas ut på utdelning även när det är fråga om en placeringsfond med hemvist i en tredjestat som kan jämställas med ett aktiebolag. Om förutsättningarna för att tillämpa bestämmelsen inte är uppfyllda, är källskatten på utdelningen enligt intern finsk lagstiftning i regel 20 procent. 
I källskattelagen finns det ingen bestämmelse som undantar dividend från källskatt i situationer där en utländsk placeringsfond är jämförbar med en finsk. I sådana situationer har det ansetts att källskatt inte kan tas ut med stöd av principen om fri rörlighet för kapital i artikel 63 i FEUF. Om en utländsk placeringsfond som investerar i Finland objektivt sett är jämförbar med en finsk placeringsfond och olika behandling inte kan motiveras på ett sätt som är godtagbart med hänsyn till unionsrätten, ska samma skattefrihetsregler tillämpas på den utländska placeringsfonden som på den finska. 
De vanligaste interna finska situationerna vid beskattning av utdelning och deras samband med beskattningen i gränsöverskridande situationer kan åskådliggöras med följande figur: 
Olika situationer vid beskattning av utdelning 
Källa: Rapport av arbetsgruppen för utvärdering av skattebehandlingen av olika investeringsformer, finansministeriets publikationer 14/2018, på finska 
Många olika slags utländska rättsliga strukturer för kollektiva investeringar har jämförts med finska placeringsfonder (situation 1 ovan) eller aktiebolag (situationerna 2 och 4 ovan). I dessa situationer förhindrar en tolkning av 20 § i inkomstskattelagen utifrån EU-rätten eller 3 § 5 mom. i källskattelagen att källskatt tas ut eller medför att den ska återbetalas. Bland annat fonder med hemvist i Luxemburg, Sverige, Danmark och Förenta staterna har jämställts med finska placeringsfonder. En del rättsliga strukturer har även jämförts enligt situation 3, däribland luxemburgska SICAV-strukturer. I fråga om dem har Finland haft rätt att ta ut källskatt, eftersom utdelning är skattepliktig även i den interna finska situationen. Rättspraxis beskrivs närmare i avsnitt 1.7. 
Fastighetsfonder 
Fastighetsinkomster betraktas som inkomster som förvärvats i Finland, vilka Finland har rätt att beskatta enligt den interna lagstiftningen. Som inkomst som förvärvats i Finland betraktas, enligt 10 § 1 punkten i inkomstskattelagen, inkomst av här belägna fastigheter eller av lägenheter som innehas på grundval av aktier i ett finskt bostadsaktiebolag eller annat aktiebolag eller på grundval av medlemskap i ett bostadsandelslag eller något annat andelslag. Enligt 10 punkten i samma paragraf betraktas vinst på investeringar i fastigheter som inkomst som förvärvats i Finland när vinsten har uppkommit vid överlåtelse av en fastighet som är belägen här eller av aktier eller andelar i ett finskt bostadsaktiebolag eller annat aktiebolag eller andelslag av vars samtliga tillgångar mera än 50 procent utgörs av en eller flera fastigheter som är belägna här. Skatteavtal hindrar i allmänhet inte Finland från att beskatta begränsat skattskyldiga för fastighetsinkomster som de får från Finland. 
I den finska rätts- och beskattningspraxisen har jämställningssituationer i viss mån behandlats även med hänsyn till fastighetsinkomster från Finland. Om en utländsk fond är jämförbar med ett finskt aktiebolag är fastighetsinkomster, exempelvis hyresinkomster, skattepliktiga inkomster, och Finland har rätt att beskatta inkomsterna. Hyresinkomster är skattepliktiga även för finska aktiebolag. Om en utländsk fond jämställs med en skattefri finsk specialplaceringsfond, är fastighetsinkomsten skattefri inkomst även för den utländska fonden. Om en utländsk fond jämställs med ett finskt kommanditbolag, betalas skatt på fastighetsinkomsten av bolagsmännen, det vill säga placerarna. 
1.6.2 Skattebehandling av finska placeringsfonder utomlands 
Trots att finska placeringsfonder genom lag är samfund som är befriade från inkomstskatt, kan de vara skyldiga att betala källskatt på placeringsavkastning utomlands. Vad gäller skattebelastningen på en finsk placeringsfond är det av stor vikt om källstaten för inkomsten tillämpar ett skatteavtal som den ingått med Finland eller inte. Det är också möjligt att källstaten betraktar den finska placeringsfonden som transparent i beskattningen och i stället för ett skatteavtal med Finland tillämpar ett skatteavtal som den ingått med andelsägarens hemviststat. 
I de finska skatteavtal som är i kraft ingår i allmänhet inte några uttryckliga överenskommelser om skattebehandlingen av finska placeringsfonder. Ur finsk synvinkel betraktas en finsk placeringsfond som en person som avses i skatteavtal, och Skatteförvaltningen beviljar placeringsfonden ett så kallat hemvistintyg. Hemvistintyget visar vilken stat som är inkomsttagarens skatterättsliga hemviststat. I regel lämnas hemvistintyget till källstaten för inkomsten för att påvisa att förutsättningarna för tillämpning av ett visst skatteavtal uppfylls. Huruvida skatteavtalsförmåner beviljas beror alltid också på hur den utländska källstaten för inkomsten tolkar situationen. 
Om de lägre procentsatser som skatteavtal möjliggör inte tillämpas, får finska placeringsfonder större källskattekostnader för sina inkomster från utlandet. Källskatt som tagits ut i utlandet kan inte gottgöras i beskattningen av en finsk placeringsfond i Finland, eftersom placeringsfonden är fri från skatt. Källskatt kan inte heller gottgöras i beskattningen av andelsägarna, eftersom det är fråga om skatt som fonden ska betala. 
Om ett skatteavtal är tillämpligt innebär det i allmänhet endast att källskatten på utdelning sjunker till 15 procent, varför den återstående källskatten även för en finsk placeringsfond under alla omständigheter kvarstår som slutlig kostnad. Även en finsk placeringsfond har möjlighet att söka återbetalning av källskatt från andra medlemsstater på unionsrättsliga grunder. 
1.6.3 Vinstandel som en placeringsfond delar ut samt överlåtelse av fondandelar 
Begränsat skattskyldiga investerare i finska placeringsfonder 
Den som är begränsat skattskyldig är skyldig att betala skatt i Finland endast på inkomst som den skattskyldige förvärvat här. Enligt 10 § 9 punkten i inkomstskattelagen betraktas vinstandelar i finska placeringsfonder som inkomst som förvärvats i Finland. Skatteavtal inverkar likväl på Finlands beskattningsrätt. Ofta betraktas en vinstandel med stöd av en så kallad uppsamlingsartikel i ett skatteavtal inte som utdelningsinkomst utan som annan inkomst. I så fall har i allmänhet endast hemviststaten beskattningsrätt, vilket innebär att Finland inte har rätt att ta ut källskatt på vinstandelen som betalas en utländsk placerare. 
Överlåtelsevinster avseende aktier är i allmänhet inte skattepliktig inkomst för begränsat skattskyldiga i Finland. Inte heller en överlåtelse av andelar i en finsk placeringsfond är inkomst från Finland enligt intern finsk lagstiftning, och Finland har därför inte rätt att beskatta överlåtelsen som källstat för inkomsten. Däremot betraktas överlåtelse av aktier av vissa fastighetsbolag eller bolag som förvaltar fastighetstillgångar enligt 10 § 10 punkten i inkomstskattelagen som inkomst som förvärvats i Finland och därför som skattepliktig även för begränsat skattskyldiga. I beskattningspraxis har det likväl ansetts att överlåtelse av en andel i en specialplaceringsfond som investerar i fastigheter inte är inkomst från Finland (centralskattenämndens (CSN) förhandsavgörande KVL:2012/2, endast på finska). 
Allmänt skattskyldiga investerare i utländska fonder 
När en finsk placerare får en vinstandel från en utländsk fond, beror skattebehandlingen av denna vinstandel på vilket slags finsk aktör den utländska fonden är jämförbar med. Om den utländska placeringsfonden är jämförbar med en finsk placeringsfond, är inkomsten i sin helhet skattepliktig inkomst. Om den utländska placeringsfonden är jämförbar med ett aktiebolag, beskattas inkomsten som vinstutdelning, som beroende på inkomsttagaren är antingen delvis eller helt skattefri. Även skatteavtal kan inverka på skattebehandlingen. 
I skattelagarna finns det inga särskilda bestämmelser där utländska samfund eller förmögenhetsmassor definieras. Hur en utländsk placeringsfond klassificeras grundar sig också vid beskattningen av en finsk placerare på en fallspecifik bedömning. I praktiken har till exempel EUD:s dom i mål C-303/07, Aberdeen Property Fininvest Alpha, och högsta förvaltningsdomens (HFD) avgörande HFD:2010:15 vad gäller rätts- och beskattningspraxis haft betydelse för huruvida inkomst som delas ut av en fond av SICAV-typ betraktas som vinstandelar eller dividend. I ett färskt förhandsavgörande (ej laga kraft) har avkastning som delas ut av ett SICAV-bolag som omfattas av fondföretagsdirektivet ansetts vara skattepliktig förvärvsinkomst i sin helhet på grund av de ändrade reglerna för beskattning av vinstutdelning från år 2014. Fonder av olika form som i sina hemviststater ses som genomgångsenheter, såsom avtalsbaserade FCP-placeringsfonder (Fonds Commun de Placement, FCP) med säte i Luxemburg, har i rätts- och beskattningspraxis vid beskattningen av finska placerare setts både som transparenta enheter och som enheter som motsvarar finska placeringsfonder. 
1.7
Central rätts- och beskattningspraxis
1.7.1 Skatteavtalens tillämplighet 
I Finland har till exempel en SICAV-konstruktion setts som en person med rätt till förmåner enligt skatteavtalet mellan Finland och Luxemburg även om den enligt Luxemburgs interna skattelagstiftning är fri från inkomstskatt. Följaktligen har endast 15 procent, inte 29 procent som enligt intern finsk lagstiftning, kunnat tas ut som källskatt (HFD:2004:111). Likaså har tyska fastighetsplaceringsfonder betraktats som personer som omfattas av skatteavtalet mellan Finland och Tyskland även när de varit avtalsbaserade arrangemang som genom en särskild bestämmelse hade befriats från samfundsskatt i Tyskland (KVL:2002/61 och KVL:2006/1, endast på finska). 
En placeringsfond av typen FCP betraktades i HFD:s avgörande HFD:2004:116 som en så kallad genomgångsenhet. På ränte- och utdelningsinkomster som det allmänt skattskyldiga bolaget A Oy som ägde andelar i fonden fick från Förenta staterna tack vare dessa andelar tillämpades skatteavtalet mellan Finland och Förenta staterna och inte skatteavtalet mellan Finland och Luxemburg. Så var fallet trots att HFD i sitt avgörande konstaterade att FCP-fonden enligt Finlands interna lagstiftning ska betraktas som ett samfund som avses i 3 § i inkomstskattelagen. Likaså ansåg CSN i sitt förhandsavgörande KVL:2009/72 att en nederländsk avtalsbaserad fond av typen Fonds voor Gemene Rekening (FGR) var en genomgångsenhet som varken var en separat skattskyldig eller ett skatteavtalssubjekt. 
1.7.2 Källbeskattning 
SICAV-konstruktioner (fonder enligt fondföretagsdirektivet och AIF-fonder) 
EUD gav sin dom i mål C-303/07, Aberdeen Property Fininvest Alpha, med anledning av HFD:s begäran om förhandsavgörande. På grund av domen ansåg HFD i sitt avgörande HFD:2010:15 att A Ab inte skulle uppbära källskatt på den utdelning som A Ab betalade till SICAV-bolaget. SICAV-bolaget i målet jämställdes med ett finskt aktiebolag, för vilket utdelningen är skattefri. 
I HFD:s avgörande var det fråga om en situation där SICAV-bolaget ägde 100 procent av ett finskt målbolag. De SICAV-bolag som placerar medel i Finland är i allmänhet UCITS-fonder enligt direktivet som gör portföljplaceringar i börsbolag. Placeringarna i finska börsnoterade bolag är då så små att de inte ger bestämmande inflytande i målbolagen. I beskattningspraxis har SICAV-bolag även i dessa fall jämställts med aktiebolag, vilket betyder att skattefriheten för utdelning beror på om SICAV-bolaget självt är börsnoterat eller inte. Om bolaget är ett börsnoterat bolag enligt inkomstskattelagen, är utdelning som det får från finska börsbolag skattefri. 
I förhandsavgörande CSN:2015/13 (KHO 19.12.2016 taltio 5433, ingen ändring) ansågs även ett maltesiskt SICAV, som inte var en fond i fondföretagsdirektivets mening, utifrån sin verksamhet och bolagsform närmast vara jämförbart med ett finskt aktiebolag som bedriver placeringsverksamhet. SICAV-företaget hade som syfte att investera i offentligt noterade aktiebolag i Finland. Enligt ansökan om förhandsavgörande var företagets aktier inte föremål för offentlig handel. Eftersom en motsvarande utdelning som en finländsk mottagare jämförbar med den sökande hade mottagit skulle ha varit skattepliktig till hela beloppet ansåg CSN att källskatt på dividenden inte stred mot artikel 63 i FEUF. 
I Luxemburg kan SICAV-konstruktioner som inte omfattas av fondföretagsdirektivet inrättas i många olika bolagsformer som bolagsrättsligt placerar sig mellan aktiebolag och kommanditbolag. Detta kan ha betydelse vid en jämförelse med finska bolagsformer. I förhandsavgörande CSN:2017/57 ansåg CSN till exempel att ett kommanditbolag med säte i Luxemburg och registrerat som SCS (Société en Commandite Simple), som var en AIF-fond enligt AIFM-direktivet och en SICAV-RAIF-konstruktion med variabelt kapital, närmast motsvarade ett finskt kommanditbolag och inte en specialplaceringsfond. Följaktligen betraktades SCS-bolaget med stöd av 4 och 16 § i inkomstskattelagen som transparent i den finska beskattningen, och dess inkomster beskattades som inkomster för dess andelsägare. 
I förhandsavgörande CSN:2017/60 (laga kraft; KHO 26.4.2018, taltio 2009, endast på finska) jämställde CSN ett belgiskt fondföretag med rörligt kapital (SICAV) i bolagsform (S.A.) som inte omfattades av fondföretagsdirektivet med en finsk specialplaceringsfond och ett finskt aktiebolag. Företagets fonder omfattades inte av AIFM-direktivet. Den sökande liknade till sina funktionella kännetecken en finsk specialplaceringsfond. Vid sidan av dem hade det emellertid också funktionella kännetecken som påminde om placeringsverksamhet i aktiebolags- eller kommanditbolagsform. Särskilt på grund av sin juridiska form ansågs att företaget objektivt sett närmast var jämförbart med ett finskt aktiebolag varför den utdelning som det fått från Finland inte var befriad från skatt enligt 20 § 1 mom. i inkomstskattelagen. 
Avtalsbaserade UCITS-fonder 
I CNS:s förhandsavgörande KVL:2011/21 (endast på finska) ansågs en norsk placeringsfond som var ett sådant fondföretag enligt fondföretagsdirektivet (85/611/EEG) som uppfyllde den norska lagen om placeringsfonder jämförbar med en finsk placeringsfond. Placeringsfonden ansågs till sina centrala egenskaper motsvara en finsk placeringsfond. Fondens medel förvaltades av ett fondbolag med formen av ett aktiebolag. Fonden var en separat juridisk person och allmänt skattskyldig för sin inkomst. Den utdelning och de överlåtelsevinster som fonden fick var till största delen undantagna från inkomstskatt genom särskilda bestämmelser. CSN ansåg att eftersom placeringsfond A var ett sådant fondföretag som avses i fondföretagsdirektivet, fanns det inga objektiva skillnader mellan den och motsvarande finska placeringsfonder. Olika skattebehandling av placeringsfonderna kunde inte heller motiveras med behovet av att trygga skattesystemets inre sammanhang eller en balanserad fördelning av beskattningsrätten mellan medlemsstaterna. Bestämmelserna om fri rörlighet för kapital i FEUF och i EES-avtalet ansågs kräva att 20 § 1 mom. 2 punkten i inkomstskattelagen tillämpas på den norska fonden som var en placeringsfond enligt fondföretagsdirektivet. Placeringsfond A var följaktligen inte enligt 20 § 1 mom. 2 punkten i inkomstskattelagen skyldig att betala källskatt för utdelning från finska börsbolag. 
Skatteförvaltningen gav till följd av avgörandet en uppdaterad anvisning om uppbörden av källskatt av utländska placeringsfonder (Källbeskattningen av dividendinkomst som en inom det Europeiska ekonomiska samarbetsområdet bosatt, begränsat skattskyldig ha fått – Rättspraxis om utländska fonder, diarienummer A29/200/2017, senaste version 9.2.2017). Enligt anvisningen är en i fondföretagsdirektivet avsedd utländsk investeringsfond som har grundats med stöd av avtalsjuridiska bestämmelser och som till sina viktigaste egenskaper motsvarar en finsk placeringsfond, inte med stöd av 20 § 1 mom. 2 punkten i inkomstskattelagen skattskyldig i Finland för inkomst som har fåtts här. I Skatteförvaltningens anvisningar har det inte fastställts vad som avses med ”viktigaste egenskaper”. Tolkningen tillämpades år 2013 (KVL:2013/14, endast på finska) även på en luxemburgsk FCK-fond enligt fondföretagsdirektivet, som i beskattningspraxis tidigare inte har ansetts jämförbar med finska placeringsfonder på grund av dess skattemässiga transparens. I beskattningspraxisen har också till exempel svenska avtalsbaserade placeringsfonder som uppfyller fondföretagsdirektivet kunnat jämställas med finska placeringsfonder. 
Amerikanska fonder 
HFD meddelade i januari 2015 två betydande avgöranden om uttaget av källskatt på utdelning som amerikanska fonder får i Finland. Ett av dem (HFD:2015:9) publicerades. 
I det publicerade avgörandet ansåg domstolen att ett registrerat amerikanskt förmögenhetsförvaltningsbolag (registered investment management company) av typen Delaware Statutory Trust som var ett reglerat investeringsbolag (regulated investment company) närmast kan jämställas med ett offentligt noterat finskt aktiebolag som bedriver placeringsverksamhet. Eftersom utdelning som ett inhemskt offentligt noterat aktiebolag och liksom även en inhemsk placeringsfond mottar av ett inhemskt offentligt noterat bolag är skattefri i Finland och med beaktande av EUD:s rättspraxis om fri rörlighet för kapital enligt artikel 63.1 i FEUF, skulle källskatt inte uppbäras för utdelning som den amerikanska fonden mottog av ett finskt börsbolag. Fonden var en juridisk person som kunde bedriva rörelse i eget namn. De administrativa funktionerna handhades av ett annat bolag. Till sin karaktär var fonden en sluten placeringsfond (closed-end investment fund), vilket innebär att antalet andelar i fonden var fast och inte varierade med teckning eller inlösen av andelar. Dess vanliga andelar var noterade på New York-börsen. I den federala beskattningen betraktades fonden som ett samfund och faktisk förmånstagare till investeringstillgångarna och avkastningen. 
I sina motiveringar betonade HFD följande omständigheter i anknytning till bedömningen av vilket slags finsk aktör fonden är jämförbar med (kursivering här): 
A motsvarar inte till sin rättsliga karaktär någon aktör enligt finsk lagstiftning. Enligt den begreppsapparat som används i Förenta staterna är A ett registrerat förmögenhetsförvaltningsbolag (registered investment management company) av typen Delaware Statutory Trust och även ett reglerat investeringsbolag (regulated investment company) och en sluten placeringsfond. I ljuset av den utredning som getts verkar den egentliga placeringsverksamhet som A bedriver i mångt och mycket motsvara en finsk placeringsfonds verksamhet. A är likväl till skillnad från en finsk placeringsfond en juridisk person och dessutom separat skattskyldig även om den här typen av aktör i allmänhet inte betalar skatt i Förenta staterna på grund av att de vinstandelar som den delar ut är avdragsgilla. Till skillnad från en finsk placeringsfond är A sluten, och antalet andelar i fonden varierar inte med teckning eller inlösen av andelar. A:s andelar är noterade på värdepappersbörsen i New York. 
A placerar sig därför på grundval av sina rättsliga och funktionella drag i gränsområdet mellan en finsk placeringsfond och ett finskt aktiebolag. Trots likheterna med en finsk placeringsfond vad gäller placeringsverksamheten ska A i ljuset av de egenskaper som nämnts ovan närmast jämföras med ett offentligt noterat finskt aktiebolag som bedriver placeringsverksamhet och inte med en placeringsfond. I en lagstiftningsmiljö där utdelning som en finsk placeringsfond eller ett offentligt noterat finskt bolag får från ett offentligt noterat finskt bolag är skattefri är det inte motiverat att jämställa A med ett sådant i praktiken ovanligt förmögenhetskomplex enligt 3 § 7 punkten i inkomstskattelagen vars utdelningsinkomst är beskattningsbar. 
I det opublicerade avgörande som HFD meddelade samma dag (KHO 13.1.2015 taltio 61 ) ansåg domstolen att en öppen amerikansk placeringsfond kunde jämföras med en finsk placeringsfond. I det aktuella fallet var fonden en del av en juridisk person av typen Massachusetts Business Trust. Till skillnad från fonden i det publicerade beslutet ovan (HFD:2015:9) var den en öppen placeringsfond (open-end investment fund), det vill säga dess kapital varierade med teckning eller inlösen av andelar. Fondandelar kunde köpas och lösas in med fondmedel. Med beaktande av den rättsliga karaktären och verksamheten som helhet hos den amerikanska fonden och en finsk placeringsfond, ansåg HFD till skillnad från CSN att fonden skulle betraktas som jämförbar med en finsk placeringsfond. 
I båda fallen ansåg HFD att det inte fanns legitima grunder för att begränsa den fria rörligheten för kapital. I sin motivering konstaterar HFD att situationen kan anses problematisk med hänsyn till reciprociteten i skatteavtalen: 
Den tolkning enligt vilken unionen har rätt att förhindra att skatt tas ut har som följd att källskatt inte kan tas ut i Finland, medan skatt kan tas ut i Förenta staterna på utdelning som en placerare som bor i Finland får från Förenta staterna. Detta motsvarar inte en traditionell skatteavtalspraxis baserad på reciprocitet. I unionens domstols rättspraxis går det emellertid inte att hitta stöd för uppfattningen att den fria rörligheten för kapital kan begränsas på denna grund. 
I CSN:s förhandsavgörande KVL:2016/44 (endast på finska) jämställdes en fond baserad i Förenta staterna med en finsk specialplaceringsfond. Den sökande var en amerikansk placeringsfond som till sin juridiska karaktär inte direkt motsvarade något av de olika slag en av aktörer som definierats i finsk lagstiftning. Den var bolagsrättsligt inte ett bolag, utan hörde som delfond till en juridisk person med en bolagsform av typen Delaware Statutory Trust. Den sökande var inte en juridisk person även om den hade drag av en fristående juridisk person. Den sökande var till sin karaktär en öppen placeringsfond vars andelar inte köptes och såldes offentligt. Fondens ägarskara hade begränsats så att andelar erbjöds och såldes endast till försäkringsbolagens separata konton (separate accounts), försäkringsavtal med variabelt kapital (variable contracts), pensionsarrangemang (qualified pension plans) och andra gemensamma placeringsfonder (mutual funds). CSN ansåg att den amerikanska fond som behandlades i fallet vad gäller verksamhet och rättslig karaktär närmast motsvarade en specialplaceringsfond enligt 1 kap. 2 § 1 mom. 2 a punkten i lagen om placeringsfonder som vid beskattningen behandlas som en placeringsfond enligt 3 § 4 punkten och 20 § 1 mom. 2 punkten i inkomstskattelagen. Därför kunde källskatt inte tas ut på utdelning från Finland. 
Avtalsbaserade AIF-fonder 
Helsingfors förvaltningsdomstol ansåg i beslut nr 13/1447/4 (HFD 2.3.2016, ej besvärstillstånd) av den 15 oktober 2013 att en tysk öppen fastighetsplaceringsfond (Spezial-Sondervermögen) kan jämställas med en finsk specialplaceringsfond. 
Ägarna till andelarna i en tysk fastighetsplaceringsfond utgjordes i huvudsak av tyska institutionella placerare, exempelvis livförsäkringsbolag, banker och pensionsfonder. I besvärsskriften till förvaltningsdomstolen konstaterades bland annat följande (i översättning): "Skillnaderna mellan tyska och finska fastighetsplaceringsfonder har främst att göra med minimikapitalet och fondandelsägarnas karaktär och antal. Allmänt taget är det dock normalt att samfund som bildats i enlighet med olika länders lagstiftning inte är helt identiska till sina rättsliga kännetecken. Den fond som anför besvär har vid tidpunkten för besvären femton institutionella placerare, och dess tillgångar överskrider avsevärt minimikapitalkraven enligt lagen om placeringsfonder. Fonden uppfyller alltså de krav på antal placerare och minimikapital som ställs på finska fastighetsplaceringsfonder. Dessutom motsvarar den skattemässiga karaktären hos och behandlingen av den överklagande helt karaktären hos och behandlingen av en finsk placeringsfond." Förvaltningsdomstolen ansåg att den ifrågavarande tyska fastighetsplaceringsfonden kunde jämställas med en finsk fastighetsplaceringsfond i beskattningshänseende. Med stöd av 3 § 4 punkten och 20 § 1 mom. 2 punkten i inkomstskattelagen är den inkomst som en specialplaceringsfond får av bland annat en inhemsk fastighet skattefri för mottagaren. Enligt förvaltningsdomstolen kunde den överklagande i väsentliga delar anses motsvara ett sådant inhemskt samfund som avses i 3 § 1 mom. 4 punkten i inkomstskattelagen. I sin motivering beaktade förvaltningsdomstolen också att de skatter som i Finland tagits ut på fastighetsinkomster som betalats till den tyska fastighetsplaceringsfonden inte kunde gottgöras i Tyskland. 
År 2016 gav CSN ett förhandsavgörande om källbeskattning av en tysk AIF-fonds utdelningsinkomst i Finland (KVL:2016/17; endast på finska). Den sökande var en öppen placeringsfond enligt den tyska lagen om placeringsfonder. I fondens placeringar ingick det finska fastighetsbolaget A Ab, som fick hyresinkomster från den fastighet bolaget ägde. Placeringsfonden ansågs till sin juridiska form och sina centrala egenskaper motsvara en placeringsfond enligt 3 § 4 punkten i inkomstskattelagen. Med hänsyn till 20 § 1 mom. i inkomstskattelagen och artikel 63.1 i FEUF ansåg CSN att källskatt inte skulle tas ut på den utdelning som A Oy betalade till placeringsfonden. 
Övriga 
I Helsingfors förvaltningsdomstols beslut 15/0830/4 (votering 2—1) av den 7 oktober 2015 jämställdes en fransk fastighetsplaceringsfond i bolagsform (Société civile de placement immobilier, SCPI) med en finsk specialplaceringsfond, varvid inkomst av en fastighet i Finland skulle befrias från skatt i Finland med stöd av 20 § 1 mom. i inkomstskattelagen. Av förvaltningsdomstolens motivering framgår att fonden var en onoterad fond med rörligt kapital registrerad i det franska handels- och bolagsregistret. Enligt fransk lagstiftning var fonden en juridisk person och en särskild skattskyldig som var befriad från skatt. Fonden hade cirka 3 000—4 000 aktieägare, varav 95 procent var franska privatpersoner och cirka fem procent samfund. Med hänsyn till den i ärendet framställda utredningen om fondens juridiska egenskaper och de funktionella drag som anknöt till placeringsverksamheten, ansåg förvaltningsdomstolen att fonden i ljuset av dessa egenskaper ska anses vara en aktör som kan jämställas med en inhemsk placeringsfond. En domare i minoritet ansåg att fonden i ljuset av dess juridiska egenskaper snarare ska jämställas med ett inhemskt aktiebolag som bedriver fastighetsplaceringsverksamhet än med en placeringsfond. 
HFD:s avgörande T 4296 av den 19 september 2018 gällde huruvida en fransk personalfond skulle jämställas med en finsk aktör. CSN hade ansett att situationen för den franska FCPE-personalfonden (Fonds Commun de Placement D’Enterprise) objektivt sett inte kunde jämställas med situationen för en finsk personalfond och att fonden inte heller kunde jämställas med en finsk specialplaceringsfond. HFD upphävde CNS:s förhandsavgörande och konstaterade i sin motivering att fonden till sina juridiska egenskaper inte direkt motsvarade någon som helst aktör enligt finsk lagstiftning. Fondens juridiska form och förvaltning motsvarade en finländsk placeringsfonds form och förvaltning. Arten av och syftet med fondens placeringsverksamhet motsvarade däremot arten av och syftet med en finsk personalfond. Fonden ska således till sin juridiska form och art anses placera sig mellan en specialplaceringsfond enligt lagen om placeringsfonder och en finsk personalfond. Eftersom båda dessa slag av inhemska aktörer är befriade från inkomstskatteplikt i Finland, skulle det strida mot principen om fri rörlighet för kapital att ta ut källskatt på utdelning som i Finland betalas till en fransk FCPE-fond. HFD ansåg också att det i den ifrågavarande situationen inte heller fanns några till allmänintresset anknytande tvingande skäl som kunde motivera en särbehandling. 
I förhandsavgörande CSN:2018/43 (ej lagakraftvunnet) ansågs en avtalsbaserad öppen fastighetsfond enligt den schweiziska lagstiftningen om placeringsfonder inte vara en specialplaceringsfond; en sådan vore enligt 20 § i inkomstskattelagen ett skattefritt samfund. Enligt motiven fästes betydelse bland annat vid att fonden inte uppfyllde det för specialplaceringsfonder i 27 § i lagen om placeringsfonder uppställda kriteriet angående det minimibelopp en fondandelsägare ska teckna. Centralskattenämnden hänvisade också till den övergångsbestämmelse (så kallad grandfathering) i artikel 64.1 i FEUF enligt vilken vissa restriktioner i förhållande stater utanför EU är tillåtna. Hit hör enligt bestämmelsen bland annat restriktioner som var i kraft den 31 december 1993 enligt nationell lagstiftning eller unionsrätt för sådana kapitalrörelser till eller från tredjeland som gäller direktinvesteringar, inbegripet fastighetsinvesteringar. Det ansågs inte att EU-rätten kräver att skattefrihet enligt 20 § i inkomstskattelagen tillämpas på den inkomst som sökanden fått från Finland. Inte heller ansågs det att artikeln om diskrimineringsförbud i inkomstskatteavtalet utgjorde ett hinder för att den inkomst som fåtts från Finland beskattades direkt som inkomst för sökanden. 
1.7.3 Inkomstens natur för delägaren 
SICAV-konstruktioner 
HFD ansåg i sitt avgörande HFD 12.3.2010 liggare 470 att den vinstutdelning ett finskt aktiebolag fick från ett SICAV-bolag ska anses utgöra dividend också vid beskattningen i Finland. Enligt avgörande CSN:2010/33 kunde likaså vinstutdelningen från ett luxemburgskt SICAF-bolag, som var en fond enligt den luxemburgska lagen om specialplaceringsfonder, betraktas som dividend i beskattningen i Finland. I båda fallen var inkomsttagaren ett finskt aktiebolag. Ännu i rättspraxis från slutet av 1990-talet ansågs vinstutdelning från SICAV-bolag utgöra vinstandel enligt 32 § i inkomstskattelagen. 
Beskattningen av dividend ändrades i Finland vid ingången av 2014, och ändringen påverkade också beskattningen av den avkastning som delades ut av SICAV-fonder. Ett SICAV-bolag är inte ett bolag som avses i moder-/dotterbolagsdirektivet. I Finland är vinstutdelning också från andra bolag med säte i EES-området än sådana som avses i moder-/dotterbolagsdirektivet skattefri, förutsatt bland annat att det bolag som delar ut vinsten utan valmöjlighet och befrielse är skyldigt att betala minst tio procent i skatt på den inkomst av vilken vinsten utdelats. Eftersom SICAV-bolagen är skattefria uppfyller de inte detta villkor. Vinstutdelningen från dem har därför sedan 2014 i princip helt varit beskattningsbar inkomst för finländska aktiebolag. 
Den ändring av beskattningen av dividend som infördes 2014 har konsekvenser också för beskattningen av den inkomst som fysiska personer får av SICAV-bolag. Tidigare grundade sig beskattningen av fysiska personers inkomster på huruvida SICAV-bolaget var börsnoterat eller inte. Enligt den gällande inkomstskattelagen bestäms skattepliktigheten för vinstutdelning från ett utländskt bolag på samma sätt som skattepliktigheten för vinstutdelning från ett finländskt bolag. Det förutsätter dock att det samfund som delar ut vinsten utan valmöjlighet och befrielse är skyldigt att betala minst tio procent i skatt på den inkomst av vilken vinsten utdelats. I annat fall är vinstutdelningen skattepliktig förvärvsinkomst även om bolagets aktie skulle vara börsnoterad (33 c § 3 mom. i inkomstskattelagen). Eftersom villkoret för betalning av skatt inte uppfylls för SICAV-bolags del, beskattas den avkastning som anses utgöra vinstutdelning som förvärvsinkomst för en fysisk person (CSN:2017/58, ej lagakraftvunnen). 
Avtalsbaserade fonder 
Det har också i rättspraxis angående avtalsbaserade fonder förekommit olika tolkningar närmast av huruvida en utländsk avtalsbaserad fond vid beskattningen ska anses som en skattemässigt transparent enhet. I fallet HFD:2004:116 ansågs en luxemburgsk FCP-fond vara en skattemässigt transparent enhet vid beskattningen i Finland, varvid delägarna beskattades direkt. 
År 2013 ansåg dock CSN i avgörandet CSN:2013/8 att en luxemburgsk FCP-fond, som var en sådan fond som avses i fondföretagsdirektivet, till sina centrala egenskaper motsvarade en placeringsfond enligt 3 § 4 punkten i inkomstskattelagen. FCP-fonden hade enbart så kallade tillväxtandelar som inte gav avkastning under placeringstiden. En finländsk privatperson hade för avsikt att placera i en delfond i FCP-paraplyfonden. I CSN:s förhandsavgörande ansågs den finländska placeraren få skattepliktig inkomst av fondandelarna först när andelarna löses in eller annars överlåts på ett sätt som realiserar överlåtelsevinst eller överlåtelseförlust. Principen om skattemässigt transparent enhet tillämpades alltså inte på beskattningen av placeraren. 
1.7.4 Byte av andelar i en fond eller delfond 
Lagen om placeringsfonder tillåter att en placeringsfond har olika slag av andelsserier. En och samma placeringsfond kan ha såväl tillväxtandelar som avkastningsandelar. Den gällande lagen om placeringsfonder tillåter dock inte delandelskonstruktioner i Finland. Med delfond avses en sådan del av en placeringsfond vars placeringsverksamhet kan avvika från placeringsverksamheten i fondens andra delfonder och, på det sätt som närmare bestäms i placeringsfondens stadgar, från placeringsfondens allmänna investeringspolicy. Utländska placeringsfonder kan dock ha delfondskonstruktioner. Rättspraxis angående byte av andelar i fonder och delfonder anknyter till huruvida bytet ska betraktas som överlåtelse vid beskattningen. Överlåtelse är förknippat med skattepåföljder. 
Ett byte av andelsklass från tillväxtandelar till avkastningsandelar eller vice versa inom samma placeringsfond har inte ansetts vara skattepliktig överlåtelse (CSN:1998/102). Inte heller byte inom samma placeringsfond från tillväxtandelar i en andelsserie med ränteriskskydd mot avkastnings- eller tillväxtandelar i andelsserien utan ränteriskskydd eller vice versa har ansetts vara skattepliktig överlåtelse (CSN:2014/54, ej offentliggjort). När det gällt byte av olika placeringsfonders fondandelar har bytet betraktats som överlåtelse också då fonderna förvaltas av samma fondbolag (HFD 10.5.2000 liggare 862). 
I fallet HFD 27.4.2009 liggare 1010 var det frågan om byte av aktier i en delfond i ett SICAV-bolag med säte i Luxemburg till aktier i en annan delfond i samma bolag. Båda aktieserierna hade rätt till en viss tillgång i delfonden. När aktier i olika delfonder byttes till aktier i en annan delfond, hänförde sig den rätt som uppkom genom de aktier som erhållits i utbyte till en annan tillgång. HFD ansåg att byte av aktier i en delfond till ett SICAV-bolag till aktier en annan delfond ska betraktas som överlåtelse enligt 45 § i inkomstskattelagen. När ett aktieslag bytts mot ett annat aktieslag inom samma delfond har det dock ansetts vara frågan om skattefri överlåtelse. Så var fallet bland annat i CSN:s opublicerade avgörande CSN:2008/65, där det var frågan om byte av aktier i en aktieserie i dollar i en utländsk placeringsfonds delfond mot aktier i en aktieserie i euro i samma delfond. 
Fallet CSN:2017/53 gällde en situation där den sökande A hade för avsikt att byta fondandelarna i den danska placeringsfonden X till fondandelar i en ny andelsklass som skulle inrättas i samma placeringsfond jämsides med den befintliga andelsklassen. Inget arvode togs ut för bytet av andelsklass, och det kapital som A hade placerat i fonden förändrades inte. Andelarna byttes från en andelsklass till en annan i samma placeringsfond, och A fick vid bytet fondandelar till samma värde i den nya andelsklassen, som beskrivits i ansökan. Andelarna berättigade till samma tillgångar i samma placeringsfond som de andelar som A hade ägt före bytet. CSN ansåg att det i ansökan beskrivna bytet av andelar i placeringsfonden X vid beskattningen av A inte var sådan överlåtelse som avses i 45 § i inkomstskattelagen. Det saknade betydelse att den nya andelsklassen enligt ansökan åtminstone tills vidare var avsedd enbart för kunder som anlitade diskretionär kapitalförvaltning erbjuden av värdepappersföretag hörande till koncernen B. 
1.8
Investeringar i placeringsfonder i Finland och utomlands
De allmänt skattskyldigas innehav i inhemska och utländska placeringsfonder 2017 har inventerats med stöd av uppgifter från Skatteförvaltningen. År 2017 ägde cirka 1 140 000 personer andelar i inhemska placeringsfonder och specialplaceringsfonder, medan 140 000 personer ägde andelar i utländska fonder. Sammanlagt hade 1 200 000 personer innehav i placeringsfonder. 
De allmänt skattskyldiga hade fondandelar i cirka 410 inhemska placeringsfonder. Av dem delade 294 ut vinst. Antalet specialplaceringsfonder var 107 och 42 av dem delade ut vinst. Placeringsfondernas sammanlagda utdelning uppgick till cirka 92 miljoner euro och specialplaceringsfondernas till cirka 78 miljoner euro. De utländska fonderna delade ut cirka 47 miljoner euro till allmänt skattskyldiga. Antalet utländska fonder är inte känt. Av de 42 finländska specialplaceringsfonder som delade ut vinst hade 37 fler än 50 andelsägare. Två av dem hade 11—50 andelsägare och tre hade 1—10 andelsägare. Inhemska specialplaceringsfonderna med färre än 50 andelsägare är i likhet med specialplaceringsfonder som i huvudsak investerar i fastigheter skyldiga att dela ut minst tre fjärdedelar av räkenskapsperiodens vinst till andelsägarna. Enligt uppgift från Suomen Sijoitustutkimus finns det inga inhemska specialplaceringsfonder med endast en andelsägare. 
Fondandelar löstes år 2017 in till ett värde av cirka 22 miljarder euro, inklusive bolagens inlösningar. Fysiska personer fick cirka två miljarder euro i överlåtelsevinst och mindre än 100 miljoner euro i överlåtelseförlust. Andelar i inhemska specialplaceringsfonder löstes år 2017 in till ett värde av cirka 1,6 miljarder euro. Inlösningarna gav cirka 150 miljoner euro i överlåtelsevinst och mindre än 20 miljoner euro i överlåtelseförlust. 
Sparandet i finländska placeringsfonder har också inventerats med hjälp av Finlands Banks statistik över placeringsfonder. Kapitalet i de finländska placeringsfonderna och specialplaceringsfonderna har ökat avsevärt under de senaste åren. 
Kapital i placeringsfonder (februari 2018) 
Utvecklingen för nettoteckningar anges i figuren nedan. 
Utveckling för nettoteckningar (februari 2018) 
Enligt Finlands Banks statistik uppgick det sammanlagda kapitalet i finländska placeringsfonder, inklusive specialplaceringsfonder, i början av 2009 till 41,4 miljarder euro. I slutet av 2017 var kapitalet 120,1 miljarder euro, vilket är en ökning på nästan 80 miljarder euro. Hushållens sparande i placeringsfonder var i september 2018 cirka 22,6 miljarder euro. Enligt en studie publicerad av Finanssiala ry den 8 juni 2017 har placeringarna i fonder och börsaktier ökat klart sedan våren 2015. Enligt studien är fondsparande den näst populäraste sparformen efter bankdepositioner. Enligt Skatteförvaltningens uppgifter äger cirka 1,2 miljoner personer i Finland andelar i (inhemska eller utländska) placeringsfonder. Det är många om man jämför med exempelvis aktieplaceringar. Enligt börsstiftelsens statistik ägde cirka 800 000 privatpersoner i Finland aktier i slutet av september 2017. 
Finlands Banks statistik över placeringsfonder visar att de finländska försäkringsinrättningarnas innehav i finländska placeringsfonder har ökat något. I början av 2009 var innehavet cirka 22,6 procent, medan det i september 2018 var cirka 24,7 procent. Åren 2014 och 2015 var innehavet uppe i litet över 26 procent. En betydande del av försäkringsbolagens fondplaceringar anknyter särskilt till försäkringsfonder samt kapitaliseringsavtal. De fondplaceringar som görs i dessa utgör indirekt tillgångar som hör till hushållen och de andra försäkringstagarna. Dessutom står placeringsfondernas inbördes placeringar (fondandelsfonder) för 17,5 procent av det sammanräknade kapitalet i placeringsfonderna, enligt arbetsgruppen för utvärdering av skattebehandlingen av olika investeringsformer. De indirekta placeringarna utgör således nästan hälften av det totala kapitalet i placeringsfonderna. Ägarna till fondandelsfonderna är ofta andra placeringsfonder som förvaltas av samma fondbolag, och syftet är att effektivisera och förenkla fondförvaltningen. Vid sidan av försäkringsinrättningarna, andra placeringsfonder och hushållen utgör de svenska investerarna en stor grupp med cirka 17,1 procent av innehavet i september 2018. Dessa fyra stora investerargrupper äger cirka 80 procent av fondandelarna i de finländska placeringsfonderna. Det övriga euroområdet står för cirka 2,6 procent av innehavet i de finländska placeringsfonderna, medan utlandet i övrigt (exkl. euroområdet och Sverige) står för cirka 1,7 procent. 
Fondkapital, fördelning per ägarsektor 31.12.2017 
Fondkapital, fördelning enligt fondtyp 
Enligt den värdepappersstatistik som den nämnda arbetsgruppen för utvärdering av skattebehandlingen erhöll av Finlands Bank minskade specialplaceringsfondernas andel av det totala kapitalet i de inhemska placeringsfonderna betydligt för några år sedan (i slutet av mars 2012 var andelen ännu 14 procent, men i slutet av december 2013 var andelen endast 8 procent). Det berodde på att fondbolagen beredde sig på att AIFM-lagen skulle träda i kraft. Sedan dess har specialplaceringsfondernas andel av placeringsfondernas totala kapital ökat något såväl relativt som i absoluta tal: i slutet av december 2016 var andelen 10,7 procent (11,55 miljarder euro) och i slutet av augusti 2017 var andelen 11,3 procent (13,26 miljarder euro). Kapitalet har ökat relativt kraftigt särskilt i specialplaceringsfonder som investerar i fastigheter och fastighetsvärdepapper, vilket bland annat beror på att regleringen av dessa fonder är mer liberal än regleringen av placeringsfonder. Också andra alternativa investeringsfonder har fått ökad betydelse. 
Enligt Finlands Bank uppgick de från Finland utgående placeringarna i utländska juridiska konstruktioner för kollektiva investeringar till 130 miljarder euro i slutet av september 2018. De främsta placeringsländerna var Irland, Luxemburg och Förenta staterna (100 miljarder euro). Enligt Finlands Banks värdepappersstatistik är de följande fem största placeringsländerna Caymanöarna, Storbritannien, Sverige, Danmark och Tyskland. Statistiken omfattar vid sidan av placeringsfonder också exempelvis AIF-fonder i kommanditbolagsform. Arbetspensionsanstalterna, som sköter de lagstadgade arbetspensionsförsäkringarna, är den största investerargruppen i utländska fondkonstruktioner (92 miljarder euro). Det är alltså huvudsakligen fråga om institutionella investerares placeringar. Hushållens direkta fondplaceringar från Finland till utlandet uppgår endast till cirka två miljarder euro, men försäkringsanstalternas andel på 11 miljarder euro kan också innehålla indirekta fondplaceringar gjorda av hushåll. 
1.9
EU-rätten
1.9.1 Allmänt 
FEUF påverkar den direkta beskattningen genom de grundläggande friheterna och reglerna om statligt stöd. De grundläggande friheter som tryggas i FEUF är fri rörlighet för arbetstagare, etableringsfrihet, frihet att tillhandahålla tjänster och fri rörlighet för kapital. Med stöd av EES-avtalet gäller de grundläggande friheterna enligt FEUF i tillämpliga delar också i EES-staterna. 
Artikel 49 i FEUF förbjuder inskränkningar för medborgare i en medlemsstat att fritt etablera sig på en annan medlemsstats territorium och likaså inskränkningar för medborgare i en medlemsstat som är etablerad i någon medlemsstat att upprätta kontor, filialer eller dotterbolag. 
Enligt den grundläggande principen i artikel 63 i FEUF är alla restriktioner för kapitalrörelser mellan medlemsstater samt mellan medlemsstater och tredjeland förbjudna. Bestämmelsen tillämpas också på personer med hemvist någon annanstans än i en medlemsstat i EU eller en EES-stat. Den omfattar alltså också boende i så kallade tredjeländer. 
EU-rättens företräde framför den nationella lagstiftningen hindrar medlemsstaterna från att exempelvis stifta lagar som står i konflikt med EU-rätten. Nationell lagstiftning och skatteavtal ska tillämpas och tolkas i enlighet med EU-rättens krav. EUD:s rättspraxis är av stor betydelse vid tolkningen av EU-rätten. 
1.9.2 Fri rörlighet för kapital 
Den främsta grundläggande friheten när det gäller beskattningen av utländska placeringsfonder är den fria rörligheten för kapital. De olika grundläggande friheterna kan ha delvis överlappande tillämpningsområden. Exempelvis kan också principen om etableringsfrihet enligt artikel 49 i FEUF, som tillämpas enbart mellan medlemsstater, bli tillämplig på källbeskattning av vinstutdelning. 
Enligt EUD:s rättspraxis kan restriktioner för kapitalrörelser vara exempelvis åtgärder som leder till att personer bosatta i en annan stat blir mindre villiga att investera i vissa medlemsstater. Att till exempel beskatta vinstutdelning olika för begränsat och allmänt skattskyldiga kan utgöra en restriktion för den fria rörligheten för kapital. 
En restriktion av kapitalrörelser kan likväl vara godtagbar enligt EU-rätten. Enligt EUD:s rättspraxis kan det vara tillåtet att ha olika beskattning för inhemska respektive gränsöverskridande situationer, om det gäller situationer som vid en objektiv bedömning inte kan jämställas med varandra, eller om olika behandling är berättigad av tvingande skäl som anknyter till allmänintresset, varvid det finns legitim grund för särbehandlingen. Legitima grunder enligt EUD:s rättspraxis är exempelvis säkerställande av effektiv skattetillsyn, förhindrande av kringgående av skatt och säkerställande av ett sammanhängande skattesystem. 
Grunder som legitimerar en restriktion av kapitalrörelser kan i ljuset av EUD:s rättspraxis lättare godtas i fråga om tredjeländer. Det kan till exempel grunda sig på att den internationella handräckningen är annorlunda mellan medlemsstater än mellan en medlemsstat och ett tredjeland. Restriktionen ska likväl alltid vara förenlig med proportionalitetsprincipen och får alltså inte överskrida vad som behövs för att uppnå de mål som bestämmelserna syftar till. 
1.9.3 Europeiska unionens domstols rättspraxis 
Målet C-303/07, Aberdeen Property Fininvest Alpha, gällde en placeringsfond i SICAV-form som inte omfattades av fondföretagsdirektivet och till fullo ägde det finländska bolag som delade ut vinst. Dåvarande Europeiska gemenskapernas domstol ansåg i sin dom av den 18 juni 2009 att debitering av källskatt för vinstutdelning till utlandet stred mot EU-rätten, eftersom motsvarande vinstutdelning var befriad från skatt i utdelningsmottagarens hemland. Domstolen jämställde SICAV-bolaget med ett finländskt aktiebolag. Enligt domstolen hade SICAV-bolagets skattefrihet eller beskattningen av placerarna ingen betydelse för den finländska skatterätten i en situation där finländska samfund som motsvarar SICAV-bolag är befriade från skatt på vinstutdelning. Domstolen ansåg att det i fråga om källbeskattningen av vinstutdelningen inte fanns någon objektiv skillnad mellan SICAV-bolag och finländska aktiebolag, så det fanns inget behov av att i målet ytterligare utreda jämförbarheten med finländska placeringsfonder. Det fanns inte heller någon legitim grund som kunde tillämpas på situationen. Finsk lagstiftning begränsade alltså etableringsfriheten. 
Både i de förenade målen C-338/11–C-347/11, Santander Asset Management, som gällde källbeskattningen i Frankrike, och målet C‑190/12, Emerging Markets Series of DFA Investment Trust Company, som gällde källbeskattningen i Polen, ansågs att källstaters källbeskattning av dividend stred mot artikel 63 i FEUF, eftersom utländska placeringsfonder som objektivt sett var i en jämförbar situation försattes i en sämre skattemässig ställning än inhemska placeringsfonder. 
I fallet C-338/11–C-347/11, Santander Asset Management, konstaterade EUD att den franska regleringen innehöll en grund för åtskillnad som baserades på var fondföretaget har sin hemvist, eftersom källskatt på utdelning endast tillämpades på fondföretag med hemvist i utlandet. Den skattefrihet som gällde för fondföretag med hemvist i Frankrike förutsatte inte att andelsägarna betalar skatt på utdelningen. Enligt EUD ska bedömningen av huruvida situationerna är jämförbara ske på fondföretagens nivå, och den skattemässiga situationen för andelsägarna ska inte beaktas. 
Enligt EUD var lagstiftningen i Polen i fallet C-190/12, Emerging Markets Series of DFA Investment Trust Company, liknande, det vill säga att den grund för åtskillnad som föreskrevs i skattelagstiftningen endast baserade sig på var placeringsfonden hade sin hemvist. Fallet gällde placeringsfonder med hemvist i Förenta staterna. EUD ansåg att den omständigheten att de ifrågavarande fonderna inte var sådana fonder som avses i UCITS-direktivet inte i sig var tillräckligt för att situationerna för de nämnda fonderna skulle anses vara olika. Ett krav på en identisk reglering skulle leda till att den ändamålsenliga verkan med den fria rörligheten för kapital gick förlorad. Enligt EUD var situationerna objektivt sett jämförbara. I avgörandet bedömdes också huruvida det förelåg tvingande skäl av allmänintresse. I fråga om vilken betydelse som med avseende på skattekontrollen ska tillämpas det faktum att fondföretagsdirektivet och det system för informationsutbyte som det avtalas om i direktivet inte tillämpas på tredjeländer, konstaterade EUD att det system för informationsutbyte som införts genom fondföretagsdirektivet inte är förenat med några skatterättsliga aspekter. Att fondföretagsdirektivets system för informationsutbyte inte var tillämpligt kunde således inte motivera en avvikande skattemässig behandling. 
EUD konstaterade vidare att motiveringen att det finns ett behov av att bibehålla en effektiv skattekontroll endast kan åberopas när det i lagstiftningen i en medlemsstat uppställs vissa villkor för att en skattefördel ska beviljas, och en kontroll av huruvida dessa villkor är uppfyllda endast kan ske genom att upplysningar inhämtas från myndigheterna i ett tredjeland, samt om det visar sig omöjligt att få tillgång till dessa upplysningar från nämnda myndigheter, särskilt på grund av att det inte finns någon avtalsmässig skyldighet för myndigheterna i tredjeland att lämna ut dem. Det hade mellan Polen och Förenta staterna inrättats en rättslig ram för ömsesidigt administrativt bistånd som möjliggjorde ett utbyte av den information som behövdes för tillämpningen av skattelagstiftningen. EUD bedömde också huruvida behovet av att upprätthålla skattesystemets inre sammanhang, fördelningen av beskattningsrätten och behovet av att slå vakt om skatteintäkterna utgjorde legitima grunder. EUD ansåg att så inte var fallet. 
Enligt EUD utgjorde den fria rörligheten för kapital sålunda ett hinder för en sådan skattelagstiftning i Polen enligt vilken undantagande från skatt inte omfattar utdelning som bolag med hemvist i den medlemsstaten lämnar till en investeringsfond belägen i tredjeland, i den mån det mellan denna medlemsstat och det ifrågavarande tredjelandet föreligger en avtalad skyldighet avseende ömsesidigt administrativt bistånd som ger de nationella skattemyndigheterna möjlighet att kontrollera de uppgifter som investeringsfonden eventuellt överlämnat. Enligt EUD ankom det på den hänskjutande domstolen att inom ramen för det nationella målet pröva om den mekanism för informationsutbyte som föreskrivs inom denna ram för samarbete verkligen kan ge de polska skattemyndigheterna möjlighet att i förekommande fall pröva den information som investeringsfonder med hemvist i Amerikas förenta stater har tillhandahållit avseende villkoren för bildande och bedrivande av deras verksamheter, i syfte att fastställa om de är verksamma inom en lagstiftningsram som är likvärdig med den unionsrättsliga lagstiftningsramen. 
Det senaste fallet, C-480/16, Fidelity Funds mot Skatteministeriet, gällde källbeskattning i Danmark. I Danmark tas källskatt inte ut på dividend till inhemska investeringsfonder som delas ut i Danmark, i det fall att fonden, faktiskt eller kalkylmässigt, lämnar en viss minimiutdelning till sina andelsinnehavare och källskatt innehålls på utdelningen. Danska investeringsfonder som inte lämnar utdelning är inte befriade från att betala källskatt på dividend. Befrielse från källskatt var inte heller möjlig för utländska fondföretag. EUD ansåg i sin dom att det ifrågavarande danska skattesystemet stred mot EU-rätten, eftersom det inskränkte den fria rörligheten för kapital. Enligt domen kunde den i det danska skattesystemet ingående inskränkningen av kapitalrörelser i princip vara motiverad för att säkerställa skattesystemets inre sammanhang, eftersom strävan var att i beskattningen av andelsinnehavarna kompensera för befrielsen från källskatt (punkt 82—83 i domen). Restriktionen stred likväl mot proportionalitetsprincipen, det vill säga att den var mer omfattande än vad som behövdes för att nå målet med bestämmelserna. Enligt EUD kunde skattesystemets inre sammanhang bibehållas om fondföretag med hemvist i en annan medlemsstat gavs samma möjlighet till utdelning som fondföretag med hemvist i Danmark (punkt 84—85 i domen). Det danska systemet kunde därför inte anses vara förenligt med EU-rätten (punkt 86 i domen). 
Av generaladvokatens förslag till avgörande framgår att de utländska fondföretagen hade åberopat att bedömningen av huruvida situationen för ekonomiska aktörer är jämförbar grundar sig på tillämpningsområdet för UCITS-direktivet. Generaladvokaten ansåg att det avgörande var fondföretagens situation mot bakgrund av den aktuella skattelagstiftningen; fondföretagens ställning är inte av betydelse, såvida inte ställningen utgör ett åtskillnadskriterium i den tillämpliga skattelagstiftningen (punkt 44 i förslaget till avgörande). Också EUD granskade jämförbarheten mot bakgrund av skattelagstiftningen (punkt 49—63i domen). 
1.10
EU:s regler för statligt stöd
Enligt artikel 107.1 i FEUF är stöd som ges av en medlemsstat eller med hjälp av statliga medel, av vilket slag det än är, som snedvrider eller hotar att snedvrida konkurrensen genom att gynna vissa företag eller viss produktion, oförenligt med den inre marknaden i den utsträckning det påverkar handeln mellan medlemsstaterna. Den främsta grunden för att tillämpa reglerna för statligt stöd på en beskattningsåtgärd är att åtgärden ger upphov till en avvikelse från det allmänna skattesystemet till förmån för vissa företag i medlemsstaterna. Det statliga stödet kan alltså utgöras av exempelvis en lägre skattesats, ett särskilt avdrag i beskattningen eller skattefrihet för en bestämd inkomst. 
Kommissionen lämnade den 19 maj 2016 ett tillkännagivande om begreppet statligt stöd som avses i artikel 107.1 i FEUF (kommissionens tillkännagivande eller tillkännagivandet). I tillkännagivandet klargörs de olika beståndsdelar som utgör begreppet statligt stöd: existensen av ett företag, att åtgärden kan tillskrivas staten, dess finansiering genom statliga medel, beviljandet av en fördel, åtgärdens selektivitet och dess eventuella inverkan på konkurrens och handel mellan medlemsstaterna. 
I tillkännagivandet tar kommissionen också ställning till hur åtgärder som gäller placeringsverksamhet ska bedömas med avseende reglerna för statligt stöd. Enligt tillkännagivandet bör investeringsbolag, till exempel företag för kollektiva investeringar, vara föremål för en lämplig beskattningsnivå, eftersom de i huvudsak fungerar som förmedlande organ mellan (tredjeparts)investerare och de målföretag i vilka investeringarna görs. Avsaknaden av särskilda skatteregler för investeringsfonder eller investeringsbolag kan leda till att en investeringsfond behandlas som en separat skattebetalare, varvid det införs ytterligare ett skatteskikt för alla de inkomster och all den vinst som det förmedlande instrumentet eventuellt genererar. I detta sammanhang strävar medlemsstaterna i regel efter att minska de negativa skatteeffekterna på investeringar som sker genom investeringsfonder/investeringsbolag jämfört med direktinvesteringar som görs av enskilda investerare och, i möjligaste mån, att se till att det totala skattetrycket på korgen av olika typer av investeringar är ungefär detsamma, oberoende av vilket verktyg som används för investeringen. 
I tillkännagivandet sägs vidare att skatteåtgärder som syftar till att säkerställa skatteneutralitet för investeringar i kollektiva investeringsfonder/investeringsbolag inte bör betraktas som selektiva, om dessa åtgärder inte leder till att vissa företag för kollektiva investeringar eller vissa typer av investeringar gynnas, utan snarare till att den dubbla ekonomiska beskattningen minskas eller elimineras i enlighet med de allmänna principer som finns inbyggda i skattesystemet i fråga. Här avses med skatteneutralitet att skattebetalare behandlas på samma sätt oavsett om de investerar i tillgångar, såsom statliga värdepapper och aktier i aktiebolag, direkt eller indirekt via investeringsfonder. En skatteordning för företag för kollektiva investeringar som respekterar syftet med skattetransparens på det förmedlande instrumentets nivå kan därför vara motiverad av logiken i skattesystemet i fråga, förutsatt att förhindrandet av dubbel ekonomisk beskattning utgör en princip som är ett bärande inslag i skattesystemet i fråga. 
Däremot bör en skattemässigt förmånlig behandling som är begränsad till väl avgränsade investeringsinstrument som uppfyller särskilda villkor till nackdel för andra investeringsinstrument som befinner sig i en jämförbar rättslig och faktisk situation betraktas som selektiv. Det gäller exempelvis om skattereglerna möjliggör en gynnsam behandling av nationella riskkapitalfonder, fonder för sociala effekter eller långsiktiga investeringsfonder och utelämnar EU-harmoniserade EuVECA-, EuSEF- eller ELTIF-fonder. 
Enligt tillkännagivandet betyder skatteneutralitet emellertid inte att sådana investeringsinstrument bör vara helt befriade från skatt eller att fondförvaltarna bör vara befriade från skatt på de avgifter som de tar ut för förvaltningen av de underliggande tillgångar som fonderna investerar i. Den berättigar inte heller att en kollektiv investering behandlas förmånligare i skattemässigt hänseende än en enskild investering med avseende på de berörda skatteordningarna. I sådana fall skulle skatteordningen vara oproportionerlig och gå utöver vad som är nödvändigt för att nå målet att förhindra dubbelbeskattning och därför utgöra en selektiv åtgärd. 
Kommissionen tillkännagivande är från 2016 och det har ännu inte utformats någon rättspraxis om dess tillämpning på de olika medlemsstaternas skattesystem i fråga om placeringsfonder. I utländsk rättslitteratur har det dock anförts att skattebehandlingen av tillväxtfonder, det vill säga i praktiken skatteuppskov, kan vara problematisk med avseende på EU-reglerna för statligt stöd, i det fall att samma skattebehandling inte tillåts också för direkta investeringar (Prof. Luja, Dr Raymond H.C., Do State Aid Rules Still Allow European Union Member States to Claim Fiscal Sovereignty?, EC Tax Review 2016–5-6). 
1.11
Om beskattningen av placeringsfonder i vissa länder
1.11.1 Sverige 
Nuläge 
I den svenska lagstiftningen indelas placeringsfonderna i värdepappersfonder enligt fondföretagsdirektivet och specialfonder som inte omfattas av fondföretagsdirektivet utan av AIFM-direktivet. I Sverige är alla placeringsfonder till sin juridiska form kontraktuella (avtalsbaserade) och utgör inte separata juridiska personer. Investeringsfondens medel förvaltas av ett separat fondbolag i aktiebolagsform. Fondandelarna kan vara antingen avkastningsandelar eller tillväxtandelar. 
I skattelagstiftningen är placeringsfonderna separata skattskyldiga som med stöd av en särskild bestämmelse dock är befriade från inkomstskatt. Enligt bestämmelser som trädde i kraft vid ingången av 2012 är svenska investeringsfonder befriade från skatt, och beskattningen av fondverksamheten gäller endast delägarna. 
I Sverige beskattas normalt 0,4 procent per år av en skattskyldig delägares andelar i fondens tillgångar (schablonintäkt) som skattepliktig kapitalinkomst (skattesats 30 procent). Om delägaren är ett samfund, beskattas samma inkomst med skattesatsen för bolagsskatt. Värdet av delägarens andel i fonden bestäms enligt situationen vid ingången av kalenderåret. Beskattningen tillämpas på såväl svenska som utländska fonder. För allmänt skattskyldiga i Sverige uppstår samma skattepliktiga kapitalinkomst (schablonintäkt) på grundval av innehav i utländska placeringsfonder. Till en svensk placerares kapitalinkomster räknas andelar i exempelvis en finländsk placeringsfonds tillgångar. Däremot uppstår inte skattepliktig inkomst i Sverige på den här grunden för begränsat skattskyldiga delägare i svenska investeringsfonder. En finländsk placerare är alltså till den här delen inte skattskyldig för sin placering i en svensk fond. 
Avkastningen från fonden och överlåtelsevinsten vid inlösen av fondandelar är på normalt vis skattepliktig inkomst för delägaren. 
Sedan ingången av 2012 tas i Sverige inte källskatt ut heller på utdelning från en utländsk fond som motsvarar en svensk värdepappers- eller specialfond. En förutsättning för befrielse från källskatt är dessutom att fonden har sin hemvist i EES-området eller i en stat med vilken Sverige har ett skatteavtal som innefattar en artikel om informationsutbyte eller ett avtal om informationsutbyte. De svenska skattemyndigheterna har utfärdat en lång anvisning i frågan. 
Om motiven till ändringen av 2012 
Före 2012 var svenska investeringsfonder i princip normalt skattskyldiga samfund. De hade dock rätt att i beskattningen dra av den avkastning som betalats till investerarna. Investeringsfondens effektiva beskattningsbara inkomst var därmed i praktiken noll. Till den beskattningsbara inkomsten lades dock alltid 1,5 procent av värdet av de medel fonden förvaltade. 
I praktiken hade skatteregleringen lett till att svenska investeringsfonder varje år delade ut hela avkastningen till delägarna. När beskattningen ändrades 2012, konstaterades det i förarbetena till lagen att de svenska fonderna sannolikt kommer att upphöra med den årliga utdelningen. Som motvikt till de minskande skatteintäkterna från utdelningen infördes en schablonintäkt, det vill säga en schablonmässig, kalkylerad intäkt baserad på avkastningen. Enligt förarbetena till lagen ska schablonbeskattningen tillämpas också på utländska fonder, eftersom beskattningen ur ett svenskt investerarperspektiv inte får vara annorlunda beroende på om fonden är svensk eller utländsk. Hur utländsk investeringsfond ska definieras överlämnades till rättspraxis. 
I förarbetena till lagändringen konstaterades det också att skattefriheten för fonderna kan leda till att de inte längre betraktas som personer som omfattas av skatteavtalens tillämpningsområde. Enligt förarbetena kan skattefriheten dessutom leda till dubbelbeskattning, eftersom fonderna i sin egen beskattning inte kan kompensera för källskatt som tas ut utomlands. Under remissfasen framfördes krav på att delägarna ska ges rätt att i sin egen beskattning dra av den skatt som fonden betalar. Det ansågs dock inte möjligt till följd av de praktiska svårigheter det skulle ha medfört. Enligt förarbetena beaktades denna omständighet i bestämmelserna om beräkning av schablonintäkten. 
Enligt förarbetena har delägarna efter reformen inte längre möjlighet att begära kompensation eller avräkning för den källskatt fonden betalat utomlands. Ur ett fiskalt perspektiv motsvarar dessa skatteintäkter det skattebortfall som uppstår vid slopandet av källskatt för utländska investeringsfonder. Att slopa källskatten för utländska investeringsfonden ansågs vara nödvändigt av EU-rättsliga skäl. 
De svenska investeringsfonderna och skatteavtalen 
Efter lagändringen 2012 intog de svenska skattemyndigheterna den ståndpunkten att svenska investeringsfonder inte är personer som omfattas av skatteavtalens tillämpningsområde, eftersom de inte betalar skatt (villkoret subject to tax uppfylls inte). Skattemyndigheterna ansåg därför att fonderna inte kan beviljas så kallat hemvistintyg. Hemvistintyget utfärdas av skattemyndigheterna och visar vilken stat som är inkomsttagarens skatterättsliga hemviststat. I regel lämnas hemvistintyget till källstaten för inkomsten för att påvisa att förutsättningarna för tillämpning av ett visst skatteavtal uppfylls. 
Högsta förvaltningsdomstolen (HFD) i Sverige ansåg dock i ett avgörande av den 15 april 2016 (nr 2268-15), att en svensk värdepappersfond hade hemvist i Sverige i enlighet med skatteavtalet mellan Sverige och Spanien och att fonden därför ska beviljas hemvistintyg. 
Efter HFD:s avgörande utfärdade skattemyndigheterna en uppdaterad anvisning, enligt vilken utfärdande av hemvistintyg är beroende av skatteavtalet och dess förarbeten. Om det i skatteavtalet eller dess förarbeten inte finns något uttryckligt omnämnande av fonder eller av vilken skattskyldighet som krävs av personen, kan hemvistintyg utfärdas. De svenska skattemyndigheternas ståndpunkt är dock fortfarande att hemvistintyg i princip inte kan utfärdas för placeringsfonder. 
1.11.2 Norge 
I Norge får fondföretag enligt fondföretagsdirektivet bildas enbart som avtalsbaserade placeringsfonder. Norge följer fondföretagsdirektivet med stöd av EES-avtalet. En placeringsfond är en separat juridisk person och fondens medel förvaltas av ett separat fondbolag i aktiebolagsform. Bolaget ska ha verksamhetstillstånd av den lokala tillsynsmyndigheten. Fondandelarna kan vara antingen avkastningsandelar eller tillväxtandelar. 
Den nya skattelagstiftning som trädde i kraft vid ingången av 2016 raderade den uppdelning som vid beskattningen tidigare gjordes mellan aktiefonder (aksjefond) och obligationsfonder (obligasjonsfond). Enligt de gamla bestämmelserna kunde en fond anses vara en aktiefond om den ägde åtminstone en aktie, och aktie- och obligationsfonderna beskattades på olika sätt. Enligt den gällande skattelagstiftningen är värdepappersfonderna (verdipapirfond) fortfarande separata skattskyldiga, som omfattas av den normala bolagsskattesatsen på 24 procent och av andra bestämmelser om beskattning av samfund. De bestämmelser om skattefrihet för utdelning (fritaksmetoden) som tidigare tillämpades enbart på aktiefonder tillämpas i dag på alla värdepappersfonder. Dessutom är värdepappersfonderna befriade från skatt på överlåtelsevinster från länder utanför EES-området och motsvarande överlåtelseförluster är inte avdragbara i beskattningen. Ränteinkomster är i regel beskattningsbara. Värdepappersfonderna har rätt att i beskattningen dra av den vinst de delar ut, om vinsten betraktas som beskattningsbar ränteinkomst i placerarens beskattning. 
Beskattningen av andelsägarna grundar sig på en schablonmässig klassificering utifrån fondens förvaltningskapital. Om mer än 80 procent av fondens förvaltningskapital består av aktier, betraktas alla inkomster som delägaren får av fonden som utdelningsinkomster. Om aktierna utgör mindre än 20 procent betraktas inkomsterna i stället som ränteinkomster. Inkomsterna från en fond där aktiernas andel ligger någonstans mellan 20 och 80 procent, fördelar sig på andelsägarens utdelnings- och ränteinkomster i proportion till placeringarna. Utdelning från värdepappersfonder och överlåtelsevinst på fondandelar är beskattningsbar kapitalinkomst för fysiska personer. För delägare i bolagsform kan utdelningsinkomst vara skattefri. 
1.11.3 Danmark 
I Danmark regleras fondverksamhet i en lag om investeringsfonder och specialfonder (Lov om investeringsforeninger og specialforeninger). De danska fonderna är till sin konstruktion bolag i föreningsform och fondandelarna är i regel föremål för handel på börsen. 
Beskattningen av fonder beror bland annat på om fonden utfärdar andelsbevis till delägarna. Fonder som inte utfärdar andelsbevis (kontoførende investeringsforening) är skattemässigt transparenta såtillvida att delägarna beskattas i proportion till deras andel av fondens inkomster. 
Allmänheten erbjuds dock nästan enbart fonder som utfärdar andelsbevis (bevisudstedende investeringsforeninger). Fonden är då en separat skattskyldig, men befriad från skatt på placeringsverksamheten i det fall att den till skattemyndigheterna anmäler att den följer bestämmelserna om minimiutdelning (minimumsbeskattede). Minimiavkastningen beskattas som kapitalinkomst för delägaren under skatteåret, även om avkastningen de facto inte delas ut. 
Om en fond som utfärdar andelsbevis inte följer bestämmelserna om minimiutdelning utan närmast utgör en tillväxtfond (akkumulerende), beskattas den typiskt som danska placeringsbolag. Enligt skattereglerna för danska placeringsbolag ska de betala slutlig källskatt på den utdelning de får, men är i övrigt befriade från skatt. Det finns dock vissa villkor för detta. Om villkoren inte uppfylls beskattas fonden som ett vanligt bolag. 
1.11.4 Storbritannien 
I Storbritannien är placeringsfonderna antingen auktoriserade eller oauktoriserade. Auktoriserade placeringsfonder är fondföretag enligt fondföretagsdirektivet. Fondandelarna kan marknadsföras hos alla placerare. Fondföretag enligt fondföretagsdirektivet kan vara i trustform (authorised unit trusts, AUT) eller fonder i bolagsform med rörligt kapital (open-ended investment companies, OEIC). En OEIC-fond kan också kallas ICVC (Investment Company with Variable Capital). Sedan 2013 har man i Storbritannien dessutom kunnat bilda avtalsbaserade fonder (authorised contractual schemes, ACS). En fond i ACS-form är dock förknippad med villkor som gäller bland annat placeraren. 
Unit trusts bygger på trustbegreppet, som grundar sig på dubbel äganderätt. Den förvaltare (trustee) som förvaltar tillgångarna för ägarens räkning betraktas som ägare med ansvar för förvaltningen av tillgångarna. Delägarens rätt begränsar sig till den ekonomiska vinning som andelen ger. En OEIC-fond inrättas med stöd av speciallagstiftning om fonder med rörligt kapital. ACS-fonder är avtalsbaserade och utgör inte separata juridiska personer. 
I Storbritannien beskattas AUT- och OEIC-fonder i regel på samma sätt som bolag. Samfundsskattesatsen är 20 procent. Placeringsfonderna är dock befriade från skatt på överlåtelsevinst. I likhet med andra bolag är placeringsfonderna inte heller skattepliktiga för den utdelning de får. Ränteinkomster är i princip beskattningsbar inkomst för fonder. Räntefonder som uppfyller vissa villkor kan dock i beskattningen dra av den vinst de delar ut till delägarna. AUT- och OEIC-fonder betraktas i beskattningen ha delat ut hela avkastningen till delägarna, oberoende av om avkastningen verkligen har betalats ut eller inte. Avkastning från fonden och överlåtelsevinst vid avyttring av fondandelar är beskattningsbar inkomst för delägarna. 
ACS-fonder är skattemässigt transparenta. Andelsägarna beskattas för sin andel i fondens inkomster på samma sätt som om de hade ägt placeringsobjektet direkt. 
1.11.5 Irland 
I Irland kan fondföretag enligt fondföretagsdirektivet vara fonder i trustform (unit trusts) eller i form av bolag med rörligt kapital (variable capital investment companies, VCC, incorporated as public limited companies, PLC). Sedan 2015 kan placeringsfonder dessutom bildas som ICAV-bolag (Irish collective asset management vehicle). För en viss typ av placerare kan man också bilda avtalsbaserade fonder (common contractual funds, CCF). Alla fonder utom unit trust-fonder är separata juridiska personer enligt irländsk lagstiftning. 
Av de nämnda formerna betraktas alla andra utom CCF-fonderna som separata skattskyldiga. De är dock på fondnivå befriade från skatt på avkastningen av placeringsverksamheten. Den utdelning eller överlåtelsevinst en inhemsk delägare får av fonden beskattas genom en förskottsskatt (withholding tax) av källskattetyp, som för fysiska personer är 41 procent och för samfund 25 procent. För fysiska personer är skatten slutlig. För samfund är utdelningen belagd med bolagsskatt. Gottgörelse kan beviljas för erlagd förskottsskatt. Utdelning och överlåtelsevinst till utländska delägare är skattefri i Irland. 
CCF-fonder är skattemässigt transparenta. Delägarna beskattas för sin andel i fondens inkomster på samma sätt som om de hade ägt placeringsobjektet direkt. 
1.11.6 Tyskland 
I Tyskland har de fondföretag som omfattas av fondföretagsdirektivet av tradition varit avtalsbaserade fonder (Sondervermögen). De är inte självständiga juridiska personer, och de har ett separat fondbolag. En placeringsfond kan dock också bildas som ett bolag med rörligt kapital (Investmentaktiengesellschaft mit veränderlichem Kapital). 
Avtalsbaserade fonder betraktades länge som i praktiken skattemässigt transparenta, om de uppfyllde vissa lagfästa krav angående information till tillsynsmyndigheten och andelsägarna. Fonderna var då skattefria, och endast andelsägarna beskattades. Om fonden inte uppfyllde de lagfästa kraven, belades andelsägarna med en strängare reglerad straffskatt. Regleringen visade sig dock problematisk bland annat till följd av vissa avgöranden i EUD, och reglerna har nyligen ändrats. 
Den nya lagen om investeringsfonder trädde i kraft vid ingången av 2018. Lagen syftar till att förenkla och lätta upp systemet, som ansetts vara tungrott. Genom den nya lagstiftningen överges principen om skattemässigt transparenta fonder och den omfattande skyldighet att lämna uppgifter som är förknippad med principen. I fortsättningen beskattas placeringsfonder som separata skattskyldiga. De inkomster fonden får är dock i huvudsak skattefria. Endast utdelning från inhemska bolag och vissa fastighetsinkomster påförs en skatt på 15 procent. Den källskatt som inhemska fonder betalar innebär EU-rättsligt en likabehandling av inhemska och utländska fonder. 
Den utdelning och den överlåtelsevinst för fondandelar som andelsägarna får av fonden är i regel beskattningsbar inkomst. För de situationer där placeringsfonden inte delar ut vinst utan fungerar som en så kallad tillväxtfond, har Tyskland genom den nya lagstiftningen infört en årligen beräknad avkastningsbeskattning, där också ett belopp som grundar sig på andelens värde betraktas som beskattningsbar inkomst för andelsägaren. Dock beskattas högst ett belopp som motsvarar placeringsfondens faktiska värdeökning. Den vinst fonden delat ut dras av från fondens beskattningsbara inkomst. 
Andelsägaren har möjlighet att få en del av inkomsterna skattefritt. Det beror bland annat på vilka objekt fonden placerat i. Exempelvis inkomster från aktiefonder kan vara skattefria till 30 procent för fysiska personer. 
Fonder som faller utanför fondföretagsdirektivet (specialplaceringsfonder) kan också enligt den nya lagstiftningen under vissa förutsättningar betraktas som transparenta. Skattebehandlingen har dock undergått stora förändringar jämfört med tidigare lagstiftning. 
1.11.7 Frankrike 
I Frankrike kan fondföretag enligt fondföretagsdirektivet vara avtalsbaserade fonder (Fonds Commun de Placement, FCP) eller aktiebolag med rörligt kapital (Sociétés d'Investissement á Capital Variable, SICAV). En FCP-fond är inte en separat juridisk person, så den ska ha ett separat fondbolag. SICAV-fonderna har bolagsform och bildas i regel som société anonyme (S.A.)
Beskattningen av avkastningsfonder grundar sig i båda fallen på en så neutral beskattning som möjligt. Det betyder att andelsägarna beskattas som om de skulle äga fondens placeringsobjekt direkt (inkomstslaget, till exempel aktieinkomst eller ränteinkomst, är oförändrat). Inkomsterna beskattas inte på fondnivå; SICAV-fonderna utgör separata skattskyldiga, men det har uttryckligen föreskrivits att de är befriade från skatt på inkomster, medan FCP-fonderna i Frankrike betraktas som skattemässigt transparenta och därmed faller utanför inkomstbeskattningen. Andelsägarna beskattas när fonderna delar ut vinst, och andelsägarna kan utnyttja exempelvis skattefrihet för utdelningsinkomster eller andra avdrag. Olika slag av sociala avgifter kan tas ut på utdelningsinkomst. 
Skattefriheten kvarstår om en fond inte delar ut vinst varje år utan fungerar som en tillväxtfond. Andelsägaren påförs skatt för överlåtelsevinst vid tidpunkten för överlåtelse av andelen. Om en fysisk person direkt eller indirekt innehar minst tio procent av en FCP-fond, beskattas fondens inkomster direkt som inkomst för andelsägaren, även om vinsten inte delas ut till denne. 
1.11.8 Luxemburg 
I Luxemburg kan fondföretag enligt fondföretagsdirektivet vara avtalsbaserade fonder (Fonds Commun de Placement, FCP) eller aktiebolag med rörligt eller fast kapital (Société d'investissement á capital variable, SICAV eller Société d'investissement á capital fixe, SICAF). En FCP-fond är inte en separat juridisk person utan en tillgång, så den ska ha ett separat fondbolag. En SICAV/SICAF-fond i bolagsform utgör en separat juridisk person. En SICAV-fond enligt fondföretagsdirektivet kan endast bildas som société anonyme (S.A.)
FCP är skattemässigt transparent i Luxemburg. Det är alltså inkomsterna till andelsägaren som beskattas, och fonden själv är inte inkomstskatteskyldig. I beskattningspraxis i Luxemburg har det dock också godkänts att andelsägarna påförs skatt först på den vinst som delas ut. En FCP-fond kan ha antingen avkastnings- eller tillväxtandelar. FCP-fondens transparens påverkar dock inte skyldigheten att erlägga vissa registreringsavgifter eller lagstadgad teckningsskatt (taxe d'abonnement), som är en slags förmögenhetsskatt. Teckningsskatten är i regel 0,05 procent och debiteras varje kvartal på grundval av fondens nettoförmögenhet. 
Enligt lagstiftningen i Luxemburg är SICAV separata skattskyldiga, men är inte belagda med andra skatter än den nämnda teckningsskatten. S.A.-bolag som inte har SICAV-status och saknar särskilt föreskriven skattefrihet är på normalt vis skyldiga att erlägga skatt på sina inkomster. En SICAV-fond är ett inkomstskattebefriat samfund oberoende av om den har tillväxt- eller avkastningsandelar. 
Den utdelning och den överlåtelsevinst för fondandelar som andelsägarna får av fonden är beskattningsbar inkomst. Skattelagstiftningen i Luxemburg medger dock ett flertal skattelättnader för överlåtelsevinst. Vinstutdelning till begränsat skattskyldiga andelsägare påförs inte källskatt i Luxemburg, och vinst på överlåtelse av fondandelar är inte beskattningsbar inkomst för utländska placerare. 
1.11.9 Förenta staterna 
I Förenta staterna bedrivs den typ av fondverksamhet som regleras i fondföretagsdirektivet av investeringsfonder (mutual funds), vars verksamhet regleras i lagen om investeringsbolag (Investment Company Act of 1940). Mutual funds marknadsförs i regel för en bred allmänhet, men de kan också ha institutionella investerare. Fonderna är öppna, och de ska exempelvis ge placerarna möjlighet att lösa in andelarna varje dag. De kallas också öppna investeringsbolag (open-end investment companies). Lagen om investeringsbolag tillåter också slutna fonder (closed-end). Sådana fonder är typiskt börsnoterade. Såväl öppna som slutna fonder övervakas av finansinspektionen (US Securities and Exchange Commission, SEC). 
Till sin juridiska form kan fonderna vara antingen bolag (corporations) eller truster (statutory trusts, business trusts) och de kan bildas enligt flera olika delstaters lagstiftning (till exempel Massachusetts Business Trust). Fonden är i sig en juridisk person, men den kan ha många olika delfonder som inte är separata juridiska personer. 
Beskattningen av fonder regleras i den allmänna skattelagen (Internal Revenue Code, IRC), enligt vilken fonderna ska uppfylla vissa villkor för att nå en förmånlig skattebehandling. Villkoren ska uppfyllas på delfondsnivå, och fonden kallas då Regulated Investment Company (RIC). För att få RIC-status ska fonden placera minst 90 procent av sina tillgångar i vissa tillåtna placeringsobjekt (good income test) och tillämpa en tillräcklig diversifiering (diversification test). Dessutom ska fonden årligen dela ut minst 90 procent av sin vinst till investerarna (distribution requirement). Vinst som inte delas ut beskattas med normal bolagsskatt. Fonderna delar därför i regel ut hela den årliga vinsten och betalar i praktiken inte skatt i Förenta staterna. Förenta staterna anser att RIC-fonder har rätt till skatteavtalsförmåner. 
För en amerikansk investerare är den vinst fonden delar ut i regel samma slag av normal utdelningsinkomst som den utdelning som ges av ett amerikanskt bolag. Inkomst för försäljning och byte av fondandelar är beskattningsbar överlåtelsevinst för investeraren. Amerikanska placerare kan i vissa fall få partiell gottgörelse för källskatt som fonden betalar utomlands. 
2
Bedömning av nuläget
2.1
Allmänt
Vissa förslag till ändringar i lagstiftningen om placeringsfonder har återverkningar på beskattningen. Det beror främst på att begreppet placeringsfond inte är självständigt definierat i skattelagstiftningen, vilket leder till att ändringar i den privaträttsliga regleringen direkt påverkar vilka slags placeringsfonder anses vara sådana fonder som avses i beskattningen. 
Bestämmelsen om placeringsfond som samfund som är befriade från inkomstskatt i 20 § 1 mom. 2 punkten i den gällande inkomstskattelagen är från 1987. Bestämmelsen är till innehållet oförändrad sedan dess. Däremot har den privaträttsliga regleringen av placeringsfonder ändrats mycket under samma tid. 
Verksamhetsmiljön har i åtskilliga år varit mer internationell än då bestämmelsen infördes 1987. Regleringen kan därför ge upphov till oklarhet i fråga om hur utländska placeringsfonder ska behandlas i olika gränsöverskridande situationer. Placeringsfonder är i dag också ett sätt att placera i utländska aktiemarknader, medan tonvikten år 1987 låg på placering i inhemska aktier. 
2.2
Ändringar i lagstiftningen om placeringsfonder
2.2.1 Föreslagna ändringar i lagstiftningen om placeringsfonder 
Den nya lagen om placeringsfonder 
I regeringens proposition till riksdagen med förslag till lag om placeringsfonder och till vissa lagar som har samband med den (förslaget till ändring av lagstiftningen om placeringsfonder) föreslås att det stiftas en ny lag om placeringsfonder genom vilken lagen om placeringsfonder från 1999 upphävs. Genom den nya lagen om placeringsfonder görs lagens tillämpningsområde klarare och oklarheter som hänför sig till den gällande lagstiftningen elimineras. Det föreslås också att bestämmelserna om specialplaceringsfonder flyttas från lagen om placeringsfonder till lagen om förvaltare av alternativa investeringsfonder. 
Minimiantalet fondandelsägare 
Det föreslås att minimiantalet fondandelsägare sänks från nuvarande 50 till 30 andelsägare. Enligt propositionsmotiven finns det fortsättningsvis anledning att i lagstiftningen säkerställa att fondverksamhet är genuin kollektiv investeringsverksamhet och att placeringar i fonder till sin natur är kollektiva investeringar med kapital från allmänheten. Ändringen av minimiantalet andelsägare syftar dock till att underlätta verksamheten för nya placeringsfonder och göra det lättare för institutionella investerare att placera i fonder. Placeringsfonderna är också efter ändringen öppna för allmänheten och ska vara likvida och ledas med yrkesskicklighet. 
Delfondskonstruktioner 
Det föreslås att det till lagen om placeringsfonder fogas bestämmelser som tillåter delfondskonstruktioner. Strävan är att stärka de finländska fondernas internationella konkurrenskraft genom att harmonisera de finländska fondbestämmelserna med motsvarande bestämmelser i andra medlemsstater i EU. I Finland kan en placeringsfond indelas i andelsserier, men den gällande lagstiftningen tillåter inte att en fond delas upp i delfonder. ESMA publicerade den 30 januari 2017 ett yttrande (Share classes of UCITS, ESMA31-43-296), enligt vilket möjligheten att låta andelsserierna avvika från varandra annat än i begränsad omfattning, exempelvis i fråga om valutasäkring, utesluts. Någon motsvarande ställning har inte tagits i fråga om delfonder, och det är alltså möjligt att bilda delfonder med sinsemellan avvikande investeringspolicy. 
I förslaget till ändring av lagstiftningen om placeringsfonder föreslås det att det till lagen om placeringsfonder kompletteras med begreppet delfonder. En placeringsfond kan på det sätt som närmare anges i bestämmelserna utgöras av en eller flera delfonder, som i sin tur kan indelas i andelsserier och andelsklasser. Efter revideringen är det alltså möjligt att en fondandelsägare innehar tillväxtandelar i andelsserien 1 i delfonden A i placeringsfonden X. Värdet av den aktuella delfonden kan anges i bråkdelar. Enligt förslaget gagnar införandet av begreppet delfond särskilt den gränsöverskridande fondverksamheten, men den möjlighet begreppet ger att i delfonder, till skillnad från i andelsserier, tillämpa sinsemellan avvikande investeringspolicyer kan också vara till nytta i inhemsk fondverksamhet. Delfondskonstruktioner tillåter bland annat utnyttjande av olika slag av inflations- eller indexsäkring. 
I en delfondskonstruktion består placeringsfonden alltså av en eller flera delfonder som var och en kan ha sinsemellan varierande investeringspolicy. På samma sätt som i en konstruktion med en enda placeringsfond kan en delfond ha avkastnings- eller tillväxtandelar och olika andelsserier. I den föreslagna delfondsmodellen utgör delfonderna tillsammans placeringsfondens tillgångar, men delfondernas tillgångar ska förvaras och bokföras separat från varandra. På delfonder tillämpas enligt förslaget det samma som föreskrivs om placeringsfonder. En delfond ska på samma sätt som en placeringsfond ha exempelvis minst 30 andelsägare. Det föreslås dock att separata bokslut ska upprättas för delfonderna, dock så att det för alla delfonder i en placeringsfond också ska läggas fram en kombinerad resultat- och balansräkning. Det är enligt förslaget också möjligt att offentliggöra ett kombinerat fondprospekt för delfonder, där delfondernas gemensamma och delfondsspecifika uppgifter offentliggörs i en och samma broschyr. Det är dock också möjligt att offentliggöra ett fullständigt fondprospekt för varje delfond. Däremot ska det för varje delfond alltid publiceras ett faktablad. 
Enligt förslaget till ändring av lagstiftningen om placeringsfonder ska det som föreskrivs om placeringsfonder på motsvarande sätt tillämpas på delfonder. I en delfondskonstruktion är placeringsfonden en så kallad paraplyfond. Enligt propositionsmotiven anger många fondbolag redan i dag stadgarna för placeringsfonden kombinerat i en och samma publikation som omfattar såväl de allmänna stadgarna för fondbolagets alla placeringsfonder och de specifika stadgarna för varje enskild placeringsfond. Denna praxis har underlättat fondbolagens hantering av placeringsfondernas stadgar och stadgeändringar. På motsvarande sätt är det enligt förslaget möjligt att presentera stadgarna kombinerat i en publikation med såväl paraplyfondens allmänna stadgar och delfondernas stadgar. Regleringen hindrar dock inte fondbolaget från att heltäckande skriva ut varje delfonds stadgar separat. Stadgarna och regelstrukturen ska dock i första hand vara klar och tydlig. Finansinspektionen fastställer placeringsfondens stadgar om de överensstämmer med lag och är tydliga. 
Specialplaceringsfonder 
I förslaget till ändring av lagstiftningen om placeringsfonder föreslås det att bestämmelserna om specialplaceringsfonder flyttas till lagen om förvaltare av alternativa investeringsfonder och att det till den lagen i behövlig utsträckning fogas hänvisningar till bestämmelser i lagen om placeringsfonder. Enligt propositionsmotiven är specialplaceringsfonder en juridisk form för AIF-fonder. Det faller sig därför naturligt att bestämmelserna om dem finns i lagen om förvaltare av alternativa investeringsfonder. I samband med att bestämmelserna om AIF-fonder flyttas, finns det också anledning att i mindre utsträckning gallra ut vissa bestämmelser om placeringsfonder som också tillämpas på specialplaceringsfonder men är överlappande eller ska upphävas. Exempel på det är bestämmelserna om bevarande av noteringar om transaktioner och bestämmelserna om revision. Andra ändringar som uttryckligen gäller specialplaceringsfonder föreslås inte. Det föreslås inga ändringar i bestämmelserna om specialplaceringsfonders investeringspolicy, minimikapital eller utdelningsskyldighet. Till den del det i den föreslagna lagen om placeringsfonder finns materiella bestämmelser till vilka det hänvisas i bestämmelserna om specialplaceringsfonder, ska dessa ändringar också gälla specialplaceringsfonder. Till dessa hör bland annat bestämmelserna om minskning av minimiantalet fondandelsägare från 50 till 30, kallelse till fondandelsägarstämma och begränsning av inlösen. Dessutom blir det möjligt med delfondskonstruktioner i specialplaceringsfonder. 
Övriga ändringar 
De andra föreslagna ändringarna anknyter bland annat till slopande av kravet på regelmässiga fondandelsägarstämmor, valet av medlemmar i fondbolagets styrelse, minskning av antalet gånger revisorerna ska beräkna fondandelsvärdet till en gång per år, begränsning av inlösen i vissa fall, fondbolagets rätt att i vissa fall lösa in fondandelar utan fondandelsägarens samtycke och slopande av kravet på att utfärda fysiska andelsbevis. 
Ändringsförslagen i lagstiftningen om placeringsfonder avses träda i kraft den 1 mars 2019. 
2.2.2 Bedömning av behovet av ändringar i skattelagstiftningen till följd av revideringen av lagstiftningen om placeringsfonder 
Särskiljning av begreppen placeringsfond och specialplaceringsfond 
Begreppet placeringsfond har inte definierats i skattelagstiftningen, och begreppet skattefri placeringsfond har ansetts vara kopplat till begreppet privaträttslig inhemsk placeringsfond. I den gällande lagen om placeringsfonder föreskrivs om såväl placeringsfonder enligt fondföretagsdirektivet som specialplaceringsfonder som grundar sig på nationell lagstiftning och utgör en form av alternativ investeringsfond. Det har av hävd ansetts att också specialplaceringsfonder är sådana placeringsfonder som avses i 20 § i inkomstskattelagen. 
I den föreslagna ändringen av lagstiftningen om placeringsfonder flyttas bestämmelserna om specialplaceringsfonder från lagen om placeringsfonder till lagen om förvaltare av alternativa investeringsfonder. Samtidigt faller specialplaceringsfonderna utanför tillämpningsområdet för den fondverksamhet som avses i lagen om placeringsfonder. I och med att begreppen placeringsfond och specialplaceringsfond genom ändringen helt särskiljs från varandra finns det starka skäl för att i skattelagstiftningen särskilt ta in begreppet specialplaceringsfond. Det skulle göra beskattningen mer förutsägbar och eliminera den oklarhet som till följd av ändringen av placeringsfondslagstiftningen kan uppstå vid beskattningen av specialplaceringsfonder. 
Minimiantalet andelsägare och ändringens konsekvenser för beskattningsmodellen för placeringsfonder 
I förslaget till ändring av lagstiftningen om placeringsfonder föreslås det att minimiantalet fondandelsägare sänks från 50 till 30. Beskattningsmässigt påverkar kravet på andelsägarnas antal i vilken utsträckning olika placeringsformer kan godkännas som skattefria och i vilka situationer man kan tillåta att beskattningen skjuts upp (skatteuppskovsförmån). 
Bestämmelserna om skattefrihet för placeringsfonder är från 1987, då också den privaträttsliga regleringen av placeringsfonder trädde i kraft. Avsikten var att skattemässigt behandla placeringsverksamhet genom placeringsfonder på samma sätt som direkta placeringar i aktier. Skattefriheten motiverades med att det var en enkel och tydlig beskattningsmodell. När det föreskrevs om skattefrihet var samtidigt huvudregeln enligt lagen om placeringsfonder att fonderna var skyldiga att regelbundet lämna utdelning. Därmed beskattades varje år den vinst som samlats i placeringsfonden och delats ut till placerarna. Också det ansågs utgöra en grund för skattefrihet. 
Genom åren har lagstiftningen om placeringsfonder ändrats åtskilliga gånger, och begreppet skattefri placeringsfond har urvattnats. År 1994 fick placeringsfonderna möjlighet att införa tillväxtandelar som inte omfattas av kravet på vinstutdelning. I dag står tillväxtandelarna för den överlägset största delen av det sammanräknade kapitalet i de finländska placeringsfonderna. Tillväxtandelarna ger alltså inte årlig avkastning. Marknaden för placeringsfonder har också blivit mångsidigare än den var då skattefriheten infördes och man eftersträvade neutralitet i förhållande till aktieplaceringar. I dag står aktiefonderna för endast 40 procent av det sammanräknade kapitalet i placeringsfonderna. 
År 1996 infördes det gällande kravet på minst 50 andelsägare i lagen om placeringsfonder. Undantag från detta krav kunde göras med särskilt tillstånd. Ett av motiven för att fastställa ett minimiantal andelsägare var att fondverksamhet till sin natur är kollektiva investeringar av medel som anskaffats hos en obegränsad grupp investerare, och att placeringsfonder inte skulle få utnyttjas som instrument för att nå andra syften. Det ansågs dock inte ändamålsenligt att förhindra bildandet av och verksamheten i placeringsfonder som byggde på andra placeringskoncept i de fall där det kunde påvisas att det exklusiva syftet med verksamheten inte var att kringgå skatt. Det fanns således också skattepolitiska mål med minimiantalet andelsägare. 
Avkastningen från en placeringsfonds fondverksamhet kan skattefritt kumuleras i tillväxtandelar, tills fondens vinst delas ut till andelsägarna eller fonden löser in fondandelen av dess ägare. Tillväxtandelar i en placeringsfond är alltså skattemässigt förknippade med en förmån, eftersom beskattningen skjuts upp. Förmånen är inte nödvändigtvis stor för en enskild placerare, men har likväl avsevärd betydelse för det totala skatteinflödet. Man kan försöka uppskatta det totala värdet av denna uppskovsförmån, men i brist på faktaunderlag kan ingen noggrann uppskattning göras. Placeringsfondernas sammanräknade kapital uppgick den 31 december 2017 till 116,2 miljarder euro, och hushållen ägde direkt knappt 20 procent av kapitalet. Enligt en grov beräkning kan den förmån som hushållen får genom skatteuppskovet (jämfört med 100-procentig vinstutdelning) vara avsevärd och uppgå till rentav några hundra miljoner euro per år. Beräkningen är dock starkt behäftad med vissa antaganden. En noggrannare beräkning skulle kräva mer detaljerade uppgifter bland annat om placeringens avkastning, innehavstiden och referensräntan, statens alternativa avkastning som skattetagare, fondandelarnas inlösningsvolym och rapporterade överlåtelsevinster samt konsekvenserna för beteendet (till exempel överföring av placeringstillgångar till andra placeringsformer). 
I ett internationellt perspektiv kan det noteras att olika stater har olika beskattningsmodeller för placeringsfonder. Det är dock typiskt att man har velat undvika dubbelbeskattning av fondplaceringar. En placeringsfond kan exempelvis vara en separat skattskyldig, men den kan få vissa inkomster skattefritt eller göra särskilda avdrag i beskattningen. Placeringsfonderna kan vara helt befriade från skatt, såsom fallet är i Finland. I vissa stater är placeringsfonder skattemässigt transparenta, och är då inte separata skattskyldiga utan inkomsten flödar vidare till investeraren, som beskattas antingen direkt eller när fonden delar ut vinst. Det uppstår alltså inte en skatteuppskovsförmån på samma sätt i alla stater. I exempelvis Sverige kompenseras skatteuppskovet genom beskattning av en schablonintäkt, och i Danmark genom bestämmelser om minimiutdelning. 
Arbetsgruppen för utvärdering av skattebehandlingen av olika investeringsformer uppskattade betydelsen av den skatteuppskovsförmån som är förknippad med skattefria placeringsfonder. Arbetsgruppen ansåg det dock motiverat att bevara den gällande modellen med skattefrihet. Som ett möjligt alternativ bedömde arbetsgruppen exempelvis ett vinstutdelningskrav för placeringsfonder. Det skulle i sig förhindra att avkastning av placeringar kumulerades skattefritt i fonder. Ett motsvarande vinstutdelningskrav skulle dock inte kunna föreskrivas för utländska placeringsfonder, vilket betyder att det skulle utgöra en klar konkurrensförmån för utländska aktörer i förhållande till finländska placeringsfonder. Arbetsgruppen ansåg det inte motiverat med en beskattning av en schablonintäkt enligt svensk modell, eftersom det inte är förenligt med realiseringsprincipen. Införandet av en schablonintäkt skulle dessutom utgöra en stor ändring av skattesystemet. Någon motsvarande modell tillämpas inte heller på andra placeringsprodukter. Arbetsgruppen bedömde dessutom att en begränsning av det skatteuppskov som väsentligen anknyter till skattefriheten för placeringsfonder skulle ha uppenbart stora konsekvenser för placeringsfondsmarknaden och i förlängningen för hela finansmarknaden, till följd av det stora antalet tillväxtandelar. Den gällande beskattningen av tillväxtfonder ansågs snarare utgöra ett exempel för beskattningen av placeringar i andra jämförbara indirekta placeringsformer, exempelvis sparlivförsäkringar och kapitaliseringsavtal. 
Placeringsfonder är till sin natur öppna. En placeringsfond är inte bara öppen för allmänheten (open to the public), utan också likvid (open-ended). Öppenheten gentemot allmänheten har kunnat begränsas genom ett högt minimiteckningskrav, men likviditeten endast i undantagsfall. Minimiantalet andelsägare syftar till att säkerställa att fondverksamheten handlar om genuina kollektiva investeringar och att fondplaceringarna har karaktären av kollektiva investeringar med kapital från allmänheten. Minimiantalet påverkar också hur i vilken utsträckning skatteuppskov tillåts och hur effektivt man kan förebygga skatteplanering genom skräddarsydd kapitalförvaltning. En förutsättning för skattefrihet för placeringsfonder kan därför anses vara att det i lag klart fastställs hur många andelsägare en placeringsfond minst måste ha samt att detta antal är tillräckligt stort. Motiven för en förmånlig skattebehandling blir allt tunnare ju färre investerare en fond har. 
Placeringsfonder är föremål för en detaljerad privaträttslig reglering och fonderna har som syfte att utgöra instrument för kollektiva investeringar. Investeraren har ingen juridisk bestämmanderätt över investeringsobjekten, eftersom fondbolaget fattar investeringsbesluten. Beskattningen sker alltid då medel tas ut. Sammantaget finns det fortfarande grundade skäl för skattefriheten för placeringsfonder. Det gäller också tillväxtfonder, trots att sådana inte var möjliga när skattefriheten infördes. Regeringen omfattar också arbetsgruppens bedömning att en ändring av beskattningsmodellen skulle ha avsevärda konsekvenser för placeringsfondsmarknaden och i förlängningen för hela finansmarknaden. Placeringsfondernas ställning som skattefria samfund måste dock också i fortsättningen knytas till kravet att det genuint handlar om kollektiva investeringar med kapital från allmänheten. Det föreslagna minimiantalet på 30 andelsägare kan anses säkerställa att dessa mål uppnås. På de grunder som nämnts ovan föreslår regeringen inga ändringar i beskattningsmodellen med placeringsfonder som är befriade från skatt. 
Delfondskonstruktioner 
I förslaget till ändring av lagstiftningen om placeringsfonder föreslår regeringen att delfondskonstruktioner ska bli tillåtna. 
Med delfond (sub-fund) avses en sådan del av en placeringsfond vars placeringsverksamhet kan avvika från placeringsverksamheten i fondens andra delfonder och, på det sätt som närmare bestäms i placeringsfondens stadgar, från placeringsfondens allmänna investeringspolicy. Åtskilliga EU-länder tillåter en fondkonstruktion kallad paraplyfond (umbrella fund), där placeringsfonden består av tiotals eller rentav hundratals delfonder som kan ha rörligt kapital eller konstrueras enligt avtalsmodellen. I en paraplyfond tecknar fondinvesterarna direkt andelar i den delfond de valt och sannolikt än mer specifikt, det vill säga i en viss andelsserie i den delfond de valt. 
Eftersom det föreslagna begreppet delfond är nytt i lagen om placeringsfonder och det inte är klart vilka slags delfondskonstruktioner som i praktiken kommer att bildas, är det av tydlighetsskäl motiverat att särskilt erkänna delfondskonstruktioner i inkomstskattelagen. Det stärker förutsägbarheten och rättssäkerheten i beskattningen. 
En central fråga ur ett skatteperspektiv är hur byte av delfondsandelar till andelar i en annan delfond ska beskattas: ska det jämställas med överlåtelse eller inte? Det finns riklig rätts- och beskattningspraxis angående byte av fondandelar och andelsklass inom en och samma placeringsfond samt om byte av delfondsandelar i utländska fonder. Enligt den gällande lagen om placeringsfonder är byte av andelsserier inom samma placeringsfond tillåtet, och det har i beskattningen inte betraktats som överlåtelse. Om föremålet för byte i stället är andelsserier som hör till olika placeringsfonder betraktas bytet som överlåtelse, även om de aktuella fonderna förvaltas av ett och samma fondbolag. I fråga om utländska delfondskonstruktioner har det i rättspraxis dock ansetts att byte av aktier i en delfond till aktier i en annan delfond är skattepliktig överlåtelse, eftersom de aktier som erhålls hänför sig till en annan fondtillgång än de tidigare ägda aktierna. 
Om lagen om placeringsfonder tillåter delfondskonstruktioner kan det i fortsättningen bli så att fondbolaget inte längre förvaltar ett flertal placeringsfonder utan endast en enda fond som utgörs av många delfonder. För att en andelsägare inte ska kunna lägga om sin placeringsportfölj utan skattepåföljder genom att byta delfondsandelar sinsemellan, måste byte av delfondsandelar betraktas som skattepliktig överlåtelse. Byte av delfondsandelar inom samma placeringsfond måste i beskattningen betraktas som överlåtelse på samma sätt som byte av fondandelar mellan placeringsfonder som förvaltas av ett och samma fondbolag utgör överlåtelse. 
Specialplaceringsfonder 
En specialplaceringsfond är en alternativ investeringsfond enligt AIFM-direktivet. Nationellt har specialplaceringsfonder varit tillåtna sedan 1996. Ursprungligen skulle en specialplaceringsfond på samma sätt som en placeringsfond vara en fond som marknadsförs hos allmänheten. Införandet av specialplaceringsfonder motiverades i tiden bland annat med att det förbättrade de små och medelstora företagens finansiella försörjning. Den viktigaste sänkningen av kraven på andelsägare genomfördes i samband med att AIFM-direktivet sattes i kraft 2014. Genom reformen utsträcktes skattefriheten klart till också andra specialplaceringsfonder än sådana som erbjuds allmänheten. Enligt den gällande lagen om placeringsfonder kan en specialplaceringsfond ha färre än tio andelsägare. Det är till och med möjligt att fonden har en enda investerare. I specialplaceringsfonder med färre än 50 andelsägare måste dessa vara professionella investerare eller förmögna privatpersoner. Specialplaceringsfonder med färre än 50 andelsägare måste också varje år dela ut tre fjärdedelar av räkenskapsperiodens vinst till andelsägarna. Redan 2007 ändrades lagen så att det blev möjligt att i form av specialplaceringsfonder bilda fastighetsplaceringsfonder med minst tio andelsägare. 
Enligt den fondtypsklassificering som tillämpas i Finlands Banks statistik utnyttjas finländska specialplaceringsfonder bland annat som aktie-, långränte-, kombinations-, hedge- och fastighetsfonder. I praktiken kan specialplaceringsfonder marknadsföras hos allmänheten på samma sätt som placeringsfonder, men de kan också anpassas för en mindre investerargrupp. Bostadsfonder i form av specialplaceringsfonder är ett exempel på fonder som erbjuds allmänheten. Lagstiftningen om placeringsfonder tillåter dessutom att specialplaceringsfonder bedriver kapitalinvesteringsverksamhet, och specialplaceringsfonder som erbjuds en mindre grupp kan till sin natur i själva verket ligga nära fonder i kommanditbolagsform, som är slutna fonder. 
Specialplaceringsfonder kan också utnyttjas för skräddarsydd kapitalförvaltning avsedd för en eller några andelsägare. Till följd av kostnaderna för att bilda en specialplaceringsfond och de fasta kostnader som verksamheten medför har det dock uppskattats att fonden måste förvalta tämligen omfattande medel, uppskattningsvis flera tiotals miljoner euro. Internationellt är därför målgruppen för dessa fonder främst ytterst förmögna familjer och institutionella och andra professionella investerare. I Finland finns det för närvarande tre specialplaceringsfonder med färre än tio andelsägare. Det finns veterligen ingen fond med enbart en andelsägare. 
Förslaget att sänka minimiantalet andelsägare från 50 till 30 gäller också specialplaceringsfonder på så sätt att fonder som erbjuds icke-professionella investerare i fortsättningen ska ha minst 30 andelsägare. Om antalet andelsägare är färre än så, måste de vara professionella investerare eller förmögna privatpersoner som kan jämställas med professionella investerare. Denna typ av specialplaceringsfond med färre än 30 andelsägare ska enligt förslaget omfattas av samma vinstutdelningskrav som i dag. Det föreslås inga ändringar i kraven på minimiplacering i specialplaceringsfonder med tio eller färre andelsägare, och det ska också i fortsättningen vara möjligt att bilda specialplaceringsfonder med endast en andelsägare. Sänkningen av minimiantalet andelsägare i specialplaceringsfonder till 30 medför att det kommer att uppstå fler situationer där en specialplaceringsfond kan utnyttjas som ett investeringsinstrument utan att investeringen ger upphov till en årlig beskattningsbar inkomst. Också professionella investerare och förmögna privatpersoner skulle på motsvarande sätt ha större möjligheter att bilda specialplaceringsfonder utan att de omfattas av ett årligt vinstutdelningskrav. Också dessa grupper skulle således i större utsträckning än i dag tillåtas en skatteuppskovsförmån. 
Arbetsgruppen för utvärdering av skattebehandlingen av olika investeringsformer bedömde skattebehandlingen av specialplaceringsfonder bland annat med avseende på om skattefriheten för specialplaceringsfonder skulle bevaras endast för fonder som bildas genuint för kollektiva investeringar. I så fall skulle det kunna föreskrivas om en helt annan skattebehandling av specialplaceringsfonder som är avsedda för en mindre krets av investerare. Ett alternativ som övervägdes var en slags modell med skattemässig transparens, där andelsägaren ansågs få inkomst direkt av placeringsobjektet och den mellanliggande specialplaceringsfonden inte skulle beaktas i beskattningen. Arbetsgruppen stannade dock för att inte rekommendera en sådan modell. Det ansågs att vinstutdelningskravet effektivt begränsade uppkomsten av en skatteuppskovsförmån i specialplaceringsfonder för en mindre krets. I ett inhemskt sammanhang ansågs skillnaden mellan vinstutdelningskrav och skattemässig transparens i praktiken inte heller vara särskilt stor. Arbetsgruppen ansåg också att den modellen var förknippad med ett flertal sådana skattetekniska frågor och omständigheter rörande fondbolagets skyldighet att lämna information som inte ingår i den gällande regleringen, som utgår från ett vinstutdelningskrav. Arbetsgruppen såg det därför inte som nödvändigt att nu gå vidare med en översyn av skattebehandlingen av specialplaceringsfonder. 
Arbetsgruppen påpekade dock att den vid utvärdering av skattebehandlingen också noterade att ett alternativ för vissa investerare är att investera i utländska fonder. Utländska fonder som kan jämställas med specialplaceringsfonder omfattas inte av den finländska lagstiftningens vinstutdelningskrav, så finländska specialplaceringsfonder kan stå i en sämre konkurrensställning i fråga om källbeskattningen av utdelning. 
När det är frågan om kollektiva investeringar med kapital från allmänheten finns det liknande grunder som för placeringsfonder att bevara specialplaceringsfonderna som skattefria samfund. Argumenten för att behandla specialplaceringsfonder som skattefria samfund blir allt svagare ju färre andelsägare en fond har. Det är därför möjligt att tänka sig en avvikande skattebehandling av specialplaceringsfonder med få andelsägare. Internationellt finns det olika modeller för beskattningen av fondplaceringar. Gemensamt för dem är strävan att undvika dubbelbeskattning av den inkomst som erhålls genom fonden. Många länder försöker också begränsa den skatteuppskovsförmån som uppstår vid fondplacering. Den obligatoriska vinstutdelningen för specialplaceringsfonder med få andelsägare kan på motsvarande sätt anses begränsa denna förmån. Det kan därför anses finnas grunder för skattefriheten för dessa specialplaceringsfonder med få ägare. 
Det ingick inte i uppgifterna för arbetsgruppen för utvärdering av skattebehandlingen av olika investeringsformer att granska fastighetsfonderna. En specialplaceringsfond kan också fungera som en fastighetsinvesteringsfond, varvid det räcker med minst tio andelsägare, om varje andelsägare måste teckna andelar till ett värde av minst en miljon euro. Oberoende av antalet andelsägare måste en specialplaceringsfond som investerar i fastigheter alltid dela ut tre fjärdedelar av räkenskapsperiodens vinst till andelsägarna, med undantag av icke-realiserade värdeförändringar. När det föreskrevs om dessa fastighetsfonder i lagen om placeringsfond, konstaterades det i propositionsmotiven att den obligatoriska vinstutdelningen är ett vanligt krav internationellt sett när det gäller fonder för kollektiva fastighetsinvesteringar och att den obligatoriska vinstutdelningen leder till att också beskattningens uppskjutande effekt begränsas till högst den del av räkenskapsperiodens vinst som inte delas ut till delägarna. På motsvarande sätt vore det motiverat att i inkomstskattelagen ta in ett krav på utdelning av tre fjärdedelar av vinsten när det är frågan om specialplaceringsfonder som huvudsakligen investerar i fastigheter. Därmed skulle inhemska och utländska fastighetsfonder jämställas. 
Arbetsgruppen för utvärdering av skattebehandlingen av olika investeringsformer konstaterade i fråga om kapitalfonder i form av kommanditbolag att om man vill åtgärda vissa av de problem som anknyter till beskattningen av dem, måste man i den fortsatta beredningen överväga att införa en modell med skattemässig transparens. Om skattebehandlingen av kapitalfonder i form av kommanditbolag ses över i den fortsatta beredningen, kan detta ge anledning att återkomma också till skattebehandlingen av specialplaceringsfonder. 
2.3
Behovet av att ändra skattelagstiftningen om gränsöverskridande situationer
2.3.1 Allmänt 
Den internationella fondmarknaden har vuxit betydligt bland annat tack vare EU:s inre marknad och euroområdets gemensamma valuta. Det har lett till fler gränsöverskridande situationer och tolkningsfrågor angående beskattningen i dessa situationer. Det har i avsevärd grad uppstått oklarheter och rättspraxis om hur utländska placeringsfonder ska behandlas skattemässigt i Finland. I praktiken har de oklara fallen gällt situationer där en utländsk fond har investerat i Finland. Frågan har då varit om Finland som inkomstens källstat har rätt att innehålla skatt på den inkomst som erhållits i Finland. Om i stället en finländsk placeringsfond har investerat i ett objekt utomlands, uppstår beskattningsfrågor angående eventuell källskatt som innehålls i utlandet. Denna källskatt kan inte avräknas i Finland, eftersom placeringsfonden i egenskap av samfund som är befriat från skatt inte har sådan skatteplikt i Finland som skulle möjliggöra gottgörelse av skatt som betalats utomlands. Skattefrågor kan också bli aktuella i situationer där investeraren skattemässigt är bosatt i en annan stat än placeringsfonden. Den stat där delägaren är bosatt har då i regel rätt att beskatta inkomst från placeringsfonden. 
Arbetsgruppen för utvärdering av skattebehandlingen av olika investeringsformer granskade ingående beskattningen i samband med gränsöverskridande situationer. Enligt arbetsgruppens rapport kan gränsöverskridande fondverksamhet bli föremål för beskattning åtminstone i tre olika stater: i den stat där föremålet för fondens investering har sin hemvist. i den stat där fonden själv har sin hemvist och i den stat där fondinvesteraren (andelsägarens) är bosatt. Beskattningen av inkomstflödena kan således anses ske på fyra olika punkter: källbeskattning av den inkomst investeringen ger, beskattning av fondens inkomst i den stat där den har hemvist, källbeskattning av den inkomst fonden delar ut i den stat där den har hemvist och beskattning av fondinvesteraren i den stat där denne är bosatt. Situationen åskådliggörs i följande figur: 
Inkomstflöden i en internationell fondkonstruktion 
Källa: Rapport från arbetsgruppen för utvärdering av skattebehandlingen av olika investeringsformer, finansministeriets publikationer 14/2018 
UCITS-direktivet tillåter tre juridiska konstruktioner för kollektiva investeringar: avtalsbaserade placeringsfonder, investeringsbolag med rörligt kapital och fonder i trustform. Direktivets överbegrepp för dessa olika fonder är fondföretag. Placeringsfonder som bildas i Finland kan endast vara avtalsbaserade. I lagen om placeringsfonder avses med fondföretag, oberoende av dess juridiska form, ett företag för kollektiva investeringar som har hemvist i någon annan EES-stat än Finland och uppfyller villkoren i fondföretagsdirektivet. I förslaget till ändring av lagstiftningen om placeringsfonder föreslås det ingen ändring av detta. I lagen om placeringsfonder avser placeringsfond också i fortsättningen en avtalsbaserad placeringsfond som har bildats i Finland. 
Det finns i olika stater också olika slag av fonder som inte är investeringsfonder enligt fondföretagsdirektivet utan i stället så kallade alternativa investeringsfonder. Dessutom kan det finnas fonder som inte heller hänförs till alternativa investeringsfonder, däribland fonder i tredjeländer. Vilken juridisk form dessa fonder har beror på lagstiftningen i respektive stat. På samma sätt som när det gäller UCITS-fonder kan det bli aktuellt att fastställa hur de ska behandlas vid beskattningen i Finland. Liksom i Finlands finns det exempelvis i Sverige avtalsbaserade specialplaceringsfonder (specialfond), som omfattas av bestämmelserna i AIFM-direktivet. 
2.3.2 Skattebehandlingen av utländska investeringsfonder – Finland som källstat för inkomsten 
Beskattningspraxis och rättspraxis 
Det har i skattelagstiftningen inte särskilt fastställts hur en utländsk investeringsfond som investerar i Finland ska behandlas skattemässigt i Finland. Frågan är flertydig, och det finns en stor mängd rättspraxis på området. Rättspraxis behandlas närmare i avsnitt 1.7. I praktiken är den centrala frågan i dessa fall huruvida källskatt ska tas ut på avkastningen av investeringen, exempelvis vinstutdelningen. De ränteinkomster och överlåtelsevinster vid avyttring av aktier som en begränsat skattskyldig får i Finland är i regel skattefria redan med stöd av Finlands nationella lagstiftning. Finland har i regel beskattningsrätt endast i fråga om vinstutdelning och fastighetsinkomster som erhålls från Finland. 
Hur stor källskatt som innehålls på vinstutdelning är beroende av bestämmelserna i källskattelagen och i eventuella tillämpliga skatteavtal. Också EU-rätten kan förhindra innehållning av källskatt. I många fall kan källskatt inte innehållas med stöd av den grundläggande friheten för kapitalrörelser enligt FEUF. När en utländsk fond får fastighetsinkomster i Finland, beror skatteplikten för inkomsten på huruvida fonden jämställs med ett aktiebolag eller med en specialplaceringsfond. Jämställs fonden med ett aktiebolag är hela fastighetsinkomsten beskattningsbar inkomst i Finland. Skatteavtalen hindrar i regel inte Finland från att beskatta fastighetsinkomst från Finland. Jämställs fonden i stället med en specialplaceringsfond är fastighetsinkomsten befriad från skatt i Finland. 
Vid skattebehandlingen av en utländsk investeringsfond är det väsentligt att slå fast vilken juridisk aktör fonden ska jämställas med. Det är av betydelse inte bara för vilka nationella beskattningsregler som ska tillämpas utan också med hänsyn till EU-rätten. Bedömningen av vilken juridisk aktör de utländska fonderna ska jämställas med är dock inte nödvändigtvis enhetlig. 
I nationell rätts- och beskattningspraxis har det främst fästs betydelse vid fondens juridiska egenskaper, men även de funktionella egenskaper har betydelse. Exempelvis luxemburgska SICAV-fonder i bolagsform har jämställts med aktiebolag. Även om SICAV funktionellt kan vara en fond som bedriver kollektiva investeringar är det i regel juridiskt frågan om ett bolag. Också amerikanska fonder i trustform (Delaware Statutory Trust) har i inhemsk rättspraxis jämställts med aktiebolag. I ett avgörande bedömde högsta förvaltningsdomstolen att en trust utifrån sina juridiska och funktionella egenskaper placerade sig mellan en finländsk placeringsfond och ett aktiebolag, men dock låg närmare ett aktiebolag. Till skillnad från finländska placeringsbolag var trusten sluten och antalet andelar varierade inte vid teckning eller inlösen av andelar. I ett annat avgörande ansåg HFD att en öppen fond i trustform med hemvist i Förenta staterna kunde jämställas med en finländsk placeringsfond. I fråga om avtalsbaserade utländska investeringsfonder har exempelvis fonder i Luxemburg, Sverige, Norge, Danmark och Förenta staterna jämställts med finländska placeringsfonder. 
Enligt EUD:s rättspraxis kan restriktioner för kapitalrörelser vara exempelvis åtgärder som leder till att personer bosatta i en annan stat blir mindre villiga att investera i vissa medlemsstater. Den fria rörligheten för kapital tillämpas också i förhållande till tredjeländer. Det kan likväl vara tillåtet med olika skattebehandling av inhemska respektive gränsöverskridande situationer, i det fall att situationerna vid en objektiv bedömning inte kan jämställas med varandra. EUD har i många avgöranden behandlat frågan om i vilka situationer en utländsk investeringsfond objektivt kan jämställas med en inhemsk aktör. Fallet C-303/07, Aberdeen Property Fininvest Alpha, gällde Finland och handlade om källbeskattning av vinstutdelning. Att innehålla källskatt på dividend (vinstutdelning) som betalades till en aktör i utlandet ansågs strida mot EU-rättens etableringsfrihet, när motsvarande vinstutdelning var befriad från skatt när mottagaren var en inhemsk aktör. Domstolen ansåg att det i fråga om källbeskattningen av vinstutdelningen inte fanns någon objektiv skillnad mellan SICAV-bolag och finländska aktiebolag, så det fanns inget behov av att i målet ytterligare utreda jämförbarheten med finländska placeringsfonder. 
I EUD:s rättspraxis har jämförbarheten uttryckligen bedömts på investeringsfondsnivå, och skattebehandlingen av investeraren har inte tillmätts någon betydelse. I de förenade målen C-338/11 och C-347/11, Santander Asset Management, angående källbeskattningen i Frankrike ansåg EUD att grunden för åtskillnad i den franska bestämmelsen endast var fondföretagets hemvist, varvid bedömningen av huruvida situationerna var jämförbara med varandra måste göras på nivån för investeringsinstrumentet, det vill säga investeringsfonden. Skattebehandlingen av investerarna skulle inte tillmätas betydelse. Den skattefrihet som gällde för fondföretag med hemvist i Frankrike förutsatte inte att andelsägarna betalar skatt på utdelningen. I ett fall gällande källbeskattning i Polen, C-190/12, Emerging Markets Series of DFA Investment Trust Company, baserade sig grunden för åtskillnad i den nationella skattebehandlingen endast på var investeringsfonden hade sin hemvist. Det var frågan om en fond med hemvist i Förenta staterna, som därmed inte var en sådan fond som avses i UCITS-direktivet. EUD ansåg att den omständigheten i sig inte räckte för att påvisa att fondens situation var annorlunda än en polsk fonds. Ett krav på en identisk reglering skulle leda till att den ändamålsenliga verkan med den fria rörligheten för kapital gick förlorad. Betydelsefullt var i båda avgörandena uttryckligen skattelagstiftningens grunder för åtskillnad mellan inhemska och gränsöverskridande situationer. 
Också i det fall att skattebehandlingen av inhemska och gränsöverskridande situationer anses vara olika och även om det vid en objektiv bedömning är frågan om jämförbara situationer, kan en avvikande skattebehandling likväl vara tillåten av tvingande skäl som anknyter till allmänintresset. Sådana legitima grunder kan exempelvis vara säkerställande av effektiv skattetillsyn, förhindrande av kringgående av skatt, säkerställande av ett sammanhängande skattesystem och säkerställande av en väl avvägd fördelning av beskattningsrätten mellan medlemsstaterna. Den legitima grunden måste vara proportionerlig och får inte överskrida vad som behövs för att uppnå de mål som bestämmelserna syftar till. De legitima grunderna för en annorlunda skattebehandling har dock inte haft några större framgångar i EUD:s rättspraxis angående källbeskattning. 
I målet C-480/18, Fidelity Funds mot Skatteministeriet, granskade EUD huruvida skattesystemet var sammanhängande i förhållande till bestämmelserna om danska investeringsfonder. I Danmark innehölls inte källskatt på utdelning till inhemska fondföretag som delades ut i Danmark, i det fall att fondföretaget, faktiskt eller kalkylmässigt, lämnade en viss minimiutdelning till sina andelsinnehavare och källskatt innehölls på utdelningen. Utländska fondföretag hade inte samma möjlighet till befrielse från källskatt. EUD ansåg att det med hänsyn till skattesystemets inre sammanhang i sig kunde vara motiverat, eftersom det fanns en strävan att kompensera för befrielsen från källskatt genom beskattningen av andelsägaren (källskatt innehölls när fonden delade ut vinst). Domstolen ansåg dock att begränsningen av den fria rörligheten för kapital gick längre än vad som behövdes för att nå målen med bestämmelsen. Skattesystemets inre sammanhang kunde enligt domstolen bibehållas genom att ge utländska fondföretag samma möjlighet till vinstutdelning som inhemska fondföretag. 
Förfarandet för återbäring av källskatt och uppskattat återbäringsbelopp 
Bedömningen av huruvida utländska investeringsfonder kan jämställas med finländska fonder grundar sig på fallspecifika bedömningar, vilket ger upphov till osäkerhet och kostnader för såväl Skatteförvaltningen som den skattskyldige. Om det har innehållits för mycket källskatt på utdelningen, kan under utbetalningsåret källskattebeloppet rättas av utbetalaren av utdelningen eller det kontoförande institut i Finland som bemyndigats av utbetalaren och handhaft utbetalningen av det finländska bolagets vinstutdelningar. Om källskattebeloppet inte rättas under utbetalningsåret, kan mottagaren av utdelning ansöka om återbetalning av den överbetalda skatten hos Skatteförvaltningen i Finland inom tre år från det att utdelningen utbetalats. Före år 2017 var tidsfristen för ansökan om återbetalning fem år. 
Arbetsgruppen för utvärdering av skattebehandlingen av olika investeringsformer försökte granska hur jämställandet av utländska investeringsfonder med finländska placeringsfonder påverkar skatteintäkterna. På grund av bristande faktaunderlag går det likväl inte att lägga fram några exakta uppgifter om hur mycket källskatt som återbärs. Skatteförvaltningen sammanställer bara statistik över den totala källskatt som varje år återbärs, och i det beloppet ingår också annan källskatt än sådan som återbärs till fonder. Enligt uppgifter från Skatteförvaltningen kommer det varje år in cirka 2 000—3 000 ansökningar om återbäring av källskatt. I nuläget gäller mer än hälften av dem ansökningar som yrkar på en jämlik behandling med stöd av EU-rätten. Av de ansökningar som åberopar EU-rätten kommer flertalet från utländska investeringsfonder. 
År 2016 återbars totalt cirka 177,5 miljoner euro till samfund som ansökt om återbäring av källskatt på vinstutdelning. Återbäringen hänför sig till olika kalenderår, eftersom det är typiskt att en ansökan gäller källskatten under flera på varandra följande år. År 2015 var motsvarande belopp cirka 273 miljoner euro, varutöver mer än 11 miljoner erlades i återbäringsränta. Tidigare år var de totala beloppen följande: år 2014 cirka 88 miljoner euro och 2,6 miljoner euro i återbäringsränta, år 2013 cirka 48 miljoner euro, år 2012 cirka 69 miljoner euro, år 2011 cirka 23 miljoner euro och år 2010 cirka 40 miljoner euro. 
Det går inte att specificera återbäringen till utländska fonder i de nämnda beloppen, men deras andel bedöms vara betydande. Enligt uppgifter från Skatteförvaltningen hade rättspraxisen angående fonder i Förenta staterna en avsevärd inverkan på återbäringsbesluten för 2015 och 2016. Den rättspraxis som avses är de HFD-avgöranden från 2015 genom vilka amerikanska fonder i trustform jämställdes med finländska samfund på så sätt att källskatt inte kunde innehållas på vinstutdelning från finländska börsbolag. 
Utöver ansökningarna om återbäring anger uppgifter från Skatteförvaltningen att fonderna också i ökande grad ansöker om källskattekort. En fond som beviljats källskattekort får utdelning utan källskatt redan vid utbetalningen, så källskattebeloppen för denna grupp återfinns inte i statistiken över återbäringen. År 2017 ansökte cirka 250 fonder om källskattekort. Dessutom är det möjligt att den som betalar utdelning gör det utan källskatt, även om mottagaren inte har ansökt om källskattekort. Inte heller dessa prestationer syns i Skatteförvaltningens statistik. 
Handläggningen av ansökningarna om återbäring av källskatt medför en stor mängd administrativt arbete för Skatteförvaltningen. I praktiken måste en utländsk investeringsfond som en gång redan fått ett positivt beslut om återbäring av källskatt ofta ansöka om antingen källskattekort för kommande utdelningar eller återbäring av källskatt i efterhand. 
Bedömning av nuläget och utvecklingsalternativ 
Arbetsgruppen för utvärdering av skattebehandlingen av olika investeringsformer ansåg att den oklara rätts- och beskattningspraxisen och källskatteåterbäringens fiskala betydelse ger orsak till en närmare granskning av den vinstutdelning som utländska investeringsfonder får från Finland. Regeringen instämmer i detta. 
För närvarande finns det inga som helst bestämmelser om skattebehandlingen av utländska investeringsfonder i inkomstskattelagen eller källskattelagen. Skattebehandlingen avgörs från fall till fall utifrån EU-principen om fri rörlighet för kapital och tolkning av vilka omständigheter som ska beaktas vid en jämförelse av utländska respektive inhemska aktörer. Den nationella lagstiftningen om skattebehandling av placeringsfonder är överhuvudtaget knapp, vilket kan bidra till att utländska fonder i tämligen stor utsträckning jämställs med inhemska placeringsfonder. Av EUD:s rättspraxis att döma ska vid bedömningen av om fonder behandlas olika endast de grunder för åtskillnad som föreskrivs i de nationella skattereglerna beaktas. Det betyder att exempelvis egenskaperna hos placeringsfonder eller specialplaceringsfonder enligt den nationella lagstiftningen om placeringsfonder saknar betydelse vid bedömningen av huruvida inhemska och utländska fonder är jämställda. Utifrån nationell rättspraxis och EUD:s rättspraxis är det likväl inte entydigt vilka omständigheter som ska beaktas vid bedömningen. Med stöd av EUD:s rättspraxis verkar det dock som om ringa skillnader i fråga om juridisk form eller skillnader i skattebehandlingen i den stat där den utländska investeringsfonden har hemvist inte räcker för att skapa en objektiv skillnad vid jämförelsen av utländska och inhemska fonder. I rättspraxis har betydelse uttryckligen tillmätts skattebehandlingen av investeringsfonden, inte av investeraren. 
Med hänsyn till principen om fri rörlighet för kapital enligt FEUF kan inhemska och utländska fonder inte försättas i olika ställning i beskattningen. I en situation där en inhemsk placeringsfond är befriad från skatt, bör inte heller källskatt innehållas på vinstutdelning till en utländsk investeringsfond. Likväl bör skattereglerna för placeringsfonder preciseras, med tanke på den oklarhet som anknyter till jämförelserna av utländska och inhemska fonder och den administrativa börda som detta ger upphov till. Det skulle göra det enklare att bedöma i vilka situationer en utländsk fond kan jämställas med en finländsk placeringsfond eller specialplaceringsfond. Ansökningarna om återbäring av källskatt har också fiskal betydelse. 
I Finland grundar sig beskattningen på placeringsinstrumentets juridiska form. De finländska placeringsfonderna är avtalsbaserade konstruktioner som inte utgör självständiga juridiska personer utan bildar en förmögenhetsmassa om vars skattefrihet det föreskrivs särskilt. Utländska investeringsfonder kan i beskattningen jämställas med finländska aktiebolag främst på grundval av deras juridiska form. För vissa utländska former, exempelvis truster, går det inte att hitta direkt motsvarande finländska juridiska personer. I så fall har jämförelsen gjorts utifrån fondens egenskaper. Frågan om huruvida en utländsk fond kan jämställas med finländska fonder sträcker sig alltså längre än enbart till när en utländsk investeringsfond kan jämställas med en finländsk avtalsbaserad placeringsfond. Jämförbarheten anknyter inte heller enbart till placeringsverksamhet som avser placeringsfonder, utan det kan uppstå situationer där det är fråga om andra utländska aktörer som får vinstutdelning från Finland. 
Arbetsgruppen för utvärdering av skattebehandlingen av olika investeringsformer ansåg att basen för källskatt på vinstutdelning har minskat betydligt på senare år och att också Finlands rätt att beskatta fastighetsinkomster från Finland har minskat. Enligt arbetsgruppen skulle det enklaste sättet att få till stånd en neutral skattebehandling av inhemska och gränsöverskridande situationer vara att införa en slutlig, låg källskatt. En sådan modell skulle dock innebära en omfattande ändring av beskattningen av vinstutdelning och kan inte ses som en lösning enbart på frågan om jämställande av utländska fonder med inhemska. 
Jämförelsen av situationen för utländska respektive inhemska fonder gäller inte enbart kollektiva investeringar i placeringsfonder, utan liknande frågeställningar kan bli aktuella också i samband med andra utländska aktörer. Eftersom frågan dessutom har kopplingar till beskattningen av vinstutdelning i vidare bemärkelse, ser regeringen det som motiverat att föreslå att skattereglerna nu preciseras enbart i fråga om avtalsbaserade fonder. I exempelvis en situation där en utländsk fond närmast jämställs med ett finländskt aktiebolag, avgörs Finlands rätt att innehålla källskatt på utdelning till en sådan utländsk fond också i fortsättningen med stöd av 3 § 5 mom. i källskattelagen. 
Ansökningar om återbäring som lämnats av fonder i tredjeländer har i beskattningspraxis visat sig vara särskilt utmanande. Det vore därför nödvändigt att i skattelagstiftningen föreskriva att utländska fonder som ansöker om återbäring är skyldiga att påvisa att fonden till sina egenskaper motsvarar en finländsk skattefri placeringsfond eller specialplaceringsfond. 
2.3.3 Skattebehandlingen av finska placeringsfonder utomlands 
När en finsk placeringsfond investerar i utlandet kan den inkomst som fonden får bli föremål för utländsk beskattning. Eftersom en placeringsfond inte är skattskyldig i Finland, kan sådan källskatt som betalas i utlandet inte gottgöras vid beskattningen i Finland. Storleken på den källskatt som ska betalas i utlandet beror på om den finska placeringsfonden betraktas som ett subjekt enligt ett skatteavtal eller inte. Om den finska placeringsfonden betraktas som ett sådant skattesubjekt, får den förmånen av en lägre procentsats för källskatten. Det är också möjligt att den finska placeringsfonden betraktas som en transparent enhet. I så fall tillämpas ett skatteavtal mellan placerarens hemviststat och källstaten för inkomsten i stället för ett skatteavtal mellan Finland och källstaten för inkomsten. Det kan också inträffa att inget skatteavtal är tillämpligt. Emellertid har även en finsk placeringsfond möjlighet att söka återbetalning av källskatt från andra medlemsstater med stöd av EU-rätten. 
Ur finsk synvinkel betraktas en finsk placeringsfond som en person som avses i skatteavtal. Beslut om att bevilja skatteavtalsförmåner grundar sig alltid också på källstatens tolkning. Det att en finsk placeringsfond är fri från skatt kan medföra att källstaten för inkomsten inte betraktar fonden som en person enligt skatteavtalet. Skattebehandlingen av finska placeringsfonder i Finland kan även göra behandlingen långsammare i källstaten, eftersom ett samfund som är helt och hållet fritt från skatt inte nödvändigtvis är en bekant struktur i alla stater. Problem i samband med återbetalningsförfarandet för källskatt, såsom långsamhet och besvärliga byråkratiska processer, har redan i nästan tjugo år hört till de så kallade Giovannini-hinder som kommissionen för en förteckning över, och de betraktas fortfarande som problem (European Post Trade Forum Report 2017). 
Betydelsen av källskatt som ska betalas i utlandet har också behandlats av arbetsgruppen för utvärdering skattebehandlingen av olika investeringsformer. Enligt arbetsgruppens rapport råder i branschen uppfattningen att finska placeringsfonder i huvudsak betalar skatt i enlighet med skatteavtal, och frånsett några undantag har det inte förekommit storas problem vid tillämpningen av skatteavtalen i EU-området. Skattefri utdelning fås till exempel från Sverige för placeringsfonder enligt UCITS-direktivet och från Storbritannien. Skattefriheten grundar sig på dessa länders nationella lagstiftning. Placeringsfonder har lämnat ansökningar om återbetalning av källskatt på grundval av unionsrätten i några länder, och återbetalningar har gjorts åtminstone från Polen. Att få beslut från Tyskland skulle emellertid vara besvärligt. 
Arbetsgruppen har också utrett möjligheterna att ändra skattebehandlingen av placeringsfonder så att finska placeringsfonder med större säkerhet kan dra nytta av skatteavtalsförmåner (källskattesatsen kan till exempel sjunka från 30 till 15 procent). Som ett alternativ har arbetsgruppen studerat en modell där en placeringsfond i regel är skattskyldig för alla sina inkomster men utdelning av avkastning är en avdragsgill utgift för fonden. Dessutom har arbetsgruppen studerat en modell där källskatt som fonden betalat i utlandet kan beaktas i beskattningen av andelsägarna och en modell grundad på så kallads transparens. 
I en modell baserad på att utdelning av avkastning är avdragsgill blir placeringsfonden inte föremål för skattebelastning till de delar som den delar ut vinsten till sina andelsägare. En finsk placeringsfond skulle tydligt vara ett separat skattesubjekt enligt Finlands interna lagstiftning, och källstaten för inkomsten skulle antagligen i många fall följa samma tolkning vid tillämpningen av skatteavtal. Internationellt tillämpas detta slags modell för beskattningen av placeringsfonder till exempel i Förenta staterna och till vissa delar i Norge. Däremot har till exempel Sverige år 2012 övergett modellen med avdragsgill utdelning av avkastning och gått över till en skattefrihetsmodell, som emellertid är förknippad med osäkerhet när det gäller tillämpningen av skatteavtal. 
Enligt arbetsgruppen verkar det inte motiverat att ändra behandlingen av placeringsfonder i beskattningen enbart för att finska placeringsfonders inkomster från utlandet medför stora kostnader för källskatter. Regeringen delar denna uppfattning. Huruvida ett skatteavtal kan tillämpas på en finsk placeringsfond beror alltid också på hur källstaten tolkar situationen, och det är inte säkert att det önskade resultatet kan uppnås genom en ändring av skattebehandlingen. Det bör också noteras att även när ett skatteavtal är tillämpligt återstår som skattebelastning den källskatt som bestäms enligt avtalet. 
Arbetsgruppen fann inte heller tillräckligt goda motiveringar för en modell där källskatt som placeringsfonder betalar i utlandet kan gottgöras i beskattningen av fondandelsägarna. En specialbestämmelse som genomför en sådan modell skulle vara exceptionell i det finska skattesystemet och svår att genomföra i förvaltningen. I modellen med skattemässig transparens igen betraktar källstaten den finska placeringsfonden som transparent vid tillämpningen av skatteavtal, varför den skatt som tas ut i källstaten eventuellt kan gottgöras i beskattningen av andelsägarna så att källskatten inte medför någon slutlig kostnad. Internationellt tillämpas modellen med skattemässig transparens till exempel i Luxemburg på avtalsbaserade fonder. Arbetsgruppen kom likväl fram till att modellen är svår att tillämpa på finska placeringsfonder, eftersom dessa är öppna och antalet andelsägare varierar. Modellen skulle inte heller gagna de placerare som är fria från skatt såsom många institutionella placerare. 
2.3.4 Vinstandel som en placeringsfond delar ut samt överlåtelse av fondandelar 
Begränsat skattskyldiga investerare i finska placeringsfonder 
Arbetsgruppen för utvärdering av skattebehandlingen av olika investeringsformer studerade också skattebehandlingen av utdelning av vinstandelar och överlåtelse av fondandelar i placeringsfonder i gränsöverskridande situationer. Arbetsgruppen noterade inga särskilda problem vad gäller skattebehandlingen av vinstandelar eller överlåtelse av fondandelar i finska placeringsfonder. Vad gäller utländska investerare med andelar i finska placeringsfonder är Finlands beskattningsrätt särskilt vid tillämpningen av skatteavtal likväl mycket begränsad, eftersom vinstandelar i allmänhet i skatteavtal ses som annan inkomst för vilken det oftast är andelsägarens hemviststat som har beskattningsrätt. Vad gäller överlåtelse av andelar i placeringsfonder har Finland enligt den interna lagstiftningen ingen beskattningsrätt. Överlåtelsevinster avseende aktier är i allmänhet inte heller skattepliktig inkomst för begränsat skattskyldiga i Finland. Undantag från denna regel utgörs av sådan överlåtelse av aktier i vissa fastighetsbolag eller bolag som förvaltar fastighetsegendom som Finland har rätt att beskatta. I beskattningspraxis har det likväl ansetts att inkomsten från överlåtelse av en andel i en specialplaceringsfond som investerar i fastigheter inte är en inkomst från Finland. 
Allmänt skattskyldiga investerare i utländska fonder 
I fråga om investeringar som finska placerare gör i utländska placeringsfonder grundar sig skattebehandlingen av andelsägarna på bedömningar som görs från fall till fall. Även om det inte finns någon uttrycklig bestämmelse om saken i skattelagen , har skattebehandlingen av en vinstandel som en finsk placerare får från en utländsk placeringsfond, det vill säga bestämningen av inkomstslaget, i praktiken berott på vilken typ av finsk aktör den utländska placeringsfonden jämställts med. Om den utländska placeringsfonden är jämförbar med en finsk placeringsfond, är inkomsten i sin helhet skattepliktig inkomst. Om den utländska placeringsfonden är jämförbar med ett aktiebolag, beskattas inkomsten som vinstutdelning som, beroende på inkomsttagaren, är antingen delvis eller helt skattefri. Även skatteavtal kan inverka på skattebehandlingen. Det är alltså fråga om liknande klassifikationsproblem som när utländska fonder investerar i finska objekt och det för källbeskattningen ska avgöras vilken typ av finsk aktör den utländska placeringsfonden närmast motsvarar. 
I praktiken har till exempel EUD:s Aberdeen-dom och avgörandet KHO:2010:15 som följde därpå ändå i rätts- och beskattningspraxis haft betydelse för huruvida inkomst som ett SICAV-bolag delar ut med hänsyn till investeraren betraktas som en vinstandel från bolaget eller som dividend. I ett färskt förhandsavgörande (ej laga kraft) har avkastning som delas ut av ett UCITS-SICAV-bolag ansetts vara skattepliktig förvärvsinkomst i sin helhet på grund av de ändrade reglerna för beskattning av vinstutdelning från år 2014. Fonder av olika form som i sina hemviststater ses som genomgångsenheter, såsom avtalsbaserade FCP-fonder med säte i Luxemburg, har i rätts- och beskattningspraxis vid beskattningen av finska placerare setts både som genomgångsenheter (HFD:2004:116) och som enheter som motsvarar finska placeringsfonder (KVL:2013/8). 
3
Föreslagna ändringar
3.1
Bakgrund
Enligt statsminister Juha Sipiläs regerings skattepolitiska riktlinjer ingår det i spetsmålen för valperioden att beskattningen sporrar till att arbeta, vara företagare, sysselsätta, ta risker, äga, investera och placera i Finland. Ett av målen är också att beskattningsförfarandena är kundorienterade och beaktar att beskattningen ska vara konsekvent, förutsägbar och trygga rättssäkerheten och tillgången till information. 
Finansministeriet tillsatte den 2 juni 2017 en arbetsgrupp med uppdrag att utvärdera skattebehandlingen av olika investeringsformer och pensioner med engångspremie. Utredningen gällde bland annat placeringsfonder och investeringar i dem. Arbetsgruppen hade också till uppgift att bedöma de problem som har konstaterats i samband med gränsöverskridande situationer till exempel i fråga om placeringsfonder. Gruppen föreslog inga ändringar i principerna för beskattningen av placeringsfonder. Den ansåg dock att skattelagstiftningen bör preciseras i inkomstskattelagen och källskattelagen. Problematiska var enligt arbetsgruppen speciellt de situationer där en utländsk fond har gjort investeringar i Finland och där Finlands rätt att ta ut källskatt på inkomst från Finland ska bedömas. 
3.2
Målsättning
Ett av syfte med propositionen är att beakta de ändringar i skattelagstiftningen som behövs på grund av föreslagna ändringar i lagstiftningen för placeringsfonder. Propositionen avses också leda till större klarhet i de situationer där en utländsk fond i beskattningen är jämförbar med en finsk placeringsfond eller specialplaceringsfond som är fri från skatt och på så sätt förbättra förutsägbarheten och rättssäkerheten i beskattningen och minska den administrativa bördan. 
I gällande inkomstskattelag definieras inte begreppet placeringsfond, vilket har lett till att man har varit tvungen att fastställa kriterier för jämförbarhet genom beskattnings- och rättspraxis. Eftersom den gällande finska skattebestämmelsen till sin karaktär är tämligen allmän, har detta kunnat leda till att utländska fonder lättare jämställs med en finsk placeringsfond. Finska placeringsfonder och specialplaceringsfonder behandlas inte nödvändigtvis på motsvarande sätt i utlandet eller så kan de annars vara föremål för en strängare reglering än utländska fonder , vilket med hänsyn till principen om konkurrensneutralitet får anses problematiskt. Ett syfte med propositionen är att ge finska och utländska fonder en likvärdig ställning i detta hänseende. 
En princip som tillämpas generellt i finsk lagstiftning är att skattebehandlingen bestäms enligt placeringsinstrumentets juridiska form. Propositionen har inte som syfte att ändra denna princip. Finska placeringsfonder och specialplaceringsfonder är avtalsbaserade arrangemang, och med propositionen avser regeringen att precisera skattelagstiftningen med hänsyn endast till finska och utländska fonder som är avtalsbaserade. 
3.3
Inkomstskattelagen
Placeringsfonder 
Det föreslås inte att behandlingen av placeringsfonder i beskattningen ändras. Däremot ska skattelagstiftningen enligt förslaget preciseras så att villkoren för skattefrihet anges exaktare i lagen. Bestämmelser om skattebehandlingen finns i den nya 20 a § i inkomstskattelagen. På motsvarande sätt föreslås det att 20 § 1 mom. 2 punkten i inkomstskattelagen ändras så att placeringsfonderna stryks från förteckningen över samfund som är fria från inkomstskatt. 
I inkomstskattelagen införs enligt förslaget som villkor för skattefrihet samma kriterier som i lagstiftningen om placeringsfonder ska anges för finska placeringsfonder. En utländsk placeringsfond kommer enligt förslaget att vara fri från skatt i motsvarande situation som en finsk. En förutsättning för skattefrihet är att placeringsfonden är avtalsbaserad, har minst 30 andelsägare och är öppen. Kravet att antalet andelsägare i en placeringsfond ska vara minst 30 säkerställer att det är fråga om genuin kollektiv placering av medel som anskaffats hos allmänheten. För såväl finska som utländska placeringsfonder ska ett av villkoren för skattefrihet vara att fonden har minst 30 andelsägare. Bestämmelser om villkoren för skattefrihet för placeringsfonder ska ingå i 1 mom. i en ny 20 a § i inkomstskattelagen. 
Med placeringsfond förstås placeringsfond enligt lagen om placeringsfonder. En närmare definition finns i 1 kap. 2 § 1 mom. 2 punkten i den nya lagen om placeringsfonder. Enligt denna avses med placeringsfond tillgångar som anskaffats genom fondverksamhet och investerats i enlighet med 13 kap. i lagen och de stadgar som fastställts i Finland samt de förpliktelser som följer av dessa tillgångar. Enligt punkten kan en placeringsfond också bestå av en eller flera delfonder. För fonder enligt fondföretagsdirektivet som inrättats i andra EES-stater används i lagen om placeringsfonder benämningen fondföretag. En definition av dessa finns i 1 kap. 2 § 1 mom. 17 punkten i lagen om placeringsfonder. Det föreslagna 20 a § 1 mom. i inkomstskattelagen, där det föreskrivs om villkoren för frihet från skatt, ska tillämpas på sådana fondföretag enligt fondföretagsdirektivet som är inrättade i en annan EES-stat, är öppna och avtalsbaserade och har minst 30 andelsägare. Avsikten med bestämmelsen är inte att avvika från den grundprincip som tillämpas generellt vid beskattningen i Finland och som innebär att skattebehandlingen bestäms enligt den juridiska formen. Avsikten är inte heller att utsträcka tillämpningsområdet för skattefrihetsbestämmelsen till andra juridiska former för fondföretag utomlands. Bestämmelsen ska alltså inte enligt förslaget tillämpas på andra former av fondföretag än de som är avtalsbaserade, och på dessa endast när angivna villkor uppfylls. 
Ett av villkoren för skattefrihet är att placeringsfonden är öppen. Med öppenhet avses i fråga om placeringsfonder att fonden är öppen för allmänheten (open to the public) och skyldig att emittera andelar och lösa in andelar (open ended). Innebörden av begreppet öppenhet kan härledas från artikel 1.2 i UCITS-direktivet, där det står som följer (understreckningar här): 
”... avses med fondföretag företag a) som har till enda syfte att företa kollektiva investeringar i överlåtbara värdepapper och/eller i andra likvida finansiella tillgångar som avses i artikel 50.1 med kapital från allmänheten och som tillämpar principen om riskspridning, och b) vars andelar på begäran av innehavarna återköps eller inlöses, direkt eller indirekt, med medel ur företagets tillgångar. En åtgärd som ett fondföretag vidtar för att säkra att börsvärdet av dess andelar inte i någon väsentlig mån avviker från fondandelsvärdet (NAV) ska jämställas med återköp eller inlösen.” 
Kravet om öppenhet ska även anses uppfyllas av en sådan alternativ åtgärd som avses i andra meningen i artikel 1.2 b i direktivet och vars syfte är att säkerställa att andelarnas börsvärde inte avviker från deras nettovärde. Ledet i fråga tillämpas på börsnoterade placeringsfonder, det vill säga ETF:er, som det i Finland för närvarande finns bara en av, men som i utlandet är vanligare. I den föreslagna lagen om placeringsfonder föreskrivs det om öppenhet i 8 kap. 8 §. Enligt motiveringarna ska det i den föreslagna paragrafen föreskrivas närmare om skyldigheten enligt fondföretagsdirektivet att hålla en placeringsfond öppen. 
Den föreslagna bestämmelsen i inkomstskattelagen ska även tillämpas på fonder med säte utanför EES-området under de förutsättningar som anges i 20 a § 1 mom. i inkomstskattelagen. Principen om fri rörlighet för kapital i FEUF ska även tillämpas i relation till stater som inte hör till EES. EUD har i sin rättspraxis ansett att det faktum att en fond inte är en fond i fondföretagsdirektivets mening inte i sig är ett tillräckligt motiv för att behandla fonden annorlunda. Även när det är fråga om en fond som inrättats i en stat utanför EES och som motsvarar finsk placeringsfond, ska den följaktligen vid beskattningen behandlas på samma sätt som en finsk fond. 
För att en utländsk placeringsfond ska anses fri från skatt med stöd av 20 a § i inkomstskattelagen, ska fonden påvisa att den till sin rättsliga och funktionella karaktär motsvarar en finsk placeringsfond. Fonden ska vara öppen (open to the public, open ended), den ska ha minst 30 andelsägare och den ska vara avtalsbaserad. För skattefrihet krävs dessutom att fonden är en fond i enlighet med den lagstiftning i hemviststatens som reglerar kollektiva investeringar. Den ska sålunda vara inrättad enligt registreringsstatens lagstiftning om fondföretag. 
För att bestämmelsen om skattefrihet för placeringsfonder ska kunna tillämpas krävs det också att det mellan Finland och registreringsstaten för den utländska fond utanför EES-området som motsvarar en finländsk gäller ett avtal om utbyte av information och att det även i verkligheten är möjligt att från registreringsstaten få tillräckliga uppgifter för att bedöma om villkoren för skattefrihet är uppfyllda. I mål C-190/12, Emerging Markets Series of DFA Investment Trust Company, ansågs att olika behandling av en utländsk fond kan legitimeras med behovet att bibehålla en effektiv skattekontroll. Enligt domen kan detta godtas som legitim grund om det inte med stöd av en avtalad skyldighet avseende ömsesidigt administrativt bistånd går att få det bekräftat hos myndigheterna i en tredjestat att villkoren för att få en viss skattefördel är uppfyllda. Det har också betydelse om systemet för utbyte av information de facto gör det möjligt för myndigheterna att i samarbete med en annan stats myndigheter kontrollera uppgifter som en utländsk placeringsfond lämnat. Bestämmelsen om möjligheten att få information som en förutsättning för skattefrihet ingår i 5 mom. i den föreslagna 20 a §. I praktiken kan en skattskyldig enligt förslaget få uppgifter om att informationsutbyte har skett endast från Skatteförvaltningen. Enligt regeringens proposition till riksdagen med förslag till lag om ändring av lagen om beskattning av delägare i utländska bassamfund (RP 218/2018 rd) ska Skatteförvaltningen som en del av sina anvisningar om tillämpningen av lagen upprätthålla en förteckning över jurisdiktioner som uppfyller bestämmelsens krav i fråga om informationsutbyte. Motsvarande förteckning kan även anses visa hur informationsutbytet genomförts på det sätt som avses i det föreslagna 5 mom. i 20 a §. Finland har omfattande giltiga skatteavtal med nästan 80 andra stater. Avtalen möjliggör också utbyte av information om beskattningen. Finland har dessutom avtal om utbyte av information med över 40 territoriella jurisdiktionsområden vilka möjliggör utbyte av information på begäran. Dessutom får Finland också handräckning med stöd av konventionen om ömsesidig handräckning i skatteärenden (FördrS 21/1995) utarbetad av Europarådet och OECD. Konventionen har undertecknats av nästan 120 territoriella jurisdiktionsområden. 
Specialplaceringsfonder 
Enligt förslaget till ändring av lagstiftningen om placeringsfonder ska specialplaceringsfonderna särskiljas tydligare från begreppet placeringsfond, varför det är nödvändig att införa bestämmelser om specialplaceringsfonder i inkomstskattelagen. 
I 3 § 4 punkten i inkomstskattelagen fastställs att placeringsfonder är samfund. Det föreslås att specialplaceringsfonder läggs till förteckningen i punkten. 
Bestämmelser om skattebehandlingen av specialplaceringsfonder finns i 2—4 mom. i den föreslagna nya 20 a §. 
En specialplaceringsfond är en AIF-fond i AIFM-direktivets mening. I motsats till en placeringsfonder behöver en specialplaceringsfonder ändå inte nödvändigtvis vara öppna för allmänheten, eftersom AIF-fonder enligt AIFM-direktivet riktar sig till professionella placerare. Det är alltså fråga om en annan typ av verksamhet än i placeringsfonder, där det alltid är fråga om kollektiva investeringar med kapital från allmänheten. Inom de ramar som AIFM-direktivet ger kan specialplaceringsfonder likväl marknadsföras till icke professionella investerare i Finland. Finska specialplaceringsfonder kan därför marknadsföras till allmänheten eller, i enlighet med 27 § i gällande lagen om placeringsfonder och när den ändrade lagstiftningen om placeringsfonder har trätt i kraft i enlighet med 4 § 2 mom. i det nya 16 a kap. i AIFM-lagen, till professionella investerare eller med sådana jämförbara förmögna fysiska personer. När en specialplaceringsfond har färre än 30 andelsägare ska samtliga andelsägare vara professionella investerare eller med sådana jämförbara förmögna fysiska personer, och fonden ska varje år dela ut minst tre fjärdedelar av vinsten för räkenskapsperioden till andelsägarna. 
Specialplaceringsfonder som har minst 30 andelsägare ska vara fria från skatt under samma förutsättningar som placeringsfonder. Bestämmelser om skattefrihet ingår i 2 mom. Enligt nuvarande lag om placeringsfonder och även enligt den AIFM-lag som ingår i förslaget till ändring av lagstiftningen om placeringsfonder är specialplaceringsfonderna i regel öppna fonder, och villkoret om minst 30 andelsägare kan anses avgränsa skattefriheten till sådana specialplaceringsfonder där det är fråga om genuin kollektiv placering av medel som anskaffats hos allmänheten. Sådana fonder kan marknadsföras till allmänheten. 
I finsk rätts- och beskattningspraxis (HFD 2015:9, KHO 2015 taltio 61 och KVL 2016/44) har öppenheten hos en finsk placeringsfond setts som en central egenskap utifrån vilken man bedömt vilket slags fond en utländsk fond ska jämställas med. Avseende har fästs vid om andelarna i fonden varierar med teckningar och inlösen. Att fonden är öppen ska följaktligen ses som en central egenskap som har varit karakteristisk för de finska placeringsfonder som varit fria från skatt enligt lag. Därför föreskrivs det i det föreslagna 2 mom. om öppenheten som ett villkor för att en specialplaceringsfond ska vara fri från skatt. 
Enligt 4 § i det föreslagna nya 16 a kap. i AIFM-lagen ska en specialplaceringsfond vara öppen för allmänheten. I en specialplaceringsfonds stadgar kan man likväl till skillnad från det som föreskrivs för placeringsfonder i 8 kap. 8 § i lagen om placeringsfonder fastställa begränsningar i öppethållandet. I motiveringarna till paragrafen nämns öppethållandet av en placeringsfond, och det fastslås att en specialplaceringsfond kan avvika från detta. En avvikelse från dagligt öppethållande syns i praktiken oftast som ett mindre frekvent öppethållande vilket till exempel i en specialplaceringsfond som investerar i andra fonder kan innebära att specialplaceringsfonden enligt sina stadgar kan vara öppen för teckning och inlösen exempelvis en gång var tredje månad. Öppethållandefrekvensen har i sådana fall samstämts med realiseringstiderna för specialplaceringsfondens placeringsobjekt. En mindre frekvent öppethållning betyder inte i sig att fonden är sluten. 
Även om en specialplaceringsfond inte marknadsförs till allmänheten kan den likväl uppfylla de krav om öppenhet som ställs på AIF-fonder. Begreppet öppenhet har förklarats upp i kommissionens delegerade förordning (EU) Nr 694/2014 av den 17 december 2013 om komplettering av Europaparlamentets och rådets direktiv 2011/61/EU vad gäller tekniska standarder för tillsyn för att avgöra typ av förvaltare av alternativa investeringsfonder, där en öppen AIF-fond definieras som följer: 
”... en AIF-fond vars aktier eller andelar, på begäran av någon av fondens aktieägare eller andelsinnehavare och innan fondens likvidationsfas eller avveckling inleds, återköps eller löses in direkt eller indirekt med hjälp av fondens tillgångar och i enlighet med de förfaranden och den frekvens som anges i dess fondbestämmelser, bolagsordning, prospekt eller emissionsdokument. 
En minskning av en AIF-fonds kapital i samband med utdelning i enlighet med dess fondbestämmelser, bolagsordning, prospekt eller emissionsdokument, inbegripet en minskning som auktoriserats genom ett beslut av fondens aktieägare eller andelsinnehavare i enlighet med dess fondbestämmelser, bolagsordning, prospekt eller emissionsdokument, ska inte beaktas vid fastställandet av huruvida AIF-fonden är av öppen typ eller ej. 
Huruvida en AIF-fonds aktier eller andelar kan vara föremål för handel på andrahandsmarknaden och inte återköps eller löses in av fonden ska inte beaktas vid fastställandet av huruvida AIF-fonden är av öppen typ eller ej.” 
I det föreslagna 3 mom. föreskrivs det om villkoren för att en specialplaceringsfond ska vara fri från skatt i en situation där antalet andelsägare är under 30 eller fonden inte kan anses vara öppen. Då är villkoren för skattefrihet att minst tre fjärdedelar av vinsten delas ut varje år, att fondens kapital uppgår till minst två miljoner euro och att samtliga andelsägare är sådana investerare som avses i 16 a kap. 4 § i AIFM-lagen. Den nuvarande lagen om placeringsfonder och även de föreslagna nya bestämmelserna i lagen om förvaltare av alternativa investeringsfonder möjliggör specialplaceringsfonder med några andelsägare och till och med en enda andelsägare, vilket i sig möjliggör skräddarsydd egendomsförvaltning. Skattefriheten gör det möjligt skjuta upp beskattningen tills avkastningen delas ut till andelsägarna eller tills fonden löser in fondandelar av andelsägare. Det har inte ansetts motiverat att möjliggöra den fördel som skatteuppskovet innebär när det gäller specialplaceringsfonder för en mindre krets av investerare. I gällande lag om placeringsfonder föreskrivs det om specialplaceringsfonders skyldighet att varje år dela ut minst tre fjärdedelar av vinsten för räkenskapsperioden med undantag för icke-realiserade värdeförändringar då specialplaceringsfonden har färre än 50 andelsägare. Enligt de föreslagna ändringarna i lagstiftningen om placeringsfonder ska det i AIFM-lagen föreskrivas om motsvarande utdelningsskyldighet för specialplaceringsfonder med färre än 30 andelsägare. Det är motiverat att i inkomstskattelagen införa en motsvarande bestämmelse som begränsar uppkomsten av den fördel som skatteuppskovet innebär. Bestämmelsen ska också tillämpas på utländska avtalsbaserade fonder som motsvarar specialplaceringsfonder. På motsvarande sätt som i fråga om finska specialplaceringsfonder ska det enligt förslaget även av utländska fonder krävas en årlig vinstutdelning av tre fjärdedelar och ett kapital på minst två miljoner euro, om fonden inte har minst 30 andelsägare eller om fonden inte är öppen. 
I den finska lagstiftningen krävs det att alla andelsägare i en specialplaceringsfond med under 50 andelsägare är professionella investerare eller med sådana jämförbara förmögna fysiska personer. I den nya 4 § i det föreslagna nya 16 a kap. i AIFM-lagen är motsvarande gräns för antalet andelsägare 30. I den nya AIFM-lagen används i stället för termen professionell investerare benämningen professionell kund som dock avser samma grupp som definieras i 1 kap. 23 § i lagen om investeringstjänster och som kallas professionella investerare i 1 kap. 2 § 21 punkten i gällande lagen om placeringsfonder. Med en förmögen privatperson som kan jämställas med professionella placerare avses placerare enligt Europaparlamentets och rådets förordningar om europeiska riskkapitalfonder (Europaparlamentets och rådets förordning (EU) nr 345/2013 av den 17 april 2013) och om europeiska fonder för socialt företagande(Europaparlamentets och rådets förordning (EU) nr 346/2013 av den 17 april 2013) (high net worth individuals). För att utländska fonder som motsvarar specialplaceringsfonder ska bli jämställda med finska fonder, det vill säga för att fonder med färre än 30 andelsägare ska vara öppna bara för vissa grupper av investerare, ska det även av utländska specialplaceringsfond i motsvarande situation krävas att andelsägarna är sådana placerare som avses i 4 § i det nya 16 a kap. i AIFM-lagen. Därför ska kravet att andelsägarna i en specialplaceringsfond med färre än 30 andelsägare ska vara investerare enligt 16 a kap. 4 § i AIFM-lagen vara ett av villkoren för skattefrihet i 20 a § 3 mom. i inkomstskattelagen. 
När det gäller de specialplaceringsfonder som i huvudsak investerar i fastigheter och fastighetsvärdepapper ska det i 20 a § 4 mom. i inkomstskattelagen föreskrivas om motsvarande vinstutdelningskrav som enligt förslaget ska införas för övriga specialplaceringsfonder med under 30 andelsägare. Oberoende av antalet andelsägare ska en specialplaceringsfond som investerar sina tillgångar huvudsakligen i fastigheter och fastighetsvärdepapper varje år dela ut minst tre fjärdedelar av vinsten för räkenskapsperioden med undantag för icke-realiserade värdeförändringar. Detta föreskrivs i 47 § i gällande lag om placeringsfonder. Motsvarande vinstutdelningskrav ingår i den föreslagna nya 5 § i 16 kap. i AIFM-lagen. I Finland är de specialplaceringsfonder som investerar i fastigheter och fastighetsvärdepapper vanligen fonder som marknadsförs till allmänheten. Enligt 1 kap. 2 § 13 a punkten i gällande lag om placeringsfonder avses med fastighet och fastighetsvärdepapper vad som föreskrivs i 3 § i lagen om fastighetsfonder (1173/1997). I den föreslagna AIFM-lagen finns inte motsvarande definition, men i 6 § i det föreslagna nya 16 a kap. ingår hänvisningar till 3 och 4 kap. i lagen om fastighetsfonder, där det föreskrivs om fastighetsfonders placeringsverksamhet och utbetalning av vinst respektive värdering av fastighetsfonders tillgångar. I 1 § i lagen om fastighetsfonder definieras fastighetsfondsverksamhet som en verksamhet där ett bolag samlar in kapital från allmänheten och, i annat syfte än byggande eller fastighetsförädling, vidareplacerar medlen huvudsakligen i fastigheter och fastighetsvärdepapper. 
Bestämmelsen om skattemyndigheternas möjlighet att få information och om motsvarande reglering i registreringsstaten som villkor för skattefrihet i 5 mom. i den föreslagna 20 a § ska även tillämpas på specialplaceringsfonder. 
På samma sätt som för placeringsfonderna ska det även för utländska specialplaceringsfonder som är jämförbara med finska specialplaceringsfonder krävas att de har inrättats i enlighet med AIFM-lagstiftningen i registreringsstaten eller, när det handlar om en stat utanför EES, i enlighet med den lagstiftning i staten som motsvarar AIFM-lagstiftningen. 
Antalet andelsägare vid inrättandet av en fond eller en tillfällig nedgång i antalet andelsägare 
I 6 mom. i den föreslagna 20 a § i inkomstskattelagen föreskrivs det om situationer där kravet om ett minsta antal andelsägare i en placeringsfond eller specialplaceringsfond ännu inte har hunnit uppfyllas när en ny placeringsfond inrättas eller där antalet andelsägare tillfälligt sjunker under trettio. 
Tidigare har det i skattelagstiftningen inte föreskrivits särskilt om minsta antalet andelsägare, utan det har föreskrivits om saken i lagen om placeringsfonder. Enligt gällande lag om placeringsfonder ska en placeringsfond ha minst 50 andelsägare. I och med de föreslagna ändringarna i lagen sjunker detta minimiantal till 30. Om det är fråga om en ny placeringsfond, har den inte nödvändigtvis genast 30 andelsägare. I förslaget till ändring av lagstiftningen om placeringsfonder förlängs den tidsperiod under vilken det antal andelsägare som fordras ska uppnås från sex månader till ett år. I en ny fond är det alltså möjligt att kravet om 30 andelsägare under det första året ännu inte har uppnåtts. Det är ändå motiverat att tillämpa skattefriheten även under det första året trots att antalet andelsägare ännu inte är tillräckligt. Detta motsvarar också den nuvarande skattebehandlingen i en situation där fonden under de första sex månaderna inte fått de 50 andelsägare som fordras. De föreslagna bestämmelserna ska enligt förslaget även tillämpas på de specialplaceringsfonder där minimiantalet 30 andelsägare inte har hunnit uppnås under det första året. 
Det är motiverat att tillämpa bestämmelsen endast på de placeringsfonder och specialplaceringsfonder som är genuint nya. Enligt lagstiftningen om placeringsfonder kan en placeringsfond eller en specialplaceringsfond uppkomma även genom en fusion eller en delning. Det föreslagna 6 mom. ska inte tillämpas vid sådana företagsarrangemang. 
I 19 kap. 7 § i den föreslagna nya lagen om placeringsfonder föreskrivs det om den situation där antalet andelsägare sjunker under trettio. Fondbolaget har då 90 dygn på sig att avhjälpa situationen, upplösa placeringsfonden eller fusionera den. Vad gäller specialplaceringsfonder ingår det i 1 § i det föreslagna 16 a kap. i AIFM-lagen en hänvisning till motsvarande paragraf i lagen om placeringsfonder. Eftersom det inte är motiverat att en sådan kortvarig och tillfällig nedgång i antalet andelsägare inverkar på fondens ställning som ett samfund som är fritt från skatt, ska en placeringsfond eller en specialplaceringsfond som har haft 30 andelsägare enligt förslaget förbli fri från skatt om antalet andelsägare tillfälligt sjunker under trettio. Fonden ska avhjälpa situationen inom 90 dygn eller alternativt upplösa fonden. 
Delfonder 
I fortsättningen ska såväl placeringsfonder som specialplaceringsfonder kunna ingå i en delfondsstruktur. Eftersom begreppet delfond är nytt i lagen om placeringsfonder och det inte nödvändigtvis är klart hurdana delfondsstrukturer som det i framtiden kommer att inrättas, ska det enligt förslaget föreskrivas om skattebehandlingen av delfonder i inkomstskattelagen. Detta är ägnat att göra skattebehandlingen av delfonder klarare och öka förutsägbarheten och rättssäkerheten i beskattningen. Enligt förslaget ska det i 20 a § 7 mom. i inkomstskattelagen föreskrivas att det på delfonder ska tillämpas vad som föreskrivs om placeringsfonder och specialplaceringsfonder. En delfond ska alltså likt placeringsfonder ja specialplaceringsfonder vara ett samfund som är fritt från skatt. 
En placeringsfond eller specialplaceringsfond med delfondsstruktur består enligt förslaget av en eller flera delfonder som kan ha en sinsemellan avvikande investeringspolitik. Det blir följaktligen möjligt att ett fondbolag i stället för att kontrollera flera placeringsfonder som alla har sin egen investeringspolitik kontrollerar en paraplyfond som består av flera delfonder. I rättspraxis har inbördes byte av fondandelar mellan två olika placeringsfonder setts som skattepliktig överlåtelse. För att andelsägarna inte ska kunna ändra sina placeringsportföljer utan skattepåföljder genom att byta andelar i delfonder sinsemellan, ska byte av en andel i en delfond till en andel i en annan på motsvarande sätt betraktas som en skattepliktig överlåtelse. Eftersom det på delfonder ska tillämpas vad som föreskrivs om placeringsfonder och specialplaceringsfonder och eftersom rättspraxis när det gäller byte av andelar i placeringsfonder får anses vara tämligen klar i detta hänseende, finns det inte behov att i inkomstskattelagen föreskriva särskilt om byte av andelar i delfonder som skattepliktig överlåtelse. Vad gäller utländska delfondsstrukturer har man i finsk rättspraxis även hittills ansett att byte av aktier i en delfond mot aktier i en annan är en skattepliktig överlåtelse. 
3.4
Källskattelagen
Till 3 § i källskattelagen ska det enligt förslaget fogas ett nytt 10 mom. som föreskriver om befrielse från källskatt för dividend i en situation där ett finskt bolag betalar dividend till en utländsk avtalsbaserad fond som motsvarar en sådan finsk placeringsfond eller specialplaceringsfond som uppfyller villkoren för skattefrihet. För att utdelning ska kunna betalas dividendtagaren skattefritt ska en utländsk fond som dividendtagare för Skatteförvaltningen visa upp en utredning om att villkoren för skattefrihet är uppfyllda. I 20 a § i inkomstskattelagen ska det föreskrivas närmare om när en finsk eller utländsk fond ska anses ha rätt till frihet från skatt. En utländsk fond ska genom en utredning klarlägga att den till sin juridiska och funktionella karaktär motsvarar en finsk skattefri placerings- eller specialplaceringsfond. När det är fråga om en utländsk specialplaceringsfond med under 30 andelsägare, ska fonden dessutom visa att villkoren i 20 a § 3 mom. i inkomstskattelagen är uppfyllda. I praktiken ska förutsättningarna för skattefrihet klarläggas för Skatteförvaltningen i samband med en ansökan om källskattekort eller behandlingen av en ansökan om återbetalning av källskatt. 
Beskattningen av en begränsat skattskyldigs fastighetsinkomst verkställs i den ordning som anges i lagen om beskattningsförfarande. Om en utländsk fastighetsfond motsvarar en finsk skattefri specialplaceringsfond som avses i 20 a § i inkomstskattelagen, är fonden inte skattskyldig i Finland för fastighetsinkomst som den förvärvar här. Om fonden inte uppfyller villkoren för skattefrihet är den skattskyldig för inkomsten, förutsatt att inget skatteavtal begränsar beskattningsrätten. I så fall är den skyldig att lämna en skattedeklaration i Finland. 
4
Propositionens konsekvenser
4.1
Propositionens konsekvenser för skatteintäkterna
Det huvudsakliga syftet med propositionen är att göra lagstiftningen klarare med hänsyn till situationer där en utländsk fond är jämförbar med en finsk placerings- eller specialplaceringsfond. Den föreslagna preciseringen av villkoren för skattefrihet i skattelagen kan leda till att de situationer där ett utländskt fondföretag är jämställs med en finsk placerings- eller specialplaceringsfond blir färre. Den föreslagna lagstiftningen kan på detta sätt inverka positivt också på avkastningen av källskatten. Eftersom syftet är att skapa större klarhet i situationer som lämnat rum för tolkning och eftersom flera av de utländska fonder som redan nu likställs med skattefria finska placerings- och specialplaceringsfonder kommer att göra det även efter ändringen, kan de faktiska konsekvenserna av förslaget för intäkterna av källskatten inte bestämmas. 
Man kan försöka bedöma eventuella konsekvenser av ändringen för skatteintäkterna utifrån befintliga uppgifter om källskatten. Beloppen av de återbetalningar av källskatt som gjorts till utländska placeringsfonder har inte kunnat presenteras på grund av att det behövliga dataunderlaget saknas. Skatteförvaltningen utarbetar endast statistik där samtliga källskatter som ska återbetalas enligt beslut ingår, och följaktligen ingår även andra återbetalningar än de som mottas av fonder. Enligt de beslut om återbetalningar till samfund som fattades 2016 återbetalades till exempel källskatt som tagits ut på utdelningar, vilken ofta gällde flera kalenderår, till ett sammanlagt belopp av 177,5 miljoner euro. År 2015 var motsvarande belopp 273 miljoner euro, och dessutom betalades över 11 miljoner i återbetalningsränta. Det är inte möjligt att specificera de återbetalningar som utländska placeringsfonder fick och som ingår i dessa belopp. Deras andel bedöms ändå vara betydande. De ändringar som nu föreslås kan delvis anses inverka på återbetalningen av källskatt till utländska placeringsfonder åtminstone så att de ger ökad klarhet i situationer som tidigare lämnat rum för tolkning, men ändringarna kommer inte nödvändigtvis att få någon faktisk inverkan de belopp som återbetalas. Det bör även noteras att återbetalningarna till utländska placeringsfonder inbegriper också de situationer där fonden jämställs med ett finskt aktiebolag och utdelningen därför är skattefri i Finland. Den föreslagna bestämmelsen avses inte ingripa i detta. 
En utländsk fond har också hos Skatteförvaltningen kunnat ansöka om ett källskattekort som gjort det möjligt för fonden att ta emot utdelning i Finland skattefritt redan i betalningsögonblicket. För sådana mottagare syns källskatten inte statistiken över återbetalningar. År 2017 ansökte till exempel 250 fonder om källskattekort. Dessutom är det möjligt att utdelningsbetalaren betalar utdelningen utan att ta ut källskatt fastän mottagaren inte har skaffat sig ett källskattekort. Sådana betalningar syns inte heller i Skatteförvaltningens statistik. 
I propositionen föreslås det att det på utländska fonder tillämpas samma krav om minst 30 andelsägare som på inhemska placeringsfonder. Placeringsfonder och utländska fondföretag är öppna fonder som marknadsförs till allmänheten, varför kriteriet om minst 30 andelsägare inte bedöms leda till att de utländska fonderna ställs utanför tillämpningsområdet. Om det emellertid finns sådana utländska fonder, innebär den föreslagna ändringen en striktare skattebehandling. När det gäller utländska specialplaceringsfonder som har under 30 andelsägare eller som är slutna, eller som huvudsakligen placerar i fastigheter eller fastighetsfonder, ska det i skattelagstiftningen anges en skyldighet att dela ut vinst som förutsättning för skattefrihet. Detta innebär en åtstramning av skattelagstiftningen. Detta skulle kunna minska incentiven för att investera i Finland. Emellertid ska en utländsk specialplaceringsfond i beskattningshänseende ha samma ställning som en finsk specialplaceringsfond, vilket eventuellt medför ökade skatteintäkter. 
4.2
Konsekvenser för myndigheterna
För Skatteförvaltningen medför behandlingen av ansökningar om återbetalning mycket administrativt arbete. I praktiken måste en utländsk placeringsfond som redan fått ett positivt beslut om återbetalning av källskatt för även kommande utdelningar hos Skatteförvaltningen ansöka antingen om ett källskattekort eller om återbetalning av källskatt. 
Den ändring som nu föreslås minskar Skatteförvaltningens administrativa börda, eftersom de oklara situationer som uppstår på grund av att den nuvarande lagstiftningen om beskattningen av placeringsfonder inte är tillräckligt utförlig kommer att bli färre. Den föreslagna ändringen utesluter dock inte helt tolkningsfrågor i förhållande till EU-rätten och den nya föreslagna regleringen kan medföra nya tolkningsfrågor. 
4.3
Konsekvenser för branschen
De föreslagna ändringarna bedöms inte få stora konsekvenser för den finska fondbranschen eftersom placeringsfonderna och specialplaceringsfonderna förblir samfund som är fria från skatt. De kriterier som införs i skattelagstiftningen är de samma som tillämpas på finska placeringsfonder och specialplaceringsfonder enligt lagen om placeringsfonder och AIFM-lagen. 
De föreslagna ändringarna bedöms öka konkurrensneutraliteten i den finska fondbranschen med hänsyn till utländska fonder, eftersom motsvarande förutsättningar för frihet från skatt ska gälla för dem som för finska fonder. 
För en utländsk bransch kan den föreslagna ändringen i några situationer betyda striktare skattebehandling, vilket kan minska incentiven att investera i Finland. 
5
Beredningen av propositionen
Finansministeriet tillsatte den 2 juni 2017 en arbetsgrupp med uppdrag att utvärdera skattebehandlingen av olika investeringsformer och pensioner med engångspremie. Utredningen gällde särskilt placeringsfonder och investeringar i dem, spar- och placeringsförsäkringar samt kapitaliseringsavtal. Till uppdraget hörde även en bedömning av skattebehandlingen av kapitalfondsstrukturer i kommanditbolagsform. Arbetsgruppen utvärderade hur välfungerande, aktuell, uppmuntrande och neutral den nuvarande skattebehandlingen av olika investeringsformer är. Den utredde också frågor som sammanhänger med placeringsfonder i gränsöverskridande situationer. Arbetsgruppens rapport publicerades den 4 maj 2018. 
Propositionen har beretts vid finansministeriet. Yttranden om utkastet till regeringspropositionen har har lämnats av Näringslivets centralförbund EK rf, Finanssiala ry, Finansinspektionen, Centralhandelskammaren, OP Gruppen, Osakesäätäjien Keskusliitto ry, Börsstiftelsen, Finlands Advokatförbund, Suomen Veroasiantuntijat ry, Företagarna i Finland rf, Skatteförvaltningen, Skattebetalarnas Centralförbund rf, biträdande professor Tomi Viitala, professor Juha Lindgren och professor Pekka Nykänen. 
I utlåtandena stöds i huvudsak de ändringar i skattelagstiftningen som föreslås på grund av ändringarna i lagstiftningen för placeringsfonder. De förordar också tydligare och precisare bestämmelser i skattelagen ned syfte att öka förutsägbarheten och rättssäkerheten i beskattningen. De föreslagna lagändringarna anses underlätta Skatteförvaltningens arbete. 
I en del av utlåtandena anses det ändå som problematiskt att endast sådana utländska placeringsfonder vars juridiska form motsvarar finska skattefria placeringsfonder, det vill säga avtalsbaserade placeringsfonder, jämställs med de finska placeringsfonderna. Som problem betraktar de den oklarhet som kvarstår vad gäller skattebehandlingen av utländska placeringsfonder i bolags- eller trustform, den valda regleringsmodellens eventuella oförenlighet med EU-rätten och de tolkningsfrågor som de föreslagna bestämmelserna för med sig. De framhåller bland annat att förslaget favoriserar en typ av utländsk fond på grundval av dess juridiska form, vilket eventuellt kan ses som förtäckt eller indirekt diskriminering. Dessutom kan jämförbarheten enligt EUD:s rättspraxis inte begränsas till fall där den utländska aktören är identisk med en finsk aktör. I utlåtandena föreslogs också att jämställningen med finska fonder ska genomföras för alla fondföretag som avses i UCITS-direktivet, och att övriga utländska verksamhetsformers jämförbarhet ska avgöras från fall till fall utifrån tydliga kriterier. I ett utlåtande framhålls också att det inte finns avgöranden av EUD i fråga om jämförbarheten mellan en utländsk och en finsk placeringsfond. Organet ifrågasätter dessutom tidpunkten för lagprojektet och nämner i det sammanhanget fall som gäller utländska fonders jämförbarhet som är under behandling i finska domstolar. Vidare lyfts i utlåtandet fram den fråga om statligt understöd som eventuellt vidlåder den valda regleringsmodellen, eftersom organet anser att den ger medelsförvaltare som kontrollerar avtalsbaserade placeringsfonder en fördel i EU-området jämfört med medelsförvaltare som kontrollerar placeringsfonder i bolags- eller trustform. 
I vissa utlåtanden anses dock den valda regleringsmodellen som ändamålsenlig och motiverad och menar att den i fråga om utländska fonder förbättrar rättssäkerheten och förutsägbarheten. De kriterier som ställts som villkor för skattefrihet ses också som motiverade med hänsyn till skattelagstiftningens syften, varför det anses osannolikt att de uppställda kraven strider mot EU-rätten. 
I en del utlåtanden framhålls att minimiantalet andelsägare bör förbli tillräckligt högt, och ser det föreslagna antalet 30 andelsägare som en lyckad kompromiss. De anser det motiverat att koppla ihop skattefriheten med ett minsta antal andelsägare, eftersom skattefriheten då gäller bara genuin kollektiv placeringsverksamhet. När ett minsta antal andelsägare fastställs, står utländska fonder i samma ställning. 
I en del utlåtanden understryks kravet att fonden är öppen som villkor för skattefrihet. De anser att kravet i förslaget lämnar rum för tolkning, och önskar att det preciseras. I ett utlåtande föreslås också att kravet om öppenhet inte ska behöva anges i lagstiftningen som ett villkor för skattefriheten, eftersom det föreskrivna minimiantalet andelsägare i kombination med kravet om vinstutdelning redan i sig begränsar skattefriheten till genuin kollektiv placeringsverksamhet. I andra utlåtanden igen har ansetts det naturligt att kräva att fonder är öppna. 
I flera utlåtanden efterlystes preciseringar i den föreslagna regleringen och i bland annat definitionerna av professionell investerare eller med en sådan jämförbar förmögen fysisk person och av fastighetsfond. I vissa utlåtanden ifrågasattes också kravet på professionella investerare eller med sådana jämförbara förmögna privata personer som villkor för andelsägare med få ägare. Det föreslogs också att en tillfällig nedgång i antalet andelsägare beaktas i lagstiftningen så sätt att den inte inverkar på skattefriheten för placeringsfonden eller specialplaceringsfonden. Det har likaså önskats preciseringar i de bestämmelser som rör vilka slag av utländska regelverk som ska anses som lagstiftning om fondföretag och om förvaltare av alternativa placeringsfonder. 
När det gäller villkoren för utbyte av information fördes det fram att informationsutbytet inte kan ses som ett villkor för skattefrihet inom EU och att det i fråga om fonder med hemvist utanför EES inte kan krävas att uppgifter fås uttryckligen av skattemyndigheter. Dessutom fördes det fram att de villkor för att en utländsk fond ska kunna jämställas med en finsk som anges i den föreslagna 20 a § i inkomstskattelagen åtminstone inte i allmänhet fordrar att information fås uttryckligen av skattemyndigheterna i fondens hemviststat. I en del utlåtanden anses dessutom att villkoret som gäller informationsutbyte är oklart, och det har föreslagits att finansministeriet eller Skatteförvaltningen ska publicera en förteckning över de stater med vilka Finland har ett giltigt avtal om utbyte av information men med vilka utbytet inte är tillräckligt för att 20 a § i inkomstskattelagen ska kunna tillämpas. 
Att behandla byte av andelar i delfonder som skattepliktig överlåtelse har setts som en motiverad lösning som står i samklang med rättspraxis. En lösning enligt vilken det inte föreskrivs särskilt om att byte av andelar i delfonder ska betraktas som överlåtelse har ansetts godtagbar, eftersom det inte är motiverat att i lag föreskriva särskilt om alla detaljer i beskattningen. Men i utlåtandena har också bedömts att tydliggörande bestämmelser om detta i inkomstskattelagen skulle klargöra och stärka det nuvarande rättsläget. I en del utlåtanden framhålls att bestämmelserna om delfonder är mycket allmänt formulerade och att detta kan leda till tolkningsfrågor. 
I ett utlåtande pekas på risken att specialplaceringsfonder som hittills varit fria från skatt efter att förslaget godkänts inte längre kommer att uppfylla villkoren för skattefrihet. Organet föreslår därför att det införs en undantagsbestämmelse för befintliga strukturer eller att övergångsbestämmelsen får en längre giltighetstid. Organet preciserar emellertid inte i vilka slags situationer skattefriheten inte längre kommer att kunna tillämpas eller hur många sådana specialplaceringsfonder det kan finnas. 
I propositionen har de synpunkter som framlagts vid remissbehandlingen beaktats i tillämplig utsträckning. Termer, definitioner och formuleringar har gjorts precisare i lagförslaget och i motiveringarna.. Begreppet öppenhet har definierats exaktare, och det utbyte av information som är ett villkor för skattefrihet har ändrats. Möjligheten att minimiantalet andelsägare i en fond underskrids tillfälligt har beaktats i lagförslagen. 
6
Samband med andra propositioner
Propositionen hänger delvis samman med regeringens proposition till riksdagen med förslag till lag om placeringsfonder och vissa lagar som har samband med den (RP 243/2018 rd) som behandlas som bäst i riksdagen. 
7
Ikraftträdande
Lagarna avses träda i kraft våren 2019. Lagarna tillämpas första gången vid beskattningen för 2020. 
I bestämmelsen om ikraftträdandet ska det för tydlighetens skull föreskrivas att bestämmelsen om skattefrihet för placeringsfonder i 20 § i gällande inkomstskattelag ska tillämpas på specialplaceringsfonder vid beskattningen för 2019. De lagförslag som ingår i förslaget till ändring av lagstiftningen om placeringsfonder avses träda i kraft den 1 mars 2019. 
Med stöd av vad som anförts ovan föreläggs riksdagen följande lagförslag: 
Lagförslag
1. 
Lag 
om ändring av inkomstskattelagen 
I enlighet med riksdagens beslut 
ändras i inkomstskattelagen (1535/1992) 3 § 4 punkten och 20 § 1 mom. 2 punkten, av dem 3 § 4 punkten sådan den lyder i lag 1736/2009 och 20 § 1 mom. 2 punkten i lag 229/1999, samt 
fogas till lagen en ny 20 a §, som följer: 
3 § 
Samfund 
Med samfund avses i denna lag 
4) aktiebolag, andelslag, sparbanker, placeringsfonder, specialplaceringsfonder, universitet, ömsesidiga försäkringsbolag, lånemagasin, ideella och ekonomiska föreningar, stiftelser och anstalter, 
20 § 
Samfund som är befriade från inkomstskatt 
Fria från skatt på inkomst är 
2) folkpensionsanstalten, kommunala pensionsanstalten, sjuk- och begravningshjälpskassorna, personalfonderna, avgångsbidragsfonderna, de riksomfattande arbetslöshetskassorna, centralkassan för arbetslöshetskassorna, arbetslöshetskassornas stödkassa, arbetslöshetskassornas stödstiftelse samt i 116 a § avsedda träningsfonder och idrottsutövarfonder för inkomster av verksamhet som nämns i 116 a §, 
20 a § 
Placeringsfonder, specialplaceringsfonder och delfonder 
En placeringsfond som avses i 1 kap. 2 § 1 mom. 2 punkten i lagen om placeringsfonder ( / ) eller en avtalsbaserad utländsk öppen placeringsfond som motsvarar den, som har minst 30 andelsägare, är fri från skatt på inkomst. 
Vad som i 1 mom. föreskrivs om placeringsfonders skattefrihet tillämpas även på specialplaceringsfonder som avses i 2 kap. 1 § 2 mom. i lagen om förvaltare av alternativa investeringsfonder (162/2014) och motsvarande utländska avtalsbaserade specialplaceringsfonder under förutsättning att de är öppna och har minst 30 andelsägare. 
Om en specialplaceringsfond som avses i 2 mom. har färre än 30 andelsägare eller den inte kan anses vara öppen, krävs för frihet från skatt dessutom att 
1) specialplaceringsfonden varje år till fondandelsägarna delar ut minst tre fjärdedelar av vinsten för räkenskapsperioden med undantag för icke-realiserade värdestegringar, 
2) specialplaceringsfondens kapital uppgår till minst två miljoner euro, och 
3) specialplaceringsfondens andelsägare är professionella investerare eller med sådana jämförbara förmögna enskilda personer på det sätt som anges i 16 a kap. 4 § i lagen om förvaltare av alternativa investeringsfonder. 
Ett villkor för att en specialplaceringsfond enligt 2 kap. 1 § 2 mom. i lagen om förvaltare av alternativa investeringsfonder eller en motsvarande utländsk avtalsbaserad specialplaceringsfond som huvudsakligen investerar sina tillgångar i fastigheter och fastighetsvärdepapper på det sätt som avses i 16 a kap. 4 § i nämnda lagen ska vara fri från skatt är att fonden varje år till fondandelsägarna delar ut minst tre fjärdedelar av vinsten för räkenskapsperioden med undantag för icke-realiserade värdestegringar. 
För en utländsk placeringsfond eller specialplaceringsfond registrerad utanför Europeiska ekonomiska samarbetsområdet krävs dessutom för skattefrihet att Finland och fondens registreringsstat har ingått ett avtal om utbyte av information i skatteärenden och att tillräckliga uppgifter fås från fondens registreringsstat för att beskattningen ska kunna verkställas och en korrekt beskattning säkerställas. Dessutom ska en placeringsfond vara inrättad enligt registreringsstatens lagstiftning om fondföretag och en specialplaceringsfond enligt det regelverk i registreringsstaten som motsvarar lagen om förvaltare av alternativa investeringsfonder. 
Det som föreskrivs i 1 och 2 mom. tillämpas också på 
1) en placeringsfond eller specialplaceringsfond som har inlett sin verksamhet trots att kravet om minst 30 andelsägare ännu inte har hunnit uppfyllas under det första året och fonden inte har uppkommit genom en fusion eller en delning, 
2) en sådan placeringsfond eller specialplaceringsfond där antalet andelsägare tillfälligt har sjunkit under 30, om fondbolaget har skridit till åtgärder som avses i 19 kap. 7 § i lagen om placeringsfonder för att avhjälpa situationen eller om fonden upplöses. 
Om placeringsfonden eller specialplaceringsfonden består av en eller flera delfonder, tillämpas på delfonderna vad som föreskrivs om placeringsfonder och specialplaceringsfonder. 
Denna lag träder i kraft den 20 . 
Denna lag tillämpas första gången vid beskattningen för 2020. 
Vad som föreskrivs om placeringsfonder det 20 § 1 mom. i inkomstskattelagen som gällde när denna lag trädde i kraft, tillämpas på specialplaceringsfonder vid beskattningen för 2019. 
2. 
Lag 
om ändring av 3 § i lagen om beskattning av begränsat skattskyldig för inkomst 
I enlighet med riksdagens beslut 
fogas till 3 § i lagen om beskattning av begränsat skattskyldig för inkomst (627/1978), sådan den lyder i lagarna 814/2008, 975/2014, 1402/2014, 532/2016 och 1490/2016, ett nytt 10 mom. som följer: 
3 § 
Källskatt ska inte betalas på dividend som betalas en utländsk avtalsbaserad fond som motsvarar en finsk placeringsfond eller specialplaceringsfond och som uppfyller de villkor för skattefrihet som anges i 20 a § i inkomstskattelagen. Ett ytterligare villkor är att dividendtagaren för Skatteförvaltningen visar upp en utredning om att villkoren för skattefrihet är uppfyllda. 
Denna lag träder i kraft den 20 . 
Denna lag tillämpas första gången vid beskattningen för 2020. 
Helsingfors den 13 december 2018 
Statsminister
Juha
Sipilä
Finansminister
Petteri
Orpo
Senast publicerat 13.12.2018 14:17