Betänkande
FvUB
8
2017 rd
Förvaltningsutskottet
Regeringens proposition till riksdagen med förslag till lag om förhindrande av penningtvätt och av finansiering av terrorism, till lag om centralen för utredning av penningtvätt samt till vissa lagar som har samband med dem
INLEDNING
Remiss
Regeringens proposition till riksdagen med förslag till lag om förhindrande av penningtvätt och av finansiering av terrorism, till lag om centralen för utredning av penningtvätt samt till vissa lagar som har samband med dem (RP 228/2016 rd): Ärendet har remitterats till förvaltningsutskottet för betänkande och till grundlagsutskottet, lagutskottet och ekonomiutskottet för utlåtande. 
Utlåtanden
Utlåtande har lämnats av 
grundlagsutskottet
GrUU 2/2017 rd
ekonomiutskottet
EkUU 5/2017 rd
lagutskottet
LaUU 3/2017 rd
Sakkunniga
Utskottet har hört 
polisdirektör
Petri
Knape
inrikesministeriet
överinspektör
Virpi
Koivu
inrikesministeriet
lagstiftningsråd
Armi
Taipale
finansministeriet
lagstiftningsråd
Arja
Manner
justitieministeriet
regeringssekreterare
Mika
Kotala
arbets- och näringsministeriet
direktör
Hannu
Ijäs
social- och hälsovårdsministeriet
statsåklagare
Ritva
Sahavirta
Riksåklagarämbetet
chefsjurist
Maarit
Pihkala
Finansinspektionen
dataombudsman
Reijo
Aarnio
dataombudsmannens byrå
överinspektör
Jemina
Fabritius
Polisstyrelsen
polisöverinspektör
Markku
Ryymin
Polisstyrelsen
kriminalinspektör
Pekka
Vasara
centralkriminalpolisen
enhetschef
Marko
Peltonen
Regionförvaltningsverket i Södra Finland
överinspektör
Taito
von Konow
Skatteförvaltningen
teamledare
Jouko
Koitto
Patent- och registerstyrelsen
ansvars- och personaldirektör
Pekka
Ilmivalta
Veikkaus Ab
expert
Santeri
Suominen
Finlands näringsliv rf
ledande expert
Mika
Linna
Finans Finland
generalsekreterare
Minna
Melender
Finlands Advokatförbund
jurist
Kristiina
Sare
Finlands Advokatförbund.
Skriftligt yttrande har lämnats av 
finansministeriet
högsta förvaltningsdomstolen
Helsingfors förvaltningsdomstol
Tullen
Ålands landskapsregering
Kepa rf.
Inget yttrande av 
utrikesministeriet.
PROPOSITIONEN
Regeringen föreslår att en ny lag om förhindrande av penningtvätt och av finansiering av terrorism ska stiftas. Syftet med propositionen är att effektivare förhindra penningtvätt och finansiering av terrorism så att lagstiftningen i större utsträckning bygger på riskbedömning. Genom propositionen genomförs Europarparlamentets och rådets direktiv om penningtvätt och finansiering av terrorism. 
Enligt den föreslagna lagen ska statsrådet, tillsynsmyndigheterna, advokatföreningen och de rapporteringsskyldiga sammanslutningarna och näringsidkarna göra en bedömning av riskerna för penningtvätt och finansiering av terrorism. Det föreslås att tillsynsmyndigheternas och advokatföreningens befogenheter förbättras och att tillsynsmyndigheterna ska bemyndigas att påföra administrativa påföljder. Vidare ska de rapporteringsskyldigas förutsättningar att identifiera sina kunder förbättras genom bestämmelser om sammanslutningars skyldighet att registrera personer med betydande ägarandelar i företag samt andra verkliga förmånstagare i sammanslutningar. Särskilda bestämmelser om registrering tas in i handelsregisterlagen, föreningslagen, religionsfrihetslagen och stiftelselagen.  
Det föreslås att en särskild lag stiftas om centralen för utredning av penningtvätt, för att understryka att det är fråga om en polisiär enhet på vilken delvis tillämpas polislagstiftningen och andra dataskyddsbestämmelser än på rapporteringsskyldiga och tillsynsmyndigheter. 
I propositionen föreslås dessutom ändringar i 25 lagar. Det är huvudsakligen fråga om hänvisningar och andra tekniska ändringar, med undantag för vissa materiella bestämmelser om registrering av verkliga förmånstagare och bestämmelser om tillsynsmyndigheter. 
Propositionen hänför sig till budgetpropositionen för 2017 och avses bli behandlad i samband med den. 
Avsikten är att lagarna huvudsakligen ska träda i kraft den 1 januari 2017 eller så snart som möjligt. 
UTSKOTTETS ÖVERVÄGANDEN
Allmänt
Propositionen ska nationellt genomföra Europaparlamentets och rådets direktiv (EU) 2015/849 (det fjärde penningtvättsdirektivet) och Europaparlamentets och rådets förordning (EU) 2015/847 (förordningen om information om betalaren). Målet är att revidera lagstiftningen om förhindrande, avslöjande och utredning av penningtvätt och finansiering av terrorism så att såväl de rapporteringsskyldiga sammanslutningarnas och näringsidkarnas som tillsynsmyndigheternas verksamhet tydligare ska grunda sig på riskbedömning än vad gällande lagstiftning förutsätter. Statsrådet, tillsynsmyndigheterna, advokatföreningen och de rapporteringsskyldiga sammanslutningarna och näringsidkarna ska göra en bedömning av riskerna för penningtvätt och finansiering av terrorism. Syftet med en riskbaserad styrning av verksamheten är att effektivisera tillämpningen av lagstiftningen. 
Den största förändringen jämfört med gällande lagstiftning är för myndigheternas del att tillsynsbefogenheterna blir mer enhetliga. Det medför också uttryckliga inspektionsbefogenheter för samtliga tillsynsmyndigheter och advokatföreningen och rätt för tillsynsmyndigheten att påföra administrativa påföljder. Den största förändringen för den privata sektorn är de nya bestämmelserna om identifiering av juridiska personers samtliga ägare och andra verkliga förmånstagare samt registrering av uppgifter om dessa. Syftet med att registrera uppgifterna centralt är att underlätta åtkomsten till uppgifterna. Det föreslås att en särskild lag ska stiftas om centralen för utredning av penningtvätt, för att understryka att det är fråga om en polisiär enhet på vilken delvis tillämpas polislagstiftningen och andra dataskyddsbestämmelser än på rapporteringsskyldiga och tillsynsmyndigheter. 
Medlemsstaterna ska senast den 26 juni 2017 sätta i kraft de bestämmelser i lagar och andra författningar som är nödvändiga för att följa det fjärde penningtvättsdirektivet. Penningtvättsdirektivet är ett s.k. minimiharmoniseringsdirektiv. För förebyggande av penningtvätt och finansiering av terrorism får medlemsstaterna, inom gränserna för unionsrätten, införa eller behålla strängare regler på det område som omfattas av detta direktiv. Förordningen om information om betalaren är däremot direkt tillämplig rätt i Finland. Med stöd av förordningen måste det likväl nationellt föreskrivas om bland annat behörighet myndighet och påförande av administrativa påföljder. I propositionens lagförslag ingår bestämmelser om övergångsperioder. Med tanke på den tidpunkt då lagförslagen eventuellt träder i kraft är det skäl att granska också de föreslagna övergångsbestämmelserna. 
Vid beredningen av propositionen stannade beredarna för att i det här sammanhanget inte föreslå att det i penningtvättslagstiftningen tas in bestämmelser om virtuella valutor. Kommissionen lämnade den 5 juli 2016 ett förslag till ändring av penningtvättsdirektivet (COM(2016) 450 final), där den föreslår att direktivet ska tillämpas också på marknadsplatser för virtuella valutor och leverantörer av plånbokstjänster. Enligt uppgift har direktivändringen redan framskridit till trilogförhandlingar, så med avseende på den nationella lagstiftningen är det ändamålsenligt att invänta EU:s lagstiftningslösningar. Förvaltningsutskottet konstaterar att virtuella valutor kan vara förknippade med avsevärd risk för penningtvätt och finansiering av terrorism, om valutan är anonym. Det är därför viktigt att penningtvättslagstiftningen tillämpas på sektorn. Bestämmelser om virtuella valutor kan fogas till penningtvättslagen exempelvis i samband med det nationella genomförandet av den nämnda direktivändringen. 
Ålands landskapsregering konstaterar i sitt yttrande till förvaltningsutskottet att propositionen berör kompetensområdena lotterier och fastighetsförmedling, som tillhör landskapets behörighet enligt självstyrelselagen för Åland (1144/1991). Landskapsregeringen anser att området penningtvätt tillhör rikets lagstiftningsbehörighet och att det därför är lämpligt att tillsynen gällande penningspelssammanslutningar, fastighetsförmedlingsrörelser och rörelser för förmedling av hyreslägenheter överförs till landskapsregeringen genom en överenskommelseförordning enligt 32 § i självstyrelselagen. Enligt uppgift pågår en dialog mellan landskapsregeringen och inrikesministeriet gällande innehållet i en överenskommelseförordning i ärendet. 
De främsta ekonomiska konsekvenserna för statsfinanserna anknyter till utvecklingen av de register och bakomliggande datasystem som den nya lagstiftningen förutsätter. Myndigheterna bedöms behöva resurser också med anledning av de nya uppgifterna och befogenheterna. Å andra sidan förväntas det faktum att tillsynen blir riskbaserad i någon mån dämpa den administrativa bördan. För företagssektorns del kommer inrättandet av den del av registret som innehåller uppgifter om verkliga förmånstagare och insamlingen av uppgifter att beröra merparten av alla inhemska juridiska personer. Också de nya förpliktelserna kommer att innebära kostnader för de företag som blir rapporteringsskyldiga enligt lagen om förhindrande av penningtvätt och av finansiering av terrorism (nedan penningtvättslagen eller den nya penningtvättslagen eller lagförslag 1). Även systemändringar kan medföra kostnader. Å andra sidan måste myndigheter och företag göra systemändringar också till följd av annan lagstiftning, exempelvis EU:s nya dataskyddsbestämmelser. 
Förvaltningsutskottet konstaterar att det är frågan om en omfattande, vittförgrenad lagstiftningsreform med en ny slags reglering och nya skyldigheter för övervakarna, företagen och de rapporteringsskyldiga. Det är därför viktigt med tillräcklig information och handledning om lagstiftningsreformen. Utskottet menar också att det är nödvändigt att följa upp hur väl lagen fungerar. Om det visar sig att lagen bör ändras, måste behövliga åtgärder vidtas så snabbt som möjligt, till exempel i samband med det nationella genomförandet av den tidigare nämnda ändringen av penningtvättsdirektivet. 
Förvaltningsutskottet vill göra statsrådet uppmärksamt på att penningtvättslagstiftning berör flera ministeriers ansvarsområden. I den nu aktuella frågan har inrikesministeriet haft föredragningsansvaret, trots att de centrala delarna av penningtvättslagstiftningen i hög grad gäller finansministeriets och justitieministeriets förvaltningsområden. När beredningsansvaret för de kommande lagändringarna i anknytning till penningtvätt fastställs bör statsrådet bedöma vilket ministerium som berörs mest av ädnringarna. 
Sammantaget sett anser förvaltningsutskottet att propositionen är behövlig och fyller sitt syfte. Utskottet tillstyrker lagförslagen i propositionen, men med följande kommentarer och ändringsförslag. Dessutom föreslår utskottet att ett lagförslag förkastas och att två nya lagförslag och ett förslag till uttalande godkänns. 
Tillämpningsområde med avseende på skadeförsäkring och penningspelsverksamhet och vikten av en riskbaserad bedömning
Ekonomiutskottet ansåg i sitt utlåtande (EkUU 5/2017 rd) att det kan anses vara utrett att skadeförsäkring är en lågriskverksamhet med avseende på penningtvätt. Dessutom skulle det i de flesta fall vara fråga om försäkringsbedrägeri. Den eventuella nytta det kan vara för kampen mot penningtvätt att identifieringsskyldigheten utsträcks till skadeförsäkring är inte tillräckligt stora i jämförelse med den börda som åsamkas företagen och konsumenterna, enligt information till utskottet. I och med att EU-lagstiftningen inte kräver att kundkontrollen i dess helhet utsträcks till skadeförsäkringssektorn föreslår ekonomiutskottet att skadeförsäkring ska falla utanför tillämpningsområdet på så sätt att tillämpningsområdet för det första lagförslagets 3 kap. 13 § om kundkontroll i fråga om personer i politiskt utsatt ställning avgränsas och att bestämmelsen tillåter förenklade åtgärder för kundkontroll vid skadeförsäkring. 
Vad gäller spel om pengar ansåg ekonomiutskottet att bestämmelserna måste garantera att förenklade åtgärder kan tillämpas på lågriskspel. Med hänvisning till inkommen information menade ekonomiutskottet att det är detta som också är målet med de föreslagna bestämmelserna. I 3 kap. 2 § i förslaget gäller skyldigheterna att identifiera kunder bara när ett fast kundförhållande etableras. Enligt motiven till propositionen avser det i spelsammanhang exempelvis att öppna ett spelkonto. Dessutom gäller skyldigheten fall som avser tröskelbelopp över 2 000 euro. Ekonomiutskottet framhöll dock att den nuvarande formuleringen ger rum för flera tolkningar vad gäller i vilka situationer de så kallade PEP-frågorna enligt 3 kap. 13 § måste ställas. För att klarlägga rättsläget föreslog utskottet att exempelvis tillämpningsområdet för 3 kap. 13 § avgränsas på samma sätt som tillämpningsområdet för 3 kap. 2 §. 
Utifrån inkommen utredning konstaterar förvaltningsutskottet att skadeförsäkring till övervägande del utgör en lågriskverksamhet i fråga om penningtvätt. Det vore dock problematiskt att för skadeförsäkringens del göra några kategoriska avvikelser i lagförslaget, eftersom samma försäkringstyp kan säljas oberoende av kund eller egendomens värde. Den brottsvinning som ligger bakom penningtvätten kan också vara kopplad till den försäkrade egendomen, även om försäkringsprodukten inte i sig utnyttjas för penningtvätt. Den gällande penningtvättslagen nämner inte heller särskilt skadeförsäkring i specialbestämmelsen om lägre krav på kundkontroll. Däremot nämns vissa typer av arbetspensionsförsäkringar och försäkringar vars premie är låg. En låg försäkringspremie betyder inte automatiskt att risken för penningtvätt eller finansiering av terrorism är låg. Frivillig pensionsförsäkring och skadeförsäkring är inte heller bosättningsbaserad försäkring på det sätt som de försäkringar som ingår i den sociala tryggheten och av vilka en del likväl också kan vara baserade på anställningsstaten. Om egendomen finns i Finland, kan den som tecknar en skadeförsäkring alltså vara bosatt i en annan stat. I en undersökning om de nationella risker som är förknippade med penningtvätt (Polisyrkeshögskolans rapporter 117) bedöms den gränsöverskridande fastighetsplaceringsverksamheten utgöra en av de största nationella riskerna. Också skadeförsäkringsbolag med hemort i andra stater inom Europeiska ekonomiska samarbetsområdet är verksamma på den finska skadeförsäkringsmarknaden. Det är av dessa skäl inte motiverat att verksamhet som redan nu är förknippad med utbjudande av tjänster på EU:s inre marknad kategoriskt utesluts från tillämpningsområdet för de skyldigheter som avses i lagstiftningen. I bilaga II till det fjärde penningtvättsdirektivet nämns uttryckligen enbart vissa typer av livförsäkringar och arbetspensionsförsäkring som försäkringsprodukter med lägre risk för penningtvätt och finansiering av terrorism än normalt. Direktivet tar inte ställning till riskerna i samband med andra försäkringsprodukter. 
Kommissionen har ännu inte slutfört bedömningen av de gränsöverskridande riskerna på EU-nivå. Riskläget på nationell nivå kan också avvika från EU:s övernationella riskbedömning, eftersom den senare enbart tar fasta på de övernationella risker som är förknippade med penningtvätt och finansiering av terrorism. Inte heller den nationella riskbedömning på statsrådsnivå, den övervakarspecifika riskbedömning eller de rapporteringsskyldigas egen riskbedömning vilka i linje med direktivet förutsätts i lagförslag 1, har ännu gjorts. Bedömningen av risknivån för de nämnda försäkringsformerna görs på det sätt som förutsätts i lagförslag 1 först när dessa riskbedömningar utförs. I undersökningen om de nationella risker som är förknippade med penningtvätt konstateras att representanterna för försäkringssektorn bedömer att risken för penningtvätt är stor eller avsevärd i samband med försäkring av värdefull egendom eller värdefulla fastigheter, fordonsförsäkringar som säljs genom bilhandlarna och förmögenhetsansvarsförsäkring. 
Utöver penningtvätt gäller propositionens lagförslag 1 också bekämpning av finansiering av terrorism. Vid finansiering av terrorism handlar det inte nödvändigtvis om att vinning av brott används, utan terrordåd kan finansieras också med lagligt förvärvade tillgångar. Det behöver inte vara frågan om stora belopp. Enligt centralkriminalpolisens bedömning kan terrorism finansieras bland annat genom frivilliga fordonsförsäkringar, vilket också förekommit på andra håll i Europa. Den uppfattningen stöds av en av FATF beställd utredning från 2015 om framväxande hotbilder och risker i fråga om finansiering av terrorism (Emerging Terrorist Financing Threats). 
Ett väsentligt inslag i kampen mot penningtvätt och terrorism är identifieringen av olika slags bindningar och förmögenhet, exempelvis ägarandelar i företag, och olika slag av utövande av inflytande. En del av den ekonomiska brottsligheten, inklusive penningtvätten och finansieringen av terrorism, har blivit alltmer professionell. Den utnyttjar inte bara lagstridiga metoder och täckföretag utan också laglig företagsverksamhet och alltmer komplicerade företags- och ägararrangemang. De här arrangemangen kan utnyttjas för att dölja tillgångar. För att motverka detta krävs att ägarandelar och utövande av bestämmande inflytande identifieras på det sätt som avses i direktivet. 
Propositionen syftar till en företagsneutral reglering som kan tillämpas på företag av olika storlek och inom mycket varierande branscher. I 3 kap 13 § i lagförslag 1 föreskrivs det om skärpta åtgärder för kundkontroll i fråga om personer i politiskt utsatt ställning. Det finns inte ett enda, obligatoriskt förfarande för att konstatera om en kund är eller har varit en person i politiskt utsatt ställning eller en sådan persons familjemedlem eller bolagspartner (PEP). I de tillämpningsanvisningar som ges i de internationella rekommendationerna är exempelvis utfrågning endast ett av flera möjliga förfaranden. Dessutom kan de rapporteringsskyldiga göra en riskbaserad bedömning i de fall där en utredning om det politiska inflytandet behövs. 
Den gällande penningtvättslagen tillåter lägre krav på kundkontroll. Förenklade åtgärder för kundkontroll kan tillämpas också i fortsättningen (3 kap. 8 § i lagförslag 1), men paragrafen nämner inga enskilda grupper av rapporteringsskyldiga, utan verksamheten grundar sig på deras egna riskbedömningar också när det gäller försäkringsverksamhet. I 3 kap. 13 § i lagförslag 1 finns en hänvisning till förenklade åtgärder för kundkontroll i fråga om vissa försäkringar som ingår i socialskyddet. Avsikten med det är enligt uppgift inte att de försäkringsbolag som säljer dessa försäkringar helt ska befrias från kundkontrollplikten i fråga om personer i politiskt utsatt ställning, utan att de inte särskilt behöver bedöma riskerna gällande penningtvätt och finansiering av terrorism. 
Med hänsyn till ordalydelsen i direktivet vore det problematiskt att kategoriskt utesluta enskilda former av affärsverksamhet från PEP-skyldigheten. När det gäller penningspelsverksamhet ska de undantag som görs med stöd av penningtvättslagen meddelas kommissionen tillsammans med en separat motivering till att verksamheten utgör en låg risk för penningtvätt. Genom förordning av statsrådet är det dock möjligt att separat bedöma speltjänster som utgör en låg risk och för vilka förfarandet kan förenklas. Enligt motiven till 3 kap. 2 § i lagförslag 1 kan man anse att ett kundförhållande ingås enbart genom att kunden registrerar sig på något sätt, exempelvis genom att öppna ett spelkonto. Skyldigheten att övervaka kundrelationen, inklusive PEP-skyldigheten, gäller därför i praktiken endast registrerade kunder. Den på direktivet grundade gränsen på 2 000 euro för enskilda avgifter för deltagande i spel innebär också att flertalet av de vanliga konsumenterna, exempelvis lottospelare, faller utanför tillämpningsområdet för kundkontrollen. Enligt utredning tillåter det riskbaserade förfarandet i princip till och med att en person i politiskt utsatt ställning inte alltid behöver kontrolleras, utan den rapporteringsskyldiga kan själv bedöma vilka risker en enskild spelprodukt är förknippad med. 
Enligt utredning till förvaltningsutskottet kommer definitionen av verkliga förmånstagare att i fråga om bostadsaktiebolag begränsa de personer som ska kontrolleras till de i handelsregistret antecknade styrelseledamöterna. Med hänsyn till att bostadsaktiebolag utgör en exceptionell form av aktiebolag syftar propositionen på den här punkten till ett minimum som uppfyller den förpliktelse direktivet ålägger. Den kund som ska kontrolleras är i första hand husbolaget, inte den enskilde styrelseledamoten. Enligt uppgift har det under lagberedningen bedömts huruvida det vore möjligt att utesluta bostadsaktiebolag och vissa andra sammanslutningar från skyldigheten att kontrollera och registrera verkliga förmånstagare. Det konstaterades dock att direktivet förutsätter att skyldigheten omfattar samtliga juridiska personer. Bostadsaktiebolag eftersträvar inte vinst och husbolagets tillgångar samlas typiskt in genom bolags- och finansieringsvederlag av delägarna och används för skötseln av den gemensamma egendomen. Risken för penningtvätt och finansiering av terrorism är därför så liten att de rapporteringsskyldiga i sina riskbedömningar ändå kunde klassificera bostadsaktiebolag som lågriskkunder utan urskiljbart politiskt inflytande.  
Tillsynsmyndigheten kan med stöd av 9 kap. 7 § i lagförslag 1 i propositionen meddela närmare föreskrifter bland annat om riskfaktorer som ska beaktas vid riskbedömningen, men den kan inte fastställa vilka kundförhållanden, tjänster eller produkter som är förenade med en högre risk än vanligt för penningtvätt och finansiering av terrorism. Exempel på riskfaktorer finns i direktivets bilagor I—III. Tillsynsmyndigheten kan dock i sin tillsyn fästa uppmärksamhet vid huruvida den rapporteringsskyldiga har bedömt riskerna på rätt sätt. Enligt direktivets artikel 48.8 ska medlemsstaterna se till att de behöriga myndigheterna beaktar den ansvariga enhetens manöverutrymme och på ett lämpligt sätt granskar de riskbedömningar som ligger till grund för detta, samt huruvida denna enhets interna riktlinjer, kontroller och förfaranden är tillräckliga och genomförs. Vid behov kan det genom förordning av statsrådet föreskrivas om lågrisksituationer, till exempel i anknytning till vissa finansierings- och försäkringstjänster och penningspelstjänster. 
Enligt inkommen utredning konstaterar förvaltningsutskottet likväl att det är nödvändigt att precisera 3 kap. 13 § i lagförslag 1 för att förtydliga vad som avses med ett förfarande som är grundat på riskbaserad bedömning. Förvaltningsutskottet hänvisar till denna del till det som sägs i detaljmotiven. 
Tröskelvärde för registrering av uppgifter om verkliga förmånstagare
Ekonomiutskottet ansåg i sitt utlåtande att allmän offentlighet är ett viktigt medel för att öka öppenheten i samhället och förtroendet mellan företagen. Ekonomiutskottet noterar att det i propositionen föreslås att uppgifter om förmånstagare ska samlas in i förmånstagarregistret om de har ett aktieinnehav eller en rösträtt över 25 procent. Vid sakkunnigutfrågningen kom det fram att förmånstagartröskeln antagligen lätt kan kringgås och att tröskeln bör sänkas till ett innehav på exempelvis 10 procent. I juli 2016 föreslog kommissionen att gränsen för innehav i vissa företag sänks till 10 procent i det fjärde direktivet om penningtvätt. Ekonomiutskottet påpekar att det behövs större insyn i företagens uppgifter om ägare och förmånstagare och att förmånstagartröskeln både i EU och nationellt bör formuleras så att den inte kan kringgås så lätt. 
Enligt utredning till förvaltningsutskottet definieras verklig förmånstagare i propositionen i enlighet med det fjärde penningtvättsdirektivet, vilket betyder att tröskeln för registrering av uppgifter om förmånstagaren i handelsregistret är en ägarandel eller rösträtt på över 25 procent. Enligt uppgift övervägdes under beredningen en lägre registreringströskel, vilket också kommissionen föreslagit i sitt förslag till ändring av direktivet. I det här stadiet ville man dock avsiktligt säkerställa att Finland håller samma linje som de övriga unionsstaterna. Därigenom förhindras att finländska företag och sammanslutningar på vilka 6 kap. i lagförslag 1 ska tillämpas inte försätts i en sämre ställning än andra företag på den inre marknaden. 
Enligt uppgift är syftet med bestämmelserna att skapa större transparens i fråga om ägarförhållandena och det bestämmande inflytandet. Den föreslagna gränsen på 25 procent har inte ansetts problematisk, eftersom ett effektivt utövande av bestämmande inflytande i praktiken kräver en relativt stor ägarandel eller rösträtt. Eftersom uppgifter om andelar i företag för närvarande saknas i det centrala registret går det inte att få exakta uppgifter om ägarandelar och storleken av andelarna. Antalet små ägarandelar, till exempel sådana som innehas av finansiärer eller företagarnas makar eller släktingar, är inte känt, men merparten av de uppgifter som ska registreras har uppskattats gälla företag med 1—3 ägare. De skulle alltså registreras också med ett tröskelvärde på 25 procent. I praktiken måste ägandet av företaget vara tämligen spritt för att en andel på 25 procent ska ge faktiskt bestämmande inflytande exempelvis enligt aktiebolagslagen. Beredarna ansåg därför att det med tanke på regleringens syfte inte är nödvändigt att utreda mindre ägarandelar. 
Förvaltningsutskottet konstaterar att tillämpningsområdet för det föreslagna 6 kap. också omfattar företag som inte berörs av skyldigheterna enligt den gällande penningtvättslagen. Skyldigheten att identifiera och registrera förmånstagare är ny för dessa företag. En registreringsskyldighet enligt det föreslagna tröskelvärdet medför i sig en administrativa börda för dessa företag, men den skulle bli än större om tröskelvärdet skulle sänkas. Enligt uppgift skulle en sänkning av gränsen vara särskilt besvärlig för stora men inte börslistade företag, eftersom de har många små ägare och ägarandelar oftare övergår till nya ägare. I vilket fall skulle en sänkning av gränsen leda till att fler företag omfattas av registreringsskyldigheten. Den administrativa bördan skulle öka också till följd av att det indirekta ägandet måste klarläggas. 
Propositionens bedömning av konsekvenserna för utvecklingen av Patent- och registerstyrelsens handelsregister grundar sig på en registreringströskel på 25 procent. Handelsregistret har för närvarande inte det datainnehåll som krävs för registrering av ägarandelar och rösträtt. Det betyder att detta innehåll måste byggas in i registret. Det har uppskattats att uppgifter om ägare och förmånstagare för cirka 300 000 företag saknas i registret. Enligt uppgift ska utvecklingen av registret inledas när lagen har antagits och anslagen är disponibla. Det behövliga anslaget, som enligt planerna ska överföras från den kompletterande budgetpropositionen till en tilläggsbudgetproposition, bygger på de uppskattade kostnaderna för ett anmälningssystem med en registreringströskel på 25 procent. Om tröskelvärdet sänks kommer kostnaderna för registerprojektet att öka betydligt. 
Det har också föreslagits övergångsperioder för företagen och registermyndigheterna. Det har föreslagits en övergångstid på två år för att bygga upp registrets datainnehåll, så i samband med genomförandet av direktivändringarna är det vid behov möjligt att beakta en sänkning av tröskelvärdet till 10 procent. Samtidigt måste också kostnaderna och övriga konsekvenser omvärderas. 
Sammanfattningsvis förordar förvaltningsutskottet den registreringströskel på 25 procent som föreslås i propositionen. Utskottet förutsätter att regeringen i samband med genomförandet av ändringarna i det fjärde penningtvättsdirektivet bedömer om tröskeln för att registrera uppgifter om verkliga förmånstagare ligger på en nivå som, också med beaktande av syftet med dessa uppgifter, säkerställer att bestämmelserna inte kan kringgås enkelt. (Utskottets förslag till uttalande
Administrativa påföljder
I 8 kap. i propositionens lagförslag 1 föreslås bestämmelser om ordningsavgifter och påföljdsavgifter. Tillsynsmyndigheten ska kunna förelägga sådana här avgifter som påföljd för överträdelse eller försummelse av skyldigheter enligt lag eller EU-förordning. Enligt propositionen ska de straffrättsliga påföljder som i dag följer av överträdelser ersättas med administrativa påföljder. De föreslagna bestämmelserna om administrativa påföljder grundar sig på den genom det fjärde penningtvättsdirektivet ålagda skyldigheten att föreskriva om effektiva, proportionella och avskräckande påföljder för brott mot direktivets verkställighetsbestämmelser. De föreslagna bestämmelserna om administrativa påföljder uppfyller enligt grundlagsutskottet huvudsakligen de krav som utskottet ställt i sin praxis. 
För juridiska personer ska den ordningsavgift som avses i 8 kap. 1 § 3 mom. i lagförslag 1 vara minst 5 000 och högst 100 000 euro. För fysiska personer ska ordningsavgiften vara minst 500 och högst 10 000 euro. Bestämmelser om påföljdsavgiftens storlek finns i 8 kap. 4 och 5 §. Påföljdsavgifter som påförs kreditinstitut och finansiella institut får uppgå till antingen högst tio procent av kreditinstitutets eller det finansiella institutets omsättning under året före gärningen eller försummelsen, eller fem miljoner euro, beroende på vilket belopp som är större. Påföljdsavgifter som Finansinspektionen påför fysiska personer får vara högst fem miljoner euro. Påföljdsavgiften får dock vara högst dubbelt så stor som den vinning som erhållits genom gärningen eller försummelsen, om vinningen kan bestämmas. En påföljdsavgift som påförs en juridisk eller fysisk person får vara antingen högst dubbelt så stor som den vinning som fåtts genom gärningen eller försummelsen, om vinningen kan bestämmas, eller en miljon euro, beroende på vilket belopp som är större. 
De gärningar som enligt den gällande lagen om förhindrande och utredning av penningtvätt och av finansiering av terrorism (503/2008) straffas med böter, dvs. brott mot kraven på kundkontroll (40 §) och rapporteringsförseelse som gäller penningtvätt (42 §), är i fortsättningen inte gärningar som leder till straffrättsligt ansvar, utan påföljden blir i dessa fall ordningsavgift i enlighet med 8 kap. 1 §. En genom direktivet tillåten påföljdsavgift enligt 8 kap. 3 § i lagförslaget kan påföras endast när en näringsidkare eller sammanslutning allvarligt, upprepade gånger eller systematiskt handlar i strid med bestämmelserna i lagen. De situationer där ordningsavgift eller påföljdsavgift kan påföras är desamma som de som anges i direktivet. 
Grundlagsutskottet (GrUU 2/2017 rd) konstaterade att de i propositionen föreslagna maximala påföljderna är tämligen stora och att de delvis förutsätts i artikel 59 i det fjärde penningtvättsdirektivet. Grundlagsutskottet konstaterade också att det utifrån lagförslaget med tillhörande motivering blir i viss mån oklart till vilken del det finns nationellt handlingsutrymme i påföljdsbestämmelserna i fråga om typen av påföljd och exempelvis ordningsavgiftens storlek. Enligt grundlagsutskottet finns det, inom de gränser som direktivet tillåter, anledning att ytterligare bedöma om typen av och storleken på påföljderna står i rätt proportion till varandra. 
Också lagutskottet (LaUU 3/2017 rd) noterade att de högsta beloppen för de påföljdsavgifter som avses i lagförslag 1 är avsevärda, vilket motsvarar direktivet. Det bedöms ha en avskräckande effekt. I direktivet föreskrivs om ett maximalt belopp för administrativa påföljder, men någon miniminivå fastställs inte. Direktivet förutsätter att en administrativ påföljd enligt dess artikel 59 kan påföras åtminstone för överträdelser som är allvarliga, upprepade och systematiska Direktivet tar inte närmare ställning till typen av påföljdsavgift. Syftet med propositionen är att göra det möjligt att tillämpa ordningsavgifter, som är lindrigare än påföljdsavgifter. Redan nu tillämpas ordningsavgifter, genom annan lagstiftning, på Finansinspektionens tillsynsobjekt när det är frågan om klart uppsåtligt och oaktsamt förfarande som likväl inte uppfyller kriterierna för en mer kännbar påföljdsavgift. Förutsättningarna för att påföra ordningsavgift föreslås motsvara kriterierna för att påföra straffrättsliga böter enligt den gällande penningtvättslagen. Bestämmelsen om ordningsavgiftens storlek grundar sig på 38 § 2 mom. i den redan gällande lagen om Finansinspektionen (878/2008). Lagförslaget syftar till en reglering som är enhetlig för de anmälningsskyldiga inom finanssektorn och till att samma intervall för ordningsavgiften kan tillämpas på samtliga anmälningsskyldiga. De avsevärda maximala beloppen för påföljdsavgifter baserar sig på en skyldighet enligt direktivet. Till övriga delar tillåter direktivet ett nationellt handlingsutrymme. Lagutskottet ansåg att det i propositionen föreslagna systemet för administrativa påföljder är motiverat i synnerhet till den del förslaget innefattar en kategori av lindrigare ordningsavgifter där nationellt handlingsutrymme tillämpas. Utifrån inkommen utredning och efter en övergripande bedömning av ärendet menade lagutskottet att de påföljder som föreslås i propositionen till sin typ och storlek kan anses vara proportionella och motiverade till den del direktivet tillåter nationellt handlingsutrymme. Förvaltningsutskottet har utifrån inhämtad utredning gjort samma bedömning. 
Grundlagsutskottet granskade bestämmelserna om administrativa straffpåföljer också med avseende på ne bis in idem-regeln. Enligt regeln får ingen lagföras eller straffas på nytt i en brottmålsrättegång i samma stat för ett brott för vilket han redan har blivit slutligt frikänd eller dömd i enlighet med lagen och rättegångsordningen i denna stat. Förbudet mot dubbel straffbarhet beaktas i lagförslag 1 genom att 8 kap. 6 § föreskriver att ordningsavgifter och påföljdsavgifter inte får påföras den som är misstänkt för samma gärning i samband med en förundersökning eller en åtalsprövning eller i ett brottmål som behandlas vid en domstol eller den som har dömts för samma gärning genom en lagakraftvunnen dom. 
I 8 kap. 9 § 2 mom. i lagförslag 1 föreslås dessutom en bestämmelse om att Rättsregistercentralen på ansökan ska återbetala redan betalda ordningsavgifter och påföljdsavgifter, om straff med stöd av 32 kap. 6—10 § i strafflagen döms ut för samma gärning som den för vilken ordningsavgiften eller påföljdsavgiften har påförts. Grundlagsutskottet hänvisar till sin praxis på senare tid och konstaterar att den föreslagna bestämmelsen om återbetalning av avgifter kan förstås som att den hänvisar till att det trots tidigare påförd ordningsavgift eller påföljdsavgift är möjligt att inleda en straffprocess eller fortsätta med en straffprocess som redan inletts. Men en sådan tolkning är inte förenlig med rättspraxis eller lagstiftningspraxis. Även om ne bis in idem-regeln vägs in i tillämpningen av lagen, menar grundlagsutskottet att bestämmelsen om återbetalning av avgiften lämpligen bör strykas. Förvaltningsutskottet föreslår nedan att bestämmelsen om återbetalning av avgiften stryks och att bestämmelserna om verkställighet preciseras på det sätt som närmare framgår av detaljmotiven. 
Vilka som påför påföljder och utövar tillsyn
De behöriga myndigheterna ska enligt direktivet ha alla befogenheter som krävs för tillsynen och för utredningen av överträdelser. Regeringen har i propositionen stannat för att föreslå den decentraliserade modellen för påförande av administrativa påföljder. Behöriga myndigheter är enligt 7 kap. 1 § i lagförslag 1 Finansinspektionen, Polisstyrelsen, Patent- och registerstyrelsen och regionförvaltningsverket. Advokatföreningen utövar tillsyn över advokaterna. Den föreslagna lösningen tar hänsyn till att tillsynsmyndigheterna sedan tidigare är grundligt insatta i den verksamhet som utövas av de näringsidkare och sammanslutningar som står under deras tillsyn och därför har de bästa förutsättningarna för att bedöma tillsynsobjektens verksamhet. Tanken är att det ska säkerställa att sakkunskapen om de rapporteringsskyldigas verksamhet bibehålls genom hela tillsyns-, undersöknings- och sanktionsförfarandet. I propositionen föreslås det att samtliga tillsynsmyndigheter ska få behörighet att påföra administrativa påföljder. Advokatföreningen, dvs. Finlands Advokatförbund, har enligt förslaget inte rätt att påföra administrativa påföljder eller meddela offentlig varning, utan förbundet ska göra en framställning till regionförvaltningsverket i sådana ärenden. Finlands Advokatförbund ska dock i det första skedet bedöma om det finns anledning att påföra en påföljd eller meddela offentlig varning. 
Utifrån inkommen utredning menar förvaltningsutskottet att propositionens förslag om vilka som ska påföra påföljder och utöva tillsyn är ändamålsenligt. Inte heller lagutskottet har något att anmärka på den lösning som föreslås i propositionen. 
Förvaltningsutskottet understryker för tydlighetens skull att det i enlighet med 7 kap. 3 § i lagförslag 1 är advokatföreningen, inte regionförvaltningsverket, som har inspektionsrätt i samband med tillsynen över advokaterna. Den inspektionsrätt i hemfridsskyddade lokaler som avses i paragrafens 3 mom. gäller inte advokater. I det momentet avses inte heller att regionförvaltningsverket skulle kunna utföra inspektioner i advokaters hemfridsskyddade lokaler. 
Lagutskottet bedömde i sitt utlåtande propositionen med beaktande av behovet att säkerställa att omständigheter som omfattas av advokathemligheten hålls hemliga också när de administrativa påföljderna behandlas vid regionförvaltningsverket. Efter granskning av den till ärendet anknytande regleringen i sin helhet ansåg lagutskottet att den föreslagna lösningen är korrekt med hänsyn till advokathemligheten. 
Sökande av ändring i Finansinspektionens beslut i frågor som avses i lagförslag 1
Bestämmelser om sökande av ändring i tillsynsmyndighetens beslut finns 9 kap. 4 § i lagförslag 1. Enligt huvudregeln i 1 mom. får ett beslut överklagas genom besvär hos förvaltningsdomstolen på det sätt som anges i förvaltningsprocesslagen. I 4 mom. finns dock en undantagsbestämmelse för de fall där Finansinspektionen är tillsynsmyndighet. I 5 mom. finns en undantagsbestämmelse för Patent- och registerstyrelsens del. 
Med stöd av den gällande lagen om Finansinspektionen (878/2008) påförs en påföljdsavgift av Finansinspektionen, om avgiften uppgår till högst en miljon euro. I annat fall påförs påföljdsavgiften av marknadsdomstolen, på framställning av Finansinspektionen. På motsvarande sätt är förfarandet för ändringssökande i samband med beslut om påföljdsavgift olika beroende på om det är Finansinspektionen eller marknadsdomstolen som påfört avgiften. Den allmänna fullföljdsdomstolen är Helsingfors förvaltningsdomstol. Regeringen föreslår inga ändringar av bestämmelserna om ändringssökande i lagen om Finansinspektionen. 
Propositionen gäller nya administrativa påföljder som också kräver särskilda bestämmelser om ändringssökande. Enligt undantagsbestämmelsen i 9 kap. 4 § 4 mom. i lagförslaget ska 73 § i lagen om Finansinspektionen tillämpas på överklagande av Finansinspektionens beslut. Formuleringen i propositionen är avsedd att betyda att när Finansinspektionen är tillsynsmyndighet ska beslutet överklagas hos marknadsdomstolen i stället för hos förvaltningsdomstolen. Något som talar för den lösningen är att Finansinspektionen har också andra lagfästa befogenheter som berör samma rapporteringsskyldiga. Det är möjligt att samma lagstridiga gärning eller försummelse samtidigt uppfyller kriterierna för överträdelse på grundval av någon annan tillämplig författning än lagförslag 1. Utan undantagsbestämmelsen i 4 mom. vore det möjligt att samma gärning då skulle behandlas i två olika domstolar. 
Med tanke på säkerställandet av en enhetlig rättspraxis menade lagutskottet i sitt utlåtande att det inte är lämpligt att de beslut av tillsynsmyndigheter som avses i lagförslag 1 i första instans överklagas hos olika domstolar beroende på huruvida tillsynsmyndigheten är Finansinspektionen eller någon annan tillsynsmyndighet. Enligt lagförslag 1 ska de myndigheter som utövar tillsyn över att lagen efterlevs ha samma befogenheter att påföra administrativa påföljder. Det är enligt lagutskottet önskvärt att bestämmelserna om ändringssökande i lagförslag 1, till den del de gäller påförande av administrativa påföljder, är så enhetliga som möjligt, eftersom det i dessa situationer uttryckligen är frågan om överträdelse av skyldigheter enligt penningtvättslagen. I detta avseende vore det ändamålsenligt att också överklaganden av Finansinspektionens beslut om påförande av påföljder för överträdelse av bestämmelser i penningtvättslagen styrs till förvaltningsdomstolarna. Därför föreslår lagutskottet i sitt utlåtande till förvaltningsutskottet att 9 kap. 4 § 4 mom. i lagförslag 1 stryks. 
Av propositionsmotiven framgår att arbetsgruppen under beredningen av propositionen övervägde att koncentrera ändringssökande i Finansinspektionens beslut till enbart Helsingfors förvaltningsdomstol i stället för till marknadsdomstolen och Helsingfors förvaltningsdomstol. Arbetsgruppen stannade dock för alternativet att ändringarna bereds vid finansministeriet i samband med ett annat lagstiftningsprojekt. Bedömningen av vilka ändringar av bestämmelserna om ändringssökande som behövs i lagen om Finansinspektionen har enligt uppgift till förvaltningsutskottet inletts. Avsikten är att en proposition om frågan ska lämnas till riksdagen under 2017. 
Förvaltningsutskottet delar lagutskottets oro i fråga om säkerställandet av en enhetlig rättspraxis. Förvaltningsutskottet konstaterar att lagstiftningen om penningtvätt gäller förhindrande och utredning av missbruk av finansieringssystemet. Betydelsefullt för säkerställandet av en enhetlig avgörandepraxis är dessutom att samtliga tillsynsmyndigheter enligt förslaget ska ha samma befogenhet att påföra administrativa påföljder. Andra frågor som ansluter till lagstiftningen om penningtvätt, däribland offentlighetsfrågor, ska likaså i första instans avgöras genom besvär hos förvaltningsdomstolarna. Med tanke på säkerställandet av en enhetlig rättspraxis i anslutning till penningtvättslagstiftningen ser också förvaltningsutskottet det därför som motiverat att sådana beslut av Finansinspektionen som avses i lagförslag 1 får överklagas genom besvär hos förvaltningsdomstolen. 
Trots det ovannämnda lagberedningsprojektet vid finansministeriet anser förvaltningsutskottet att den av lagutskottet föreslagna ändringen i fråga om överklagande av sådana beslut av Finansinspektionen som avses i lagförslag 1 kan genomföras redan i det här sammanhanget. I den proposition som behandlas här är det frågan om det nationella genomförandet av det fjärde penningtvättsdirektivet, som ska sättas i kraft senast den 26 juni 2017. Förvaltningsutskottet menar att det också med hänsyn till detta är motiverat att genomföra ändringen i det här sammanhanget och föreslår att 9 kap. 4 § 4 mom. i lagförslag 1 stryks på det sätt som framgår av detaljmotiven. 
DETALJMOTIVERING
1.
Lagen om förhindrande av penningtvätt och av finansiering av terrorism
1 kap. Allmänna bestämmelser
2 §. Tillämpningsområde.
Enligt utredning är det för tydlighetens skull motiverat att precisera underpunkterna b och c i 1 mom. 1 punkten med en hänvisning till underpunkt a.  
I den föreslagna paragrafen nämns inte sådana registreringsskyldiga AIF-förvaltare som avses i lagen om förvaltare av alternativa investeringsfonder (162/2014) och som övervakas av Finansinspektionen. Dessa omfattas av den gällande penningtvättslagen. Utskottet föreslår att det i slutet av 1 mom. 4 punkten infogas en bestämmelse om AIF-förvaltare. 
Dessutom måste det till 1 mom. 6 punkten fogas ett omnämnande av i Finland etablerade filialer till utländska försäkringsförmedlare, till vilka det finns en hänvisning också i 4 § 16 punkten underpunkt e
I 1 mom. 12 punkten föreslås det att penningtvättslagen ska tillämpas på advokater. Den föreslagna ordalydelsen ger det intrycket att lagen skulle tillämpas på advokater i en omfattning som är vidare än vad som föreskrivs i artikel 2 i det fjärde penningtvättsdirektivet. Enligt direktivet är advokater rapporteringsskyldiga när de på en klients vägnar och för dennes räkning deltar i finansiella transaktioner eller transaktioner avseende fast egendom. Enligt den exakta ordalydelsen i propositionen ska penningtvättslagen tillämpas på alla transaktioner där advokaten handlar i en klients namn eller för en klients räkning. Förvaltningsutskottet anser att bestämmelsen i 12 punkten är minst sagt flertydig och att ordalydelsen bör ändras så att den bättre motsvarar ordalydelsen i direktivet. 
Förvaltningsutskottet föreslår därför att det inledande stycket i 12 punkten ändras till formen ”advokater enligt lagen om advokater (496/1958) och på dem som biträder advokaterna, till den del det är fråga om att de handlar i en klients namn eller för en klients räkning vid finansiella transaktioner eller transaktioner avseende fast egendom eller att de i en klients namn deltar i planering eller genomförande av följande transaktioner:”. 
En motsvarande ändring bör göras i 1 mom. 13 punkten
3 §. Avgränsning av tillämpningsområdet.
Enligt förslaget ska lagen inte tillämpas på ekonomisk verksamhet som bedrivs tillfälligt eller i mycket begränsad omfattning och uppfyller vissa förutsättningar. Enligt 1 mom. 3 punkten är en förutsättning att verksamheten bedrivs av en person som inte bedriver verksamhet enligt 2 § 1 mom. 1—22 punkten som sin huvudsakliga affärsverksamhet. Enligt uppgift är avsikten att bestämmelsen ska gälla alla de rapporteringsskyldiga som avses i lagen, med undantag av dem som säljer eller förmedlar varor (24 punkten). Utskottet föreslår därför att det till 3 punkten fogas en hänvisning till 2 § 1 mom. 23 punkten, som gäller dem som utför bokföringsuppdrag enligt uppdrag. 
Förvaltningsutskottet föreslår att hänvisningen i 2 mom. rättas. 
4 §. Definitioner.
I 10 punkten definieras tillhandahållare av företagstjänster. Enligt utredning avviker 10 punkten underpunkt a innehållsmässigt från direktivets artikel 3.7, som definitionen grundar sig på. För att säkerställa en överensstämmande tolkning måste frasen ”för en tredje parts räkning” strykas. 
Enligt 11 punkten avses med en person i politiskt utsatt ställning bland annat en fysisk person som har eller har haft offentliga uppdrag som medlem av politiska partiers förvaltningsorgan (underpunkt c). I den finska språkdräkten används uttrycket ”on toiminut julkisessa tehtävässä poliittisten puolueiden hallintoelinten jäsenenä”. I artikel 3.9 i den svenskspråkiga versionen av direktivet används uttrycket ”ledamöter av politiska partiers styrelser” (”poliittisten puolueiden johtoelinten jäsenet” i den finska versionen). Enligt utredning ingick propositionens formulering redan i det propositionsutkast som publicerades efter den inledande beredningsfasen, men några särskilda motiv för användningen av en formulering som avviker från direktivet har inte lämnats. Utskottet menar att formuleringen i direktivet kan avgränsas tydligare, vilket underlättar de rapporteringsskyldigas tillämpning av 3 kap. 13 §. Utskottet föreslår därför att underpunkt c ändras i enlighet med det. De internationella rekommendationerna eller direktivet avser inte heller att definitionen ska omfatta personer på lokal nivå.  
I 12 punkten definieras familjemedlem till en person i politiskt utsatt ställning. Enligt bestämmelsen avses med en sådan bland annat make eller partner som enligt den nationella lagstiftningen i respektive land likställs med make (underpunkt a). I Finlands nationella lagstiftning jämställs registrerat partnerskap med äktenskap (8 § i lagen om registrerat partnerskap (950/2001). Detsamma gäller dock inte samboförhållande, eftersom det för samboförhållande inte finns någon motsvarande bestämmelse om kategoriskt jämställande. Jämställande av samboförhållande skulle kräva att det föreskrivs särskilt om saken. 
I punkt 16 underpunkt b hänvisas till fondföretag enligt 2 § 1 mom. 10 punkten i lagen om placeringsfonder (48/1999). I den lagen avses med fondföretag ”ett företag för kollektiva investeringar som har fått auktorisation i någon annan EES-stat än Finland och som enligt lagstiftningen i sin hemstat uppfyller villkoren i fondföretagsdirektivet". Hänvisningen borde likväl gälla finländska fondbolag enligt 2 § 1 mom. 3 punkten i lagen om placeringsfonder. Till underpunkt b måste också fogas ett omnämnande av sådana finländska AIF-förvaltare som avses i lagen om förvaltare av alternativa investeringsfonder och omfattas av definitionen ”ett företag för kollektiva investeringar som saluför sina andelar eller aktier” i artikel 3.2 d i penningtvättsdirektivet. 
Enligt inkommen utredning måste definitionen i underpunkt d preciseras så att den lyder "en försäkringsförmedlare enligt 3 § 3 punkten i lagen om försäkringsförmedling, om den förmedlar livförsäkringar och andra investeringsrelaterade tjänster". 
I punkt 17 omfattar definitionen av "företag som tillhandahåller finansiella tjänster" till följd av det breda tillämpningsområdet också sådana rapporteringsskyldiga som avses i 1 kap. 2 § 1 mom. 1—8 punkten och övervakas av Finansinspektionen. För tydlighetens skull måste paragrafens 17 punkt preciseras. Dessutom är det enligt utredning motiverat att i enlighet med artikel 3.2 f i penningtvättsdirektivet till punkten foga i Finland etablerade filialer till företag som tillhandahåller finansiella tjänster. 
3 kap. Kundkontroll
2 §. Kundidentifiering och identitetskontroll.
I den föreslagna 2 § föreskrivs om de situationer där kunden alltid måste identifieras oberoende av riskerna. Bestämmelsen gäller när ett fast kundförhållande etableras och vissa andra situationer som anges i paragrafen. 
Med transaktion avses en enskild transaktion, exempelvis en girering eller betalning av en spelavgift. Enligt 2 § 1 mom. 1 punkten, som avser sporadiska transaktioner, gäller skyldigheten att identifiera kunden inte sedvanliga händelser som inte är förenade med några betydande risker, exempelvis vanliga konsumternas transaktioner.  
Enligt artikel 11 a i direktivet ska en rapporteringsskyldig vidta åtgärder för kundkännedom när en affärsförbindelse ingås. Med avseende på bekämpningen av penningtvätt och av finansiering av terrorism har det i propositionen inte ansetts nödvändigt med kundkontroll i fråga om alla sporadiska kundrelationer eller transaktioner, i det fall att kundrelationen inte är förknippad med några särskilda risker. Uttrycket fast kundförhållande, som grundar sig på den gällande penningtvättslagen, har av dem som tillämpar lagen ansetts vara tydligare och mer ändamålsenligt, eftersom skyldigheten att vidta fullständiga åtgärder för kundkännedom då begränsas till att gälla fasta kundförhållanden som registrerats på olika sätt. Direktivet gör också åtskillnad mellan att ingå en affärsförbindelse (establishing a business relationship) och utföra enstaka transaktioner (carrying out an occasional transaction).  
I fråga om penningspelsverksamhet som avses i 2 mom. uppstår skyldigheten till kundkontroll när det är frågan om att etablera ett fast kundförhållande enligt 1 mom., när det gränsvärde som avses i 2 mom. överskrids eller när transaktionen av någon anledning är tvivelaktig (1 mom. 3 och 4 punkten).  
Av propositionens detaljmotiv framgår att det vid penningspelsverksamhet anses att ett fast kundförhållande etableras när kunden registreras på något sätt (t.ex. genom öppnande av ett spelkonto eller anteckning av kundkontrolluppgifter i ett kundregister).  
När det är frågan om spelbetalningar (t.ex. lottokuponger) som överskrider gränsvärdet, ger lagförslaget penningspelsbolaget rörelseutrymme i fråga om när kunden ska identifieras, med hänsyn till att sammanhängande spelrelaterade betalningar kan vara svåra att kontrollera särskilt vid spel som lämnas in i fysiska butiker. Lagförslaget utgår från att penningspelsbolaget ska bedöma när betalningar kan anses vara sammanhängande (t.ex. under samma dag eller vecka).  
Penningspelsbolaget kan anse det ändamålsenligt att alltid när det görs enskilda spel på över 2 000 euro identifiera kunden redan vid betalningen, med beaktande av att en så stor betalning kan anses avvika från det normala. Lagförslaget gör det dock möjligt att kontrollera kundens identitet senast vid utbetalningen av vinsten. Kundkontrollen kan alltså i fråga om sammanhängande betalningar utföras också när vinsten betalas ut.  
I kapitlets 4 § föreskrivs om skyldigheten att följa kundförhållandet i situationer där kunden har identifierats. Till exempel ska bankerna fästa vikt vid transaktioner som, med hänsyn till kundens normala verksamhet, avviker från det normala. Vid penningspelsverksamhet kan ett kundförhållande i praktiken följas först när det fråga om ett registrerat fast kundförhållande.  
Bestämmelserna i 13 § (skärpta åtgärder för kundkontroll i fråga om personer i politiskt utsatt ställning) avser i enlighet med direktivet skyldigheter som kompletterar 2 §. En rapporteringsskyldig kan om den så vill kontrollera uppgifterna om en person i politiskt utsatt ställning samtidigt som andra kundkontrolluppgifter samlas in. Det är dock inte det enda korrekta sättet att utreda politisk utsatthet, och syftet med paragrafen är inte att föreskriva att en viss metod ska tilllämpas.  
De på riskbaserad bedömning grundade förfarandena som avses i 13 § innebär att det inte är nödvändigt att utreda om en kund är en person i politiskt utsatt ställning i samtliga de situationer där kunden ska identifieras enligt 3 kap. 2 §, såvida inte någon särskild risk för penningtvätt och finansiering av terrorism är förenad med produkten eller tjänsten eller kundförhållandet. De på riskbaserad bedömning grundade förfarandena behandlas närmare i samband med den nämnda 13 §.  
I 5 mom. föreskrivs det att om kunden ska identifieras och identiteten kontrolleras på grund av att det sammanlagda värdet av enskilda transaktioner i sådana fall som avses i 1 mom. 2 punkten är minst 10 000 euro eller i sådana fall som avses i 2 mom. minst 2 000 euro, ska identiteten kontrolleras när den nämnda gränsen nås. Enligt utredning borde 5 mom. ha hänvisat också till de fall som avses i 1 mom. 1 punkten. Enligt den punkten ska kundkontroll utföras om en enskild transaktion eller flera sammanhängande transaktioner sammanlagt uppgår till minst 10 000 euro och kundförhållandet är tillfälligt, eller om det är fråga om en sådan överföring av medel enligt artikel 3.9 i förordningen om information om betalaren, som överstiger 1 000 euro. Utskottet föreslår att 5 mom. kompletteras på det ovan avsedda sättet. 
7 §. Fullgörande av skyldigheter i fråga om kundkontroll för den rapporteringsskyldigas räkning.
Enligt 6 mom. i paragrafen kan tillsynsmyndigheten anse att en penningspelssammanslutning i egenskap av rapporteringsskyldig uppfyller de förutsättningar som föreskrivs i denna paragraf, om en näringsidkare eller sammanslutning enligt 1 kap. 2 § 2 mom. som handlar på dess vägnar och förmedlar deltagaranmälningar och -avgifter i anslutning till penningspel iakttar bestämmelserna om kundkontroll i 1, 2 och 10 § i detta kapitel, och om penningspelssammanslutningen på begäran utan dröjsmål av denna får uppgifter om kundkontroll och för kontroll av en kunds identitet. 
Enligt utredning avser bestämmelsen den miniminivå på vilken penningspelssammanslutningen anses följa skyldigheterna enligt lagförslag 1 när den anlitar ombud för att fullgöra skyldigheterna enligt de paragrafer som nämns där. En penningspelssammanslutning befrias dock inte från ansvar för skyldigheterna i denna lag genom att överföra kundkontrollen till ombud (8 mom.). Också riskbedömningen ligger helt på penningspelssammanslutningens ansvar. Penningspelssammanslutningen har i bestämmelsen avsiktligt getts rörelseutrymme att avgör hur det är mest ändamålsenligt att ordna överföringen av uppgifterna. Penningspelssammanslutningarna ska på det sätt som avses i 4 § 2 mom. fortlöpande följa upp kundförhållanden där en tredje part har vidtagit åtgärder för kundkontroll (7 mom.)
Enligt utredning utför penningspelssammanslutningens ombud kundidentifiering och kontroll av kunders identitet för penningspelssammanslutningens räkning som ett moment i förmedlingen av deltagaranmälningar och -avgifter i anknytning till penningspel. Samtidigt som en kunds identitet kontrolleras, fyller ombudet i identifieringsuppgifterna för kunden och andra begärda uppgifter antingen direkt i försäljningsterminalen för penningspel eller på en pappersblankett som gjorts upp av penningspelssammanslutningen. Ombudet ska utan dröjsmål lämna identifieringsuppgifterna till penningspelssammanslutningen. Utskottet konstaterar att frasen ”på begäran” i 6 mom. måste strykas för att bestämmelsen ska motsvara sitt syfte. 
Kundidentifiering och kontroll av kunders identitet innebär behandling av personuppgifter. Behandling av personuppgifter är förknippad med särskilda lagstiftningsmässiga krav. Eftersom ombuden inte är rapporteringsskyldiga enligt 1 kap. 4 § 1 mom. 5 punkten är det med hänsyn till kundernas integritet ändamålsenligt att ombuden behandlar de aktuella personuppgifterna endast på uppdrag av en penningspelssammanslutning och för dess räkning. 
8 §. Förenklade åtgärder för kundkontroll.
I 2 mom. föreslås ett bemyndigande att utfärda förordning, enligt vilket genom förordning av statsrådet utfärdas närmare bestämmelser om sådana kunder, produkter, tjänster, transaktioner, leveranssätt och geografiska riskfaktorer som kan vara förenade med låg risk för penningtvätt eller finansiering av terrorism samt om förfarandena i sådana situationer. 
Utifrån inkommen utredning poängterar förvaltningsutskottet att tillämpningen av förenklade åtgärder för kundkontroll inte kräver att statsrådet utfärdat en förordning, utan den rapporteringsskyldiga kan tillämpa förenklade åtgärder utifrån sin egen riskbedömning. Riskbedömningen måste dock dokumenteras. Enligt utredning är syftet med förordningen att stödja de rapporteringsskyldigas verksamheten genom att det utfärdas närmare bestämmelser för situationer där det anses behövligt. De här situationerna kan exempelvis gälla finansieringsavtal som avses i statsrådets förordning om lägre krav på kundkontroll när det gäller vissa finansieringsavtal vid förhindrande och utredning av penningtvätt och av finansiering av terrorism (1204/2011) eller försäkringsprodukter som är förenade med låg risk för penningtvätt eller finansiering av terrorism. Det är dock möjligt att beakta också andra situationer. 
10 §. Skärpta åtgärder för kundkontroll.
I 2 mom. föreslås ett bemyndigande att utfärda förordning, enligt vilket genom förordning av statsrådet utfärdas närmare bestämmelser om sådana kunder, produkter, tjänster, transaktioner, leveranssätt och geografiska riskfaktorer som är förenade med extra hög risk för penningtvätt eller finansiering av terrorism samt om förfarandena i sådana situationer. Inte heller tillämpningen av skärpta åtgärder för kundkontroll kräver att statsrådet utfärdar förordning. 
13 §. Skärpta åtgärder för kundkontroll i fråga om personer i politiskt utsatt ställning.
I paragrafen föreskrivs det om den rapporteringsskyldigas skyldighet att vidta skärpta åtgärder för kundkontroll i fråga om personer i politiskt utsatt ställning. Bestämmelsen motsvarar i huvudsak 20 § i den gällande penningtvättslagen. Den största ändringen jämfört med nuläget är att bestämmelsens tillämpningsområde utvidgas så att det i enlighet med det fjärde penningtvättsdirektivet omfattar inte bara utländska utan även inhemska personer i politiskt utsatt ställning. 
Det fjärde penningtvättsdirektivet kräver att alla rapporteringsskyldiga har lämpliga riskhanteringssystem på plats, inklusive riskbaserade förfaranden, för att kunna avgöra om kunden eller kundens verkliga huvudman är en person i politiskt utsatt ställning. Artikel 20 i direktivet genomför FATF:s rekommendation 12, men enligt den behöver endast alla aktörer inom finanssektorn ha lämpliga riskhanteringssystem. Direktivet avser också att kundkontrollen i fråga om personer i politiskt utsatt ställning och den löpande övervakningen i samband därmed ligger på samma nivå oberoende av om kunden är inhemsk eller utländsk. FATF:s rekommendation kräver bara skäliga åtgärder för avgöra om kunden är en person i politiskt utsatt ställning, och förutsätter att de åtgärder som avses i direktivet vidtas endast vid kundförhållanden som är förknippade med hög risk. Kraven i direktivet är alltså klart strängare än de i FATF:s rekommendation. Det mest väsentliga vid utformningen av bestämmelsen är därför att säkerställa att direktivet genomförs korrekt. 
Enligt 1 mom. ska de rapporteringsskyldiga ha lämpliga på riskbaserad bedömning grundade förfaranden för att konstatera om en kund är eller har varit en person i politiskt utsatt ställning eller en sådan persons familjemedlem eller medarbetare. 
Enligt propositionens detaljmotiv ska en rapporteringsskyldig ha lämpliga på riskbaserad bedömning grundade förfaranden för att konstatera om en kund är eller har varit en person i politiskt utsatt ställning eller en sådan persons familjemedlem eller medarbetare. Den rapporteringsskyldiga kan sålunda anpassa förfarandet till de risker för penningtvätt och finansiering av terrorism som är förenade med kundförhållandena och verksamheten. 
Enligt utredning till förvaltningsutskottet är avsikten i propositionen att den rapporteringsskyldiga ska ha möjlighet att låta bli att utreda kundens status, om det kan motiveras med den riskbaserade bedömningen. Förfarandena för en riskbaserad bedömning tillåter exempelvis att den rapporteringsskyldiga inte utreder om en person är i en politiskt utsatt ställning samtidigt som kunden identifieras och identiteten kontrolleras. I stället kan den rapporteringsskyldiga göra utredningen av personens politiska utsatthet i efterhand, dock utan obefogat dröjsmål. 
Av de skäl som anförs i utskottets överväganden är det motiverat att precisera 3 kap. 13 § för att undvika oklarheter i fråga om tolkningen. Förvaltningsutskottet föreslår att det till paragrafen fogas ett nytt 2 mom., enligt vilket den politiska utsattheten alltid ska utredas inom ramen för det förfarande som avses i 1 mom., om den rapporteringsskyldiga utifrån den i 2 kap. 3 § avsedda riskbedömningen bedömer att ett kundförhållande eller en enskild transaktion är förenad med en extra hög risk för penningtvätt och finansiering av terrorism. 
Utskottets förslag till nytt 2 mom. betyder att alla rapporteringsskyldiga ska ha förfaranden för riskbaserad bedömning. Inom ramen för detta förfarande kan den rapporteringsskyldiga utifrån riskbedömningen själv avgöra i vilka situationer den måste utreda om en kund är eller har varit en person i politiskt utsatt ställning respektive när en sådan utredning kan göras utifrån en prövning av det enskilda fallet. Enligt utskottets förslag måste det i vilket fall alltid utredas om en kund är eller har varit en person i politiskt utsatt ställning, när ett kundförhållande eller en enskild transaktion är förenad med extra hög risk för penningtvätt och finansiering av terrorism. Så kan fallet vara exempelvis om en i en annan stat bosatt person köper en skadeförsäkring för en värdefull fastighet eller bostad i Finland. På motsvarande sätt kan den rapporteringsskyldiga inom ramen för ett förfarande för riskbaserad bedömning avgöra att den inte behöver utreda om en kund är eller har varit en person i politiskt utsatt ställning, när det är frågan om en transaktion som inte är förenad med någon särskild risk för penningtvätt och finansiering av terrorism. Det kan till exempel gälla sedvanligt penningspel, där det gränsvärde som anges i 3 kap. 2 § 2 mom. sällan överskrids. Å andra sidan bör den rapporteringsskyldiga i enskilda fall bedöma kundförhållandet separat, om spelhändelsen är förenad med något som avviker från det normala eller om den rapporteringsskyldiga misstänker penningtvätt eller finansiering av terrorism. 
Av utskottets förslag följer att propositionens 2 mom. blir 3 mom. Utskottet föreslår en teknisk ändring av 3 mom. 1 punkten i den finska språkdräkten, varvid uttrycket "ylimmän johdon" ändras till "ylemmän johdon". Ändringen påverkar inte den svenska språkdräkten. På motsvarande sätt blir 3 mom. i propositionen 4 mom. enligt utskottets förslag. 
I propositionens 4 mom. finns en specialbestämmelse om obligatoriska försäkringar som hör till den sociala tryggheten. Med hänsyn till det nya 2 mom. är bestämmelsen onödig, eftersom det nya 2 mom. gäller alla grupper av rapporteringsskyldiga, även arbetspensionsförsäkringsbolag. Förvaltningsutskottet föreslår därför att 4 mom. i propositionen stryks. 
5 kap. Registret för övervakning av penningtvätt
4 §. Uppgifter som ska föras in i registret för övervakning av penningtvätt samt anmälan om ändringar.
Enligt det föreslagna 5 kap. 3 § 3 mom. ska sökanden i sin ansökan om att införas i registret för övervakning av penningtvätt uppge den näringsverksamhet som bedrivs och som ligger till grund för sökandens rapporteringsskyldighet. Förvaltningsutskottet anser att det för en i 4 § 1 mom. 1 punkten avsedd enskild näringsidkares del är behövligt att i registret också anteckna den näringsverksamhet som avses i nämnda 3 § 3 mom. Utskottet föreslår att en bestämmelse om detta införs i en ny 3 punkt
Enligt utredning har regionförvaltningsverket dessutom med anledning av sin tillsynsuppgift behov av att i registret anteckna vilka personers tillförlitlighet som har utretts i enlighet med 5 kap. 5 §. I registret antecknas personens namn, personbeteckning eller, om sådan saknas, födelsedatum samt medborgarskap och ställning hos den registrerade. Utskottet föreslår att det till momentet fogas en ny 4 punkt om detta. 
Av detta följer att 3 och 4 punkten i RP i stället blir 5 och 6 punkten
5 §. Tillförlitlighet.
I paragrafen föreslås det bestämmelser om bland annat kriterierna för bedömning av tillförlitligheten. Under utskottsbehandlingen har det framgått att paragrafens 2 mom. 1 punkt och den till den punkten kopplade rätten att få uppgifter som avses i 5 mom. inte motsvarar varandra. För att rätta till detta föreslår förvaltningsutskottet att 2 mom. 1 punkten preciseras genom ett omnämnande av de offentliga avgifter enligt 5 mom. som bestämmelsen ska gälla. 
Enligt utredning till förvaltningsutskottet måste avgiftsfriheten för de uppgifter som Enheten för utredning av grå ekonomi producerar för regionförvaltningsverket beaktas i 5 mom. 
Det finns också en inbördes konflikt mellan 3 mom. och 6 mom. För att rätta till detta föreslår utskottet att ordalydelsen i 6 mom. preciseras så att den motsvarar ordalydelsen i 3 mom. Enligt utredning berörs dessutom överlåtelsen av uppgifter enligt 6 mom. av samma krav på att hanteringen av personuppgifter är behövlig som gäller för 5 mom. Utskottet konstaterar att det ska föreskrivas i lag om detta och föreslår att en bestämmelse om detta fogas till 6 mom. 
Utskottet konstaterar att ordalydelsen i 7 mom. måste preciseras. Den datasäkra lösning som avses i momentet kan vara något annat än en teknisk anslutning. 
7 §. Utlämnande av uppgifter ur registret för övervakning av penningtvätt.
Enligt propositionen ska det vid regionförvaltningsverket inrättas ett register för övervakning av penningtvätt i vilket det med stöd av penningtvättslagen registreras uppgifter om rapporteringsskyldiga som övervakas av regionförvaltningsverket, med undantag för dem som är auktoriserade tillsynsobjekt eller som redan är registrerade som regionförvaltningsverkets tillsynsobjekt enligt någon annan lagstiftning. Avsikten är att anmälningar till registret ska göras elektroniskt och att också eventuella registerförfrågningar ska göras elektroniskt. 
I 7 § 2 mom. sägs det att trots bestämmelserna i 16 § 3 mom. i lagen om offentlighet i myndigheternas verksamhet (621/1999) får regionförvaltningsverket lämna ut personuppgifter ur registret i form av utskrifter eller göra dem allmänt tillgängliga i ett elektroniskt datanät eller i övrigt lämna ut dem i elektronisk form. 
Grundlagsutskottet har fäst uppmärksamhet vid att regionförvaltningsverket ska få göra personuppgifter i registret för övervakning av penningtvätt allmänt tillgängliga i ett elektroniskt datanät. Grundlagsutskottet har ansett att det enligt grundlagen är möjligt att offentliggöra personuppgifter i form av en offentlig informationstjänst så som regeringen nu föreslår, om argumenten för det är godtagbara med tanke på garantierna för rättsskydd och de grundläggande fri- och rättigheterna. Med avseende på skyddet för privatlivet och för personuppgifter är det dock enligt grundlagsutskottet väsentligt att det i webbaserade personregister av den föreslagna typen inte går att söka uppgifter på stora grupper utan till exempel bara genom enskild sökning. Inom ramarna för det direktiv som ska genomföras ser grundlagsutskottet det ändå som viktigt att det aktuella lagförslagets bestämmelser om offentliga informationstjänster kompletteras med en i fråga om registrets innehåll och syfte motiverad restriktion som avser att sökningarna är enskilda. 
Enligt vad förvaltningsutskottet erfar ska överlåtelsen av uppgifter ordnas genom att de i tillämpliga delar görs allmänt tillgängliga via en elektronisk tjänst. Användarna av den elektroniska tjänsten kan söka efter registrerade uppgifter genom enskilda sökningar av företags- och organisationsnummer, firma eller bifirma. Vidare kan användaren göra sökningar utifrån näringsverksamheten på så sätt att sökresultatet är en förteckning över samtliga rapporteringsskyldiga som registrerats på grundval av en viss näringsverksamhet. Avvikande från vad som sägs i propositionsmotiven är avsikten inte att begränsa möjligheterna att söka uppgifter så att samma sökande under ett dygn ska kunna söka uppgifter endast om ett begränsat antal företag. Det ska inte vara möjligt att genom den elektroniska tjänsten söka uppgifter som antecknats i registret med stöd av den nya 4 punkt (tillförlitlighet) som förvaltningsutskottet föreslår bli infogad i 4 § 1 mom. 
Sökningarna av personuppgifter riktar sig i den elektroniska tjänsten endast till personuppgifter som är offentliga, och uppgifter kan sökas endast som enskilda sökningar. De här personuppgifterna kan avgränsas till grunduppgifterna. Med tanke på regleringen i dess helhet och lösningarna för den elektroniska tjänsten ser förvaltningsutskottet det inte som behövligt att i 7 § inkludera en bestämmelse som motsvarar kravet på enbart enskilda sökningar i registerlagstiftningen för yrkesutbildade personer inom hälso- och sjukvården (GrUU 32/2008 rd). Det register som avses där avviker också från det nu aktuella registret för övervakning av penningtvätt. Efter bedömning av grundlagsutskottets utlåtande och bestämmelserna om registret för övervakning av penningtvätt föreslår förvaltningsutskottet dock att 2 mom. preciseras så att det av bestämmelsen tydligt framgår vilka personuppgifter som kan göras tillgängliga genom ett allmänt datanät eller lämnas ut i form av utskrifter, genom teknisk anslutning eller på något annat sätt i elektronisk form. De här uppgifterna omfattar enligt förslaget en fysisk persons namn och födelsedatum. 
Som det konstaterades ovan är avsikten att användaren av den elektroniska tjänsten ska kunna göra sökningar utifrån näringsverksamheten på så sätt att sökresultatet är en förteckning över samtliga rapporteringsskyldiga som registrerats på grundval av en viss näringsverksamhet. Det framgår dock inte klart av formuleringen i 1 mom., så utskottet föreslår att 1 mom. kompletteras med en bestämmelse om detta. Enligt utskottets uppfattning är en sådan sökning i praktiken en sökning av uppgifter på stora grupper. I huvudsak vore det frågan om företagsuppgifter, men enligt utskottets uppfattning ingår också personuppgifter, eftersom bestämmelsen även gäller uppgifter som avses i 4 § 1 mom. 1 punkten. Med hänsyn till grundlagsutskottets utlåtande anser förvaltningsutskottet att det i 2 mom. bör ingå ett omnämnande av att personuppgifter i ett elektroniskt datanät endast kan sökas som enskilda sökningar. 
I andra meningen i 2 mom. föreskrivs dessutom om de villkor under vilka regionförvaltningsverket får lämna ut personbeteckningens slutled ur regionförvaltningsverkets register för övervakning av penningtvätt. I paragrafen saknas dock en uttrycklig bestämmelse, motsvarande den som föreslås i 1 a § i handelsregisterlagen, om att en förutsättning för att personbeteckningens slutled ska lämnas ut är att den som begär uppgifterna ger registermyndigheten en utredning om att uppgifterna skyddas på ändamålsenligt sätt. I 3 mom. finns visserligen en allmän bestämmelse om skyldigheten att lämna en utredning. 
Utskottet ser det som motiverat att bestämmelsen om förutsättningarna för att lämna ut personbeteckningens slutled ur registret för övervakning av penningtvätt motsvarar bestämmelsen i handelsregisterlagen. Utskottet föreslår därför att sista meningen i 2 mom. flyttas till 3 mom. och att det momentets bestämmelse om ändamålsenligt skydd av uppgifter preciseras så att den gäller utlämnande av personbeteckningens slutled. Dessutom verkar det som om 3 momentets första mening om att lämna ut uppgifter genom teknisk anslutning eller på något annat sätt i elektronisk form överlappar med det som föreslås i 2 mom., så utskottet föreslår att meningen stryks. 
Förvaltningsutskottet noterar vidare att det i propositionens detaljmotiv sägs att kravet på ändamålsenligt informationsskydd inte gäller utlämnande av uppgifter som ska offentliggöras elektroniskt över det allmänna datanätet. Utskottet konstaterar att skyddet av personuppgifter regleras i personuppgiftslagen (523/1999) som allmän lag och den samtidigt stiftade lagen om offentlighet i myndigheternas verksamhet (621/1999), vilka tillsammans utgör ett lagstiftningskomplex om skyddet av personuppgifter. Utskottet inskärper att den registeransvariga är skyldig att i enlighet med personuppgiftslagstiftningen skydda uppgifterna på ett ändamålsenligt sätt i personregistret och när uppgifterna lämnas ut, oberoende av på vilket sätt den elektroniska överlåtelsen genomförs i tekniskt avseende. För att öppna en teknisk anslutning till regionförvaltningsverkets register eller på något annat sätt lämna ut uppgifterna elektroniskt krävs det dessutom att regionförvaltningsverket fattar ett beslut om att lämna ut uppgifter. 
6 kap. Uppgifter om förmånstagare
2 §. Sammanslutningars skyldighet att upprätthålla information om verkliga förmånstagare.
Enligt propositionen är de rapporteringsskyldiga som avses i 1 kap. 4 § 5 punkten skyldiga att identifiera de verkliga förmånstagarna i de företag och sammanslutningar som är deras kunder. Bestämmelser om dessa finns i 1 kap. 5 och 7 §. Enligt 3 kap. 6 § i lagförslaget ska en kunds verkliga förmånstagare alltid identifieras i sådana situationer som avses i 1 kap. 5 § 2—4 mom. och 7 §. 
Dessutom kräver direktivet att medlemsstaterna i sin lagstiftning säkerställer att också de företag och sammanslutningar som utgör sådana kunder som avses ovan själva upprätthåller uppgifter om sina verkliga förmånstagare. I 6 kap. föreslås det bestämmelser om detta. 
Med beaktande av detta anser förvaltningsutskottet att hänvisningarna till verkliga förmånstagare i 6 kap. 2 § 1 och 2 mom. är oklara. Enligt utredning är syftet med dessa moment att proportionalisera skyldigheten att identifiera den verkliga förmånstagaren mot företagets möjligheter att få uppgifter om den verkliga förmånstagarens ställning. I de enklaste fallen kan förmånstagarens ställning utläsas av aktieägarförteckningen eller handelsregistrets anteckning om styrelsen. Å andra sidan kan förmånstagarens ställning grunda sig på exempelvis ett delägaravtal eller på utövande av faktiskt bestämmande inflytande, varvid företagets möjligheter att få information är begränsade. Faktiskt bestämmande inflytande kan i princip utövas också genom små ägarandelar eller långa ägarkedjor. Utgångspunkten vid fastställande av den verkliga förmånstagarens ställning är enligt utredning att ett företag ska utnyttja alla omständigheter som det har kännedom om. Ett företags skyldighet att aktivt utreda saken måste dock ställas i relation till utredningsmöjligheterna, så att företaget inte förorsakas oskälig administrativ börda. 
Med tanke på det som i 3 kap. 6 § 1 mom. föreskrivs om en rapporteringsskyldigs skyldighet att alltid identifiera verkliga förmånstagare i sådana situationer som avses i 1 kap. 5 § 2—4 mom., är det enligt förvaltningsutskottet konsekvent att också bestämmelsen om kundernas skyldighet att aktivt upprätthålla information om verkliga förmånstagare hänvisar till samma bestämmelser. Utskottet föreslår att det i 1 mom. infogas en precisering om detta. 
Enligt 3 kap. 6 § 1 mom. ska dessutom de rapporteringsskyldiga med beaktande av de risker för penningtvätt och finansiering av terrorism som är förenade med en kund, på ett ändamålsenligt sätt och i en tillräcklig omfattning utreda om någon annan utövar sådant bestämmande inflytande över kunden som avses i 1 kap. 5 § 1 mom. Av de skäl som nämns ovan måste också bestämmelsen i 2 mom. preciseras i detta avseende. 
4 §. Registrering av sammanslutningars verkliga förmånstagare.
I propositionen föreslås det att det för tydlighetens skull i paragrafen införs bestämmelser med hänvisningar till handelsregisterlagen (129/1979), föreningslagen (503/1989), religionsfrihetslagen (453/2003) och stiftelselagen (487/2015), i vilka det föreskrivs om registrering av uppgifter om personer som ska anses vara verkliga förmånstagare. På motsvarande sätt ändras handelsregisterlagen så att uppgift om verkliga förmånstagare ska antecknas i registret. Uppgifterna om förmånstagare ska registreras i Patent- och registerstyrelsens handelsregister, föreningsregister, stiftelseregister och register över religionssamfund. Bestämmelsen anknyter till penningtvättsdirektivets krav på ett centralt register. Kravet uppfylls genom att föreningsregistret och registret över religionssamfund ansluts som stamregister i företags- och organisationsdatasystemet. 
I 5 mom. föreskrivs om den tidpunkt då uppgifterna senast ska lämnas in till registren. Enligt utredning är det föreslagna 5 mom. likväl onödigt i sammanhanget, eftersom det föreskrivs särskilt om ikraftträdandet för bestämmelserna om registren. Utskottet föreslår därför att 5 mom. stryks. 
Däremot måste det till förslaget till lag om ändring av handelsregisterlagen (lagförslag 4) fogas en särskild ikraftträdande- och övergångsbestämmelse. Utskottet hänvisar till det som anförs nedan i fråga om lagförslag 4.  
7 kap. Tillsyn
1 §. Tillsynsmyndigheterna och anmälan till centralen för utredning av penningtvätt.
Enligt 1 mom. 2 punkten utövas tillsynen av Polisstyrelsen när det är fråga om penningspelssammanslutningar enligt 1 kap. 2 § 1 mom. 9 punkten samt näringsidkare och sammanslutningar som avses i 1 kap. 2 § 2 mom. Föremål för Polisstyrelsens tillsyn är därmed den penningspelssammanslutning (Veikkaus Ab) som avses i 11 § i lotterilagen (1047/2001) och näringsidkare och sammanslutningar som förmedlar deltagaranmälningar och -avgifter för penningspel som tillhandahålls av sådana penningspelssammanslutningar (Veikkaus Ab och Ålands Penningautomatförening, Paf) som avses i 1 kap. 2 § 1 mom. 9 och 10 punkten, om penningspelssammanslutningen till en sådan annan näringsidkare eller sammanslutning har överfört ansvaret för kundkontroll samt rapporteringsskyldigheten. Enligt förslaget ska Polisstyrelsen alltså svara för tillsynen över de ombud som säljer penningspel som tillhandahålls av den penningspelssammanslutning (Paf) som avses i 1 kap. 2 § 1 mom. 10 punkten, men inte för tillsynen över själva penningspelssammanslutningen. 
Som konstaterats i utskottets överväganden är avsikten att tillsynen över penningspelsverksamhet och fastighetsförmedling i landskapet Åland ska ordnas separat. Förvaltningsutskottet konstaterar att det därför är motiverat att avgränsa 1 mom. 2 punkten så att den även för ombudens del endast gäller de ombud till Veikkaus Ab som avses i 1 kap. 2 § 1 mom. 9 punkten. 
Enligt utredning måste det till lagförslaget fogas en bemyndigandebestämmelse enligt vilken Finansinspektionen utöver tillsyn över att förordningen om information om betalaren följs. Utskottet föreslår därför att detta införs i ett nytt 3 mom. i paragrafen, varvid det nuvarande 3 mom. blir 4 mom. 
5 §. Begränsning av ledningens verksamhet för viss tid.
Den föreslagna paragrafen grundar sig på penningtvättsdirektivets artikel 59.2 d. Enligt det ska de administrativa åtgärder som kan tillämpas inbegripa ett tillfälligt förbud. Enligt paragrafens detaljmotiv kan en person som hör till ledningen och är rapporteringsskyldig förbjudas att sköta uppgifter inom ledningen hos den rapporteringsskyldiga, om han eller hon i fråga vid skötseln av sina uppgifter har visat uppenbar oskicklighet eller oförsiktighet och om det är uppenbart att detta allvarligt kan äventyra de mål för tillsynen som anges i lagen. En förutsättning för att utfärda ett förbud är i enlighet med grundlagsutskottets tolkningspraxis att den till ledningen hörande personen tidigare har fått en rättelseuppmaning, anmärkning eller varning som inte har lett till att allvarliga och väsentliga brister i verksamheten har rättats till. Ytterligare en förutsättning är att oskickligheten eller oförsiktigheten allvarligt kan äventyra de mål för tillsynen som anges i lagförslaget. I de motiv som gäller 1 mom. understryks dessutom att syftet med denna paragraf är att begränsa ledningens verksamhet vid överträdelse av villkor som föreskrivs i lagen. 
Enligt utredning till förvaltningsutskottet finns likväl de flesta bestämmelserna om de krav på yrkesskicklighet och tillförlitlighet som avses i 1 mom. 2 punkten i andra lagar. I den nu aktuella lagen föreskrivs om vissa krav som ställs på dem som övervakas av regionförvaltningsverket (5 kap. i lagförslag 1). 
Av detaljmotiven får man också den uppfattningen att den ytterligare förutsättningen, dvs. att oskickligheten eller oförsiktigheten allvarligt kan äventyra de mål för tillsynen som anges i lagen, gäller såväl 1 punkten som 2 punkten. Den nämnda ytterligare förutsättningen ingår dock uttryckligen i 1 punkten och anknyter till den. 
En förutsättning för att utfärda ett förbud är enligt 2 mom. att den som avses i 1 mom. tidigare har fått en rättelseuppmaning, anmärkning eller varning som inte har lett till att allvarliga och väsentliga brister i verksamheten har rättats till. 
Enligt 3 mom. föreskrivs det om Finansinspektionens rätt att besluta att verksamheten inom ledningen för de sammanslutningar som står under dess tillsyn ska begränsas. Paragrafens 1 och 2 mom. ska således tillämpas exempelvis på den tillsyn som regionförvaltningsverket utövar över de rapporteringsskyldigas ledning. 
Den utredning som utskottet fått i frågan motsvarar innehållet i propositionen och ger inte anledning att ändra paragrafen. Utskottet påpekar dock betydelsen av propositionernas detaljmotiv. I detaljmotiven till en paragraf motiveras paragrafens innehåll och varför regeringen har stannat för en viss lösning i propositionen. Motiven utgör också tolkningsanvisningar för dem som tillämpar lagen. Det finns därför anledning att utarbeta detaljmotiven med den noggrannhet saken kräver. 
7 §. Vite.
Enligt 3 mom. får en fysisk persons informationsskyldighet enligt denna lag inte förenas med vite när det finns anledning att misstänka denna för brott och informationen har samband med det ärende som brottsmisstanken avser. Lagutskottet fäste uppmärksamhet vid uttrycket "aihetta epäillä", som inte används i straffprocesslagstiftningen, och föreslog att ordet ”aihetta” ersätts med ordet ”syytä”. Därigenom framgår det tydligare av formuleringen att bedömningen ska göras av förundersökningsmyndigheten. Förvaltningsutskottet menar att bestämmelsen bör ändras och föreslår att ordalydelsen ses över på det sätt lagutskottet föreslår. Ändringen påverkar inte den svenska språkdräkten. 
8 kap. Administrativa påföljder
1 §. Ordningsavgift.
Lagutskottet föreslog i sitt utlåtande att förvaltningsutskottet överväger att antingen till lagförslag 1 eller till revisionslagen foga ett förtydligande om att det är revisionsnämnden vid Patent- och registerstyrelsens revisionstillsyn som ska påföra revisorer påföljder som följer av penningtvättslagen. Det motsvarar revisionstillsynens interna arbetsfördelning i fråga om de påföljder som påförs med stöd av revisionslagen. De påföljder som penningtvättslagen tillåter är enligt det första lagförslagets 8 kap. 1 § ordningsavgift, enligt 2 § offentlig varning och enligt 3 § påföljdsavgift. 
Enligt propositionens lagförslag 1 utövas tillsyn över efterlevnaden av den lagen samt bestämmelser och föreskrifter som utfärdats med stöd av den av Patent- och registerstyrelsen när det är fråga om rapporteringsskyldiga enligt 1 kap. 2 § 1 mom. 11 punkten. I lagförslaget fastställs inte närmare vilken enhet vid Patent- och registerstyrelsen som ska besluta om de administrativa påföljder som avses i 8 kap. 1—3 §. I revisionslagen (1141/2015) finns bestämmelser om Revisionstillsynen och revisionsnämnden vid Patent- och registerstyrelsen. I 7 kap. 2 § i revisionslagen föreskrivs om Revisionstillsynens uppgifter. Enligt 4 § i det kapitlet finns vid Revisionstillsynen revisionsnämnden, som är självständig i sina avgöranden. Bestämmelser om revisionsnämndens beslutsrätt finns i 5 § i samma kapitel. Revisionsnämnden avgör de ärenden som specificeras där och sköter andra uppgifter enligt revisionslagen. 
Eftersom revisionsnämndens gällande behörighet avgränsats till de uppgifter som nämns i revisionslagen och det i propositionens lagförslag inte ingår någon bestämmelse enligt vilken revisionsnämnden kan påföra de administrativa påföljder som avses i lagförslag 1, verkar revisionsnämnden inte ha behörighet att påföra dessa administrativa påföljer. I vilket fall är nämndens ställning oklar i detta avseende. 
Förvaltningsutskottet menar därför att det måste föreskrivas att revisionsnämnden vid Patent- och registerstyrelsens revisionstillsyn påför de administrativa påföljder som avses i 8 kap. 1—3 §. Det är följdriktigt att föreskriva om detta i lagförslag 1, där det också föreskrivs om överklagande av beslut om sådana administrativa påföljder som avses i lagförslag 1 samt om verkställighet av besluten. 
Utskottets förslag betyder också att det omprövningsförfarande om vilket det föreskrivs i revisionslagen inte tillämpas på beslut om administrativa påföljder enligt lagförslag 1. 
Förvaltningsutskottet föreslår därför att det till paragrafen fogas ett nytt 7 mom., enligt vilket revisionsnämnden vid Patent- och registerstyrelsen påför den ordningsavgift som avses i paragrafen. 
2 §. Offentlig varning.
Bestämmelsen i 1 mom. måste beakta andra överträdelser av bestämmelserna i förordningen om information om betalaren än de som avses i 8 kap. 1 och 3 §. Utskottet föreslår att en bestämmelse om detta fogas till 1 mom. 
Av de skäl som anfördes i anknytning till 1 § föreslår förvaltningsutskottet att det till paragrafen fogas ett nytt 4 mom., enligt vilket revisionsnämnden vid Patent- och registerstyrelsen meddelar den offentliga varning som avses i paragrafen. 
3 §. Påföljdsavgift.
Enligt 3 mom. kan en fysisk person inte påföras påföljdsavgift om det samtidigt är frågan om en gärning som är straffbar. Tillsynsmyndigheten kan dock påföra en påföljdsavgift och avstå från att anmäla ärendet till förundersökningsmyndigheten om gärningen eller försummelsen med hänsyn till dess menlighet, gärningsmannens skuld sådan den framgår av gärningen, den vinning som erhållits och övriga omständigheter i anslutning till gärningen eller försummelsen som helhet betraktad anses vara ringa. Förvaltningsutskottet menar i likhet med lagutskottet att bestämmelsen är i viss mån problematisk, eftersom ett villkor för påförande av påföljdsavgift enligt paragrafens 1 mom. är att verksamheten allvarligt, upprepade gånger eller systematiskt bryter mot bestämmelserna. Utskottet menar att samma gärning inte samtidigt kan vara såväl allvarlig som ringa. 
Bestämmelsen i 3 mom. grundar sig på 40 § 3 mom. i den gällande lagen om Finansinspektionen (878/2008). Det finns en inbördes konflikt mellan å ena sidan det inledande stycket i 8 kap. 3 § 1 mom. och å andra sidan 3 mom. Någon liknande konflikt förekommer inte i bestämmelserna i lagen om Finansinspektionen, där villkoren endast är uppsåt och oaktsamhet. Det inledande stycket i 1 mom. grundar sig på artikel 59.1 i penningtvättsdirektivet, så till den delen vore det problematiskt att slopa omnämnandet av hur allvarlig gärningen är som kriterium för påföljdsavgift. Enligt lagutskottets uppfattning kan däremot 3 mom. ändras genom strykning av kriteriet att gärningen kan anses vara ringa. 
Förvaltningsutskottet anser det motiverat att ändra bestämmelsen enligt lagutskottets förslag och föreslår att 3 mom. ändras på följande sätt: 
”Tillsynsmyndigheten kan inte påföra en fysisk person påföljdsavgift för en gärning eller försummelse som enligt lag är straffbar. Med hänsyn till gärningens eller försummelsens menlighet, gärningsmannens skuld sådan den framgår av gärningen, den vinning som fåtts och övriga omständigheter i anslutning till gärningen eller försummelsen som helhet betraktad, kan tillsynsmyndigheten dock påföra påföljdsavgift och avstå från att anmäla ärendet till förundersökningsmyndigheten.” 
Med hänvisning till det som konstaterades i anknytning till 1 § föreslår förvaltningsutskottet vidare att det till paragrafen fogas ett nytt 6 mom., enligt vilket revisionsnämnden vid Patent- och registerstyrelsen påför den ordningsavgift som avses i paragrafen. 
4 §. Storleken på påföljdsavgiften för kreditinstitut och finansiella institut.
Enligt 1 mom. ska, utöver de andra omständigheter som nämns i bestämmelsen, vid bestämmandet av påföljdsavgiften hänsyn tas till den vinning som erhållits eller den skada som orsakats genom förfarandet, om vinningen eller skadan kan bestämmas, gärningsmannens samarbete med den behöriga tillsynsmyndigheten för att utreda ärendet samt gärningsmannens tidigare försummelser och överträdelser av denna lag eller av bestämmelser som utfärdats med stöd av den. Enligt artikel 17 i penningtvättsdirektivet ska de europeiska tillsynsmyndigheterna senast den 26 juni 2017 för behöriga myndigheter och kreditinstitut och finansiella institut utfärda riktlinjer i enlighet med artikel 16 i förordningarna (EU) nr 1093/2010, (EU) nr 1094/2010 och (EU) nr 1095/2010 om de riskfaktorer som ska beaktas och åtgärder som ska vidtas i situationer där förenklade åtgärder för kundkännedom är lämpliga. Särskild hänsyn ska tas till företagets typ och storlek, och där så är lämpligt och proportionerligt ska särskilda åtgärder fastställas. I artikel 18 i penningtvättsdirektivet föreskrivs dessutom att de europeiska tillsynsmyndigheterna senast den 26 juni 2017 för behöriga myndigheter och kreditinstitut och finansiella institut ska utfärda riktlinjer i enlighet med artikel 16 i förordningarna (EU) nr 1093/2010, (EU) nr 1094/2010 och (EU) nr 1095/2010 om de riskfaktorer som ska beaktas och åtgärder som ska vidtas i situationer där skärpta åtgärder för kundkännedom är lämpliga. Särskild hänsyn ska tas till företagets typ och storlek, och där så är lämpligt och proportionerligt ska särskilda åtgärder fastställas. Riktlinjerna kommer enligt inkommen utredning att påverka också de föreskrifter som Finansinspektionen meddelar med stöd av 9 kap. 6 § i lagförslag 1 och som är bindande för dem som är verksamma på finansmarknaden. Enligt utredning måste överträdelser och försummelser som hänför sig till dessa föreskrifter från Finansinspektionen beaktas i 1 mom. Utskottet föreslår att 1 mom. kompletteras med en bestämmelse om detta. 
I 4 mom. i finns en bestämmelse enligt vilket den vinning som erhållits genom gärningen eller försummelsen ska beaktas vid påförandet av påföljdsavgift. Enligt momentet får påföljdsavgiften, ”trots det som föreskrivs i denna paragraf [...] emellertid vara högst dubbelt så stor som den vinning som erhållits genom gärningen eller försummelsen, om vinningen kan bestämmas”. Förvaltningsutskottet hänvisar till lagutskottets utlåtande och föreslår av tydlighetsskäl att formuleringen ”kaksi kertaa suurempi” i den finska språkdräkten ersätts med formuleringen ”kaksi kertaa niin suuri". Ändringen påverkar inte den svenska språkdräkten. 
Det tillägg till 1 mom. som utskottet föreslår gäller en specialbestämmelse om Finansinspektionen, varför tillämpningsområdet enligt 7 mom. måste avgränsas så att det inte omfattar specialbestämmelsen. 
5 §. Storleken på påföljdsavgiften för andra än kreditinstitut och finansiella institut.
Enligt inkommen utredning kan Finansinspektionen med stöd av 9 kap. 7 § i lagförslag 1 utfärda föreskrifter som grundar sig på de europeiska tillsynsmyndigheternas regler och är bindande för dem som är verksamma på finansmarknaden, inklusive andra aktörer än kredit- och finansinstitut. Till dessa hör exempelvis skadeförsäkringsbolag, försäkringsföreningar, förmedlare av gräsrotsfinansiering och de som avses i 7 och 7 a § i lagen om betalningsinstitut (297/2010). Av de skäl som anförs i anknytning till 4 § 1 mom. ovan måste också överträdelser och försummelser som anknyter till dessa föreskrifter från Finansinspektionen beaktas i 5 § 1 mom. Utskottet föreslår att 1 mom. kompletteras med en bestämmelse om detta. Eftersom 5 § tillämpas också av andra tillsynsmyndigheter än Finansinspektionen framhåller utskottet att tillägget till 1 mom. är en specialbestämmelse som enbart gäller Finansinspektionen. 
Förvaltningsutskottet hänvisar dessutom till lagutskottets utlåtande och föreslår att formuleringen ”kaksi kertaa suurempi” i 2 mom. i den finska språkdräkten ersätts med formuleringen ”kaksi kertaa niin suuri". Ändringen påverkar inte den svenska språkdräkten. 
8 §. Offentliggörande av administrativa påföljder.
Utskottet föreslår att rubriken ändras så att den mer exakt motsvarar paragrafens innehåll. I 4 mom. hänvisas också till beslut enligt 7 kap. 4—7 §. I den form utskottet föreslår motsvarar rubriken dessutom motsvarande bestämmelse i lagen om Finansinspektionen (43 §, lag 176/2016). 
Enligt sista meningen i 4 mom. kan tillsynsmyndigheten låta bli att offentliggöra ett beslut om det inte skulle vara skäligt att offentliggöra beslutet på grund av att den åtgärd som beslutet avser är obetydlig. Meningen motsvarar artikel 60.1 c ii i penningtvättsdirektivet. I 43 § 2 mom. 4 punkten i lagen om Finansinspektionen finns en hänvisning till 43 § 4 mom. Bestämmelsen i 43 § 4 mom. motsvarar i sak det aktuella 8 kap. 8 § 4 mom. i lagförslag 1. Enligt utredning till utskottet genomförs den nämnda bestämmelsen i penningtvättsdirektivet nationellt genom den här meningen i 8 kap. 8 § 4 mom. i lagförslag 1. 
9 §. Verkställighet och återbetalning av ordningsavgifter och påföljdsavgifter.
Enligt det föreslagna 1 mom. sköter Rättsregistercentralen verkställigheten av ordningsavgifter och påföljdsavgifter. Närmare bestämmelser om verkställigheten utfärdas genom förordning av statsrådet. 
Grundlagsutskottet konstaterade i sitt utlåtande att grunderna för verkställigheten av en lag om administrativa sanktioner bör föreskrivas i lag. Också lagutskottet fäste uppmärksamhet vid regleringen och ansåg att de i propositionen föreslagna bestämmelserna inte är sakliga på denna punkt. Enligt lagutskottets bedömning lämpar sig det förfarande för verkställighet av påföljder som föreskrivs i lagen om verkställighet av böter (672/2002) i princip som sådant för verkställighet av de ordningsavgifter och påföljdsavgifter som avses i lagförslag 1. Därigenom är verkställigheten av påföljder, som sköts av Rättsregistercentralen, reglerad på lagnivå. 
Förvaltningsutskottet instämmer i det som grundlagsutskottet och lagutskottet säger i sina utlåtanden. För att komplettera bestämmelserna om verkställigheten på det ovannämnda sättet bör det till lagförslag 1 fogas en bestämmelse enligt vilken ordningsavgifter och påföljdsavgifter som påförts med stöd av denna lag ska verkställas i den ordning som avses i lagen om verkställighet av böter (672/2002). Samtidigt stryks bemyndigandet att utfärda förordning i 1 mom.  
Dessutom bör det också till lagen om verkställighet av böter fogas en bestämmelse om verkställigheten av de ordningsavgifter och påföljdsavgifter som avses i lagförslag 1. I propositionen ingår inga förslag om ändring av den lagen. Förvaltningsutskottet föreslår därför nedan att ett nytt lagförslag om detta godkänns. 
Av de skäl som anförs i utskottets överväganden föreslår förvaltningsutskottet dessutom med hänvisning till grundlagsutskottets och lagutskottets utlåtanden att 2 mom. om återbetalning av ordningsavgifter och påföljdsavgifter stryks. Därigenom kan den av förvaltningsutskottet föreslagna hänvisningen till lagen om verkställighet av böter (672/2002) fogas till paragrafen som nytt 2 mom. 
Dessutom måste paragrafens rubrik ändras så att den stämmer överens med det ändrade innehållet. 
9 kap. Särskilda bestämmelser
4 §. Ändringssökande.
Enligt det föreslagna 1 mom. får tillsynsmyndighetens beslut överklagas genom besvär hos förvaltningsdomstolen på det sätt som anges i förvaltningsprocesslagen, om inte något annat föreskrivs nedan i denna paragraf eller någon annanstans i lag. I paragrafen finns ingen bestämmelse om att ett beslut av förvaltningsdomstolen får överklagas bara om högsta förvaltningsdomstolen beviljar besvärstillstånd. I propositionsmotiven ansågs det i den här fasen motiverat med besvärsrätt utan krav på besvärstillstånd, eftersom påföljderna, som ersätter kriminaliseringarna i den gällande lagen, i vilket fall torde tillämpas endast i ett fåtal fall per år och påföljderna kan vara av stor ekonomisk betydelse. Överträdelser av penningtvättslagen utgör en ny ärendegrupp i förvaltningsdomstolarna, och antalet fall kommer sannolikt att vara lågt. Den direkta besvärsrätten syftar alltså uppenbart till att säkerställa att det i högsta instans fälls avgöranden som ger ledning för rättspraxisen. Ändringssökandet är dessutom fördelat på samtliga förvaltningsdomstolar. 
Lagutskottet noterade i sitt utlåtande att det ligger i linje med den allmänna utvecklingen av förvaltningsdomstolarna att överklagande hos högsta förvaltningsdomstolen i regel kräver besvärstillstånd. Härigenom kan högsta förvaltningsdomstolen utvecklas mer mot att vara en domstol med en styrande funktion för rättspraxis. Med hänsyn till detta och till inkommen utredning ansåg lagutskottet att det i fråga om rättstryggheten är tillräckligt med en direkt besvärsinstans för besvär över beslut av de tillsynsmyndigheter som avses i lagförslag 1. Lagutskottet menade att det är möjligt att utveckla rättspraxis ändamålsenligt också på förvaltningsdomstolsnivå och så att man tillämpar besvärstillståndssystemet. Lagutskottet föreslog därför att 4 § 1 mom. kompletteras så att ett beslut av förvaltningsdomstolen får överklagas genom besvär endast om högsta förvaltningsdomstolen beviljar besvärstillstånd. 
Förvaltningsutskottet konstaterar i det här sammanhanget att tillsynsmyndigheterna med stöd av lagförslag 1 fattar också andra beslut än sådana som gäller påförande av administrativa påföljder. Propositionen föreslår dock inte att fortsatta besvär hos högsta förvaltningsdomstolen till någon del ska kräva besvärstillstånd, trots att det enligt den gällande penningtvättslagen är så sedan början av 2016 (40 §). 
Förvaltningsutskottet hänvisar till lagutskottets utlåtande och föreslår därför att det i slutet av 1 mom. infogas en bestämmelse om att förvaltningsdomstolens beslut får överklagas genom besvär endast om högsta förvaltningsdomstolen beviljar besvärstillstånd. 
På de grunder som anförs i utskottets överväganden föreslår förvaltningsutskottet dessutom att 4 mom. stryks, varvid sådana beslut av Finansinspektionen som avses i lagförslag 1 får överklagas genom besvär hos förvaltningsdomstolen. 
Enligt 5 mom. ska 11 kap. 1 § i revisionslagen tillämpas på överklagande av Patent- och registerstyrelsens beslut. Det är alltså frågan om ett sådant undantag som avses i 4 § 1 mom. Enligt 11 kap. 1 § i revisionslagen ska överklagandet styras till Helsingfors förvaltningsdomstol. Lagutskottet konstaterar i sitt utlåtandet att utskottet i samband med behandlingen av propositionen inte har fått kännedom om några särskilda grunder för att ändringssökande i sådana beslut av Patent- och registerstyrelsen som avses i lagförslag 1 skulle ordnas på ett sätt som avviker från huvudregeln i 9 kap. 4 §. Inte heller i propositionens motiv till 4 § 5 mom. ges några skäl för den valda lösningen. Enligt lagutskottets uppfattning är det ändamålsenligt att överklagande av Patent- och registerstyrelsens beslut styrs till förvaltningsdomstolen på samma sätt som de andra tillsynsmyndigheternas beslut. Därför föreslår lagutskottet att 9 kap. 4 § 5 mom. i lagförslag 1 stryks. 
Det har inte heller under förvaltningsutskottets behandling av ärendet framkommit några särskilda grunder för den avvikande bestämmelsen i propositionen. Med hänvisning till lagutskottets utlåtande föreslår förvaltningsutskottet därför att paragrafens 5 mom. stryks. 
I den form förvaltningsutskottet föreslår innebär bestämmelserna i 4 § i fråga om överklagande i högre instans att besvärstillstånd krävs för besvär hos högsta förvaltningsdomstolen över förvaltningsdomstolens beslut i samtliga ärenden som gäller beslut som med stöd av lagförslag 1 fattats av de tillsynsmyndigheter som avses i 7 kap. 1 §. 
5 §. Verkställighet av vite, ordningsavgifter och påföljdsavgifter.
Enligt förslaget får vite som dömts ut i enlighet med denna lag samt ordningsavgift och påföljdsavgift som påförts i enlighet med denna lag verkställas endast med stöd av beslut som vunnit laga kraft. Lagutskottet noterade att enligt 1 kap. 1 § 1 mom. 1 punkten i den gällande lagen om verkställighet av böter verkställs vite i enlighet med den lagen. Enligt 2 § 1 mom. i samma lag kräver verkställighet att beslutet har vunnit laga kraft eller har blivit verkställbart som en lagakraftvunnen dom. Utifrån det som sägs ovan anför lagutskottet i sitt utlåtande att 9 kap. 5 § i lagförslag 1 är obehövlig till den del paragrafen gäller vite. 
Förvaltningsutskottet omfattar lagutskottets ståndpunkt. Förvaltningsutskottet föreslog ovan att 8 kap. 9 § i lagförslag 1 ändras bland annat på så sätt att ordningsavgifter och påföljdsavgifter enligt lagförslaget ska verkställas i den ordning som föreskrivs i lagen om verkställighet av böter. Härigenom kan enligt lagutskottet 9 kap. 5 § strykas helt, om det säkerställs att verkställbarheten också för ordningsavgifters och påföljdsavgifters del i lagen om verkställighet av böter regleras korrekt och på motsvarande sätt som för situationer som rör vite. 
Enligt inkommen utredning anser förvaltningsutskottet att det inte finns något behov av att föreskriva särskilt om verkställbarheten för ordningsavgifter och påföljdsavgifter. Verkställbarheten bestäms då enligt förvaltningsprocesslagen (586/1996). Med stöd av 31 § i förvaltningsprocesslagen får ordningsavgifter och påföljdsavgifter verkställas när de har vunnit laga kraft. Verkställbarheten motsvarar då i sak vad som gäller för vite, som får verkställas när det avgörande genom vilket påföljden bestämts har vunnit laga kraft eller har blivit verkställbart som en lagakraftvunnen dom. 
Förvaltningsutskottet konstaterar därför att 9 kap. 5 § är obehövlig också i fråga om ordningsavgifter och påföljdsavgifter och föreslår att paragrafen stryks helt. Samtidigt ändras numreringen av de följande paragraferna enligt detta. 
6 (7) §. Bemyndigande att meddela föreskrifter.
I paragrafen föreskrivs det att tillsynsmyndigheterna kan meddela närmare föreskrifter om sådana riskfaktorer enligt 3 kap. 1 § 3 mom. som de rapporteringsskyldiga ska beakta samt om de skärpta åtgärder som avses i 3 kap. 10 § och som är förenade med en högre risk än vanligt för penningtvätt och finansiering av terrorism. Av detaljmotiven till paragrafen framgår det inte varför bemyndigandet har avgränsats så att det gäller uttryckligen dessa omständigheter och varför bestämmelsen inte innehåller en hänvisning till de förenklade åtgärder för kundkontroll som avses i 3 kap. 8 §. 
I anknytning till 8 kap. 4 och 5 § konstaterade utskottet att de europeiska tillsynsmyndigheterna i enlighet med artikel 17 i penningtvättsdirektivet senast den 26 juni 2017 ska utfärda riktlinjer om de riskfaktorer som ska beaktas och åtgärder som ska vidtas i situationer där förenklade åtgärder för kundkännedom är lämpliga. I artikel 18 i penningtvättsdirektivet föreskrivs på motsvarande sätt om de riktlinjer om de riskfaktorer som ska beaktas och åtgärder som ska vidtas i situationer där skärpta åtgärder för kundkännedom är lämpliga. Riktlinjerna kommer enligt inkommen utredning att påverka också de föreskrifter som Finansinspektionen meddelar med stöd av 9 kap. 6 § i lagförslag 1 och som är bindande för dem som är verksamma på finansmarknaden. 
Utskottet anser att den föreslagna 6 § måste preciseras genom komplettering med en hänvisning också till de förenklade åtgärder för kundkontroll som avses i 3 kap. 8 §, så att det inte uppstår oklarhet om Finansinspektionens rätt att meddela sådana föreskrifter som avses här också om förenklade åtgärder för kundkontroll. 
I paragrafen är det frågan om ett bemyndigande att meddela föreskrifter som gäller samtliga tillsynsmyndigheter. Enligt inkommen utredning har det åtminstone vid Finansinspektionen identifierats ett behov av att vid behov meddela föreskrifter om förenklade och skärpta åtgärder för kundkontroll. Också de andra tillsynsmyndigheterna kan med stöd av paragrafen meddela sådana föreskrifter som avses där. Utskottet understryker att det i paragrafen föreskrivs om rätt att meddela föreskrifter, inte om skyldighet att meddela föreskrifter. 
Utskottet hänvisar dessutom till 3 kap. 8 § 2 mom. i lagförslag 1, enligt vilket genom förordning av statsrådet utfärdas närmare bestämmelser om sådana kunder, produkter, tjänster, transaktioner, leveranssätt och geografiska riskfaktorer som kan vara förenade med låg risk för penningtvätt eller finansiering av terrorism samt om förfarandena i sådana situationer. Enligt 3 kap. 10 § 2 mom. utfärdas genom förordning av statsrådet dessutom närmare bestämmelser om sådana kunder, produkter, tjänster, transaktioner, leveranssätt och geografiska riskfaktorer som är förenade med extra hög risk för penningtvätt eller finansiering av terrorism samt om förfarandena i sådana situationer. Utskottet betonar att det genom föreskrifter av tillsynsmyndigheten inte får ske avvikelser från det som föreskrivs genom förordning av statsrådet. 
Utskottet har dessutom rättat paragrafens hänvisning till 3 kap. 1 § 3 mom. till att gälla 2 mom. i samma paragraf. 
7 (8) §. Ikraftträdande.
I 2 mom. föreslås det bestämmelser om ikraftträdandet för 5 kap. (Registret för övervakning av penningtvätt), 6 kap. 2 § (Sammanslutningars skyldighet att upprätthålla information om verkliga förmånstagare) och 6 kap. 3 § (Skyldighet för förvaltare av utländska truster att ha kännedom om verkliga förmånstagare). Utskottet föreslår att det i paragrafen görs en lagteknisk ändring så att det föreskrivs om ikraftträdandet för 5 kap. i 2 mom. och för 6 kap. 2 och 3 § i ett nytt 3 mom. Därigenom blir det möjligt att vid behov ge olika ikraftträdandetider för de olika bestämmelserna. Av utskottets förslag följer att propositionens 3 mom. blir 4 mom. 
8 (9) §. Övergångsbestämmelser.
Lagförslagen i propositionen är i huvudsak avsedda att träda i kraft den 1 januari 2017 eller så snart som möjligt. I 1 mom. föreskrivs om när den rapporteringsskyldigas riskbedömning enligt 2 kap. 3 § ska vara klar, och i 2 mom. föreskrivs om när det på riskbaserad bedömning grundade förfarandet enligt 3 kap. 13 § ska vara klart. Med hänsyn till tidsplanen för riksdagensbehandlingen måste de tider som föreslås i propositionen justeras. Förvaltningsutskottet föreslår därför att båda tidsfristerna skjuts fram med ett halvt år, dvs. till den 31 december 2017. 
I 4 mom. sägs att vad som i 3 kap. 2 § 2 mom. föreskrivs om kundidentifiering och identitetskontroll i samband med sammanhängande transaktioner i penningspelsverksamhet tillämpas från och med den 1 januari 2018 på i 14 § 1 mom. i lotterilagen avsedd verksamhet som gäller penningspel som förmedlas elektroniskt. Tidsfristen för övergångsbestämmelsen har anpassats så att den tidsmässigt motsvarar den övergångsperiod som föreskrivits för den begränsning i 14 § 1 mom. (1286/2016) i lotterilagen enligt vilken en spelare kan ha endast ett spelkonto. Övergångsperioden går ut den 31 december 2017. Enligt uppgift behöver tidsfristen inte justeras i det här sammanhanget. 
I 5 mom. finns en övergångsbestämmelse som anknyter till avkriminaliseringen av påföljder, dvs. till att de straffrättsliga påföljderna för gärningar ersätts med administrativa påföljder. Enligt förslaget ska bestämmelserna om straffansvar i lagen om förhindrande och utredning av penningtvätt och finansiering av terrorism, som upphävs genom denna lag, tillämpas på de brott och förseelser som inträffat innan lagen träder i kraft. 
Lagutskottet granskade i sitt utlåtande regleringen med avseende på den straffrättsliga legalitetsprincipen och konstaterade att det föreslagna 5 mom. utgör ett undantag från den huvudregel om den lindrigare lagens princip som framgår av 3 kap. 2 § 2 mom. i strafflagen. Avkriminalisering betyder inte i det här fallet att inställningen till straffbara gärningar eller försummelser skulle ha blivit lindrigare, och upphävandet av straffbestämmelsen betyder inte att gärningarna i fortsättningen inte skulle leda till påföljder. Gärningar och försummelser som begås före ikraftträdandet ska således i princip leda till ett straffrättsligt straff. Om en administrativ påföljd enligt den nya lagen i ett enskilt fall de facto skulle vara lindrigare än en straffrättslig påföljd enligt den tidigare lagen, ska övergångsbestämmelsen dock tolkas i överensstämmelse med artikel 15.1 i konventionen om medborgerliga och politiska rättigheter. Om det för gärningen enligt den nya lagen exempelvis ska meddelas offentlig varning, kan domstolen välja att inte döma svaranden till straff. Likaså ska exempelvis antalet dagsböter vid behov kunna sänkas. 
Trots det som sagts ovan föreslog lagutskottet att det till lagförslag 1 fogas en informativ bestämmelse om den lindrigare lagens princip. Bestämmelsen klargör att den svarande trots principen om lindrigare lag uttryckligen ådöms ett straffrättsligt straff. Att den straffrättsliga regleringen ersätts med administrativ reglering innebär inte befrielse från straffansvar, utan att principen om lindrigare lag beaktas vid bestämmande av straffet. 
Av tydlighetsskäl ser förvaltningsutskottet det som motiverat att infoga en informativ bestämmelse och föreslår i enlighet med lagutskottets utlåtande att det i slutet av 5 mom. infogas en bestämmelse som säger att om den nya lagen skulle leda till ett lindrigare slutresultat, ska detta beaktas när straffet bestäms. 
2.
Lagen om centralen för utredning av penningtvätt
6 §. Förordnande av centralen för utredning av penningtvätt om avbrytande av en transaktion.
Enligt propositionen ska centralen för utredning av penningtvätt ha befogenhet att förordna avbrytande av en transaktion för högst tio vardagar. Grundlagsutskottet fäste i sitt utlåtande uppmärksamhet vid synpunkten i motiveringen till lagstiftningsordning att förordnandet om avbrytande av en transaktion inte ska vara överklagbart eftersom det rör sig om en tillfällig åtgärd. Grundlagsutskottet konstaterar att motiveringen är problematisk inte minst med tanke på en effektiv rättssäkerhet, som är ett av de allmänna villkoren för begränsning av de grundläggande fri- och rättigheterna. Förslaget om besvärsförbud ingår dock inte i den föreslagna lagtexten. Grundlagsutskottet konstaterar att ett besvärsförbud står i strid med rättsskyddet enligt 21 § i grundlagen. Enligt grundlagsutskottet står det klart att överklagande av ett myndighetsbeslut inte kan förbjudas enbart utifrån en skrivning i motiveringen. Även lagutskottet anser att skrivningen i propositionsmotiven är olämplig. 
Enligt utredning till förvaltningsutskottet är avsikten i propositionen inte att föreskriva om besvärsförbud mot förordnande om avbrytande av en transaktion för viss tid. Något besvärsförbud ingår inte heller i den gällande penningtvättslagen, där det likaså föreskrivs om förordnande om avbrytande av en transaktion för viss tid. Ett förordnande om avbrytande av en transaktion för viss tid riktar sig inte till hela affärsverksamheten, utan till en enskild transaktion, exempelvis en girering eller en utbetalning av en vinst från ett penningspel. Förvaltningsutskottet konstaterar att ett förordnande om avbrytande av en transaktion för viss tid likväl är en åtgärd som inskränker användningen av egendom. I praktiken är besvär inget särskilt fungerande rättsmedel i det här sammanhanget, eftersom förordnandet är en kortvarig åtgärd och bestämmelsen är kopplad till penningtvättsdirektivets krav på att föremålet för åtgärden i regel inte informeras om inrapporterade misstänkta transaktioner. När föremålet för åtgärden är medveten om att en transaktion avbrutits har vederbörande också i alla fall möjlighet att främja utredningen av ärendet genom att lämna all information som är av vikt i ärendet till centralen för utredning av penningtvätt. Dessutom ska förordnandet återkallas utan dröjsmål när det inte längre behövs. Den som är föremål för förordnandet har möjlighet att framställa klagomål och söka skadestånd i enlighet med skadeståndslagen (412/1974). 
Ett förordnande om att en transaktion ska avbrytas för viss tid kan ges endast när det är fråga om potentiell brottsvinning. Syftet med ett förordnande är att säkra myndigheternas möjligheter att på ett tidigt stadium, före brottsutredningen, komma åt potentiell brottsvinning och förhindra att tillgångarna skingras. I penningtvättslagstiftningen särskiljs förordnandet avsiktligt från situationer där det ”finns anledning att misstänka” någon för brott, eftersom merparten av anmälningarna om misstänkta transaktioner aldrig leder till åtgärder och centralen för utredning av penningtvätt inte heller själv svarar för förundersökningen. Om det finns anledning att misstänka brott, ska det göras en brottsanmälan om misstanken om penningtvätt eller finansiering av terrorism. Som säkringsåtgärd tillämpas då kvarstad. Om kvarstad och tillfällig kvarstad och till dem anknytande rättsmedel föreskrivs i 6 kap. i tvångsmedelslagen (806/2011). 
3.
Lagen om ändring av lagen om Finansinspektionen
10 §. Direktionens uppgifter.
Paragrafens 1 mom. 5 punkt har ändrats genom lag 1442/2016, som trädde i kraft den 1 januari 2017. Propositionens förslag till 1 mom. 5 punkt måste harmoniseras med den lagändringen. 
71 §. Rätt och skyldighet att lämna ut information.
I paragrafen föreskrivs om Finansinspektionens rätt och skyldighet att utan hinder av sekretessbestämmelserna lämna ut information till de myndigheter och organ som nämns i lagen. 
I 9 kap. 3 § i lagförslag 1 ingår bestämmelser om samarbete och informationsutbyte mellan tillsynsmyndigheterna och advokatföreningen. Enligt paragrafen ska ”tillsynsmyndigheter och advokatföreningen [...] samarbeta för att förhindra och avslöja penningtvätt och finansiering av terrorism. Tillsynsmyndigheter och advokatföreningen ska, trots vad som någon annanstans i lag föreskrivs om sekretess, utan dröjsmål utbyta information som de innehar och som är nödvändig för förhindrande och avslöjande av penningtvätt och av finansiering av terrorism.” 
Sakkunniga har framfört att Finansinspektionens rätt att lämna ut information i det aktuella sammanhanget kan ge utrymme för viss oklarhet. För att undvika oklarhet om tolkningen föreslår utskottet att det till 71 § 1 mom. fogas en ny 15 punkt, enligt vilken, utöver vad som föreskrivs i lagen om offentlighet i myndigheternas verksamhet (621/1999), Finansinspektionen utan hinder av sekretessbestämmelserna får lämna ut information som är nödvändig för att förhindra och avslöja penningtvätt och finansiering av terrorism till de myndigheter som avses i 7 kap. 1 § 1 mom. i lagen om förhindrande av penningtvätt och av finansiering av terrorism och till den advokatförening som avses i 2 mom. i samma paragraf. Till följd av den nya 15 punkten måste det dessutom göras en lagteknisk ändring i 14 punkten
Ingressen.
Utskottets förslag till ändringar måste beaktas också i ingressen. 
4.
Lag om ändring av handelsregisterlagen
1 a §.
Regeringen föreslår att den offentlighet för uppgifter om förmånstagaren som förutsätts i penningtvättsdirektivet ska genomföras så att uppgifterna insamlas och lagras i det av Patent- och registerstyrelsen förda företags- och organisationsdatasystemets stamregister, dvs. handelsregistret, föreningsregistret, stiftelseregistret och registret över religionssamfund. Uppgifterna är tillgängliga i enlighet med bestämmelserna om offentlighet för stamregistren och utlämnande av uppgifter. För att säkra tillgången till uppgifter om förmånstagaren föreskrivs det i förslaget till 1 a § i handelsregisterlagen att Patent- och registerstyrelsen trots bestämmelserna i 16 § 3 mom. i lagen om offentlighet i myndigheternas verksamhet (621/1999) får lämna ut personuppgifter ur registret i form av utskrifter eller göra dem allmänt tillgängliga i ett elektroniskt datanät. 
Grundlagsutskottet fäste i sitt utlåtande uppmärksamhet vid den föreslagna ändringen av handelsregisterlagen och konstaterade bland annat att det med avseende på skyddet för privatlivet och för personuppgifter är av relevans att det i ett så här omfattande webbaserat personregister inte går att söka uppgifter på stora grupper utan till exempel bara genom enskild sökning. Grundlagsutskottet hänvisade till sin tidigare utlåtandepraxis men konstaterade å andra sidan också att innehållet i de uppgifter som ska lämnas ut och bestämmelsernas sammanhang är annorlunda i det här fallet. Inom ramarna för det direktiv som ska genomföras ser grundlagsutskottet det ändå som viktigt att det aktuella lagförslagets bestämmelser om offentliga informationstjänster kompletteras med en i fråga om registrets innehåll och syfte motiverad restriktion som avser att sökningarna är enskilda. 
Att göra uppgifterna allmänt tillgängliga i ett datanät avser, enligt utredning, i fråga om handelsregistret att tillhandahålla en elektronisk webbtjänst genom vilken sökningar i handelsregistret kan göras. I handelsregistrets webbtjänst är det för närvarande endast möjligt att göra enskilda sökningar på juridiska personer i registret. Genom sådana sökningar hittar man uppgifter om fysiska personers roll i den sammanslutning som registrerats, exempelvis styrelseledamot, verkställande direktör, firmatecknare eller revisor samt de uppgifter som behövs för att identifiera en person. Offentligheten för och tillgången till uppgifterna i handelsregister har i praktiken stor betydelse bland annat för intressentgrupperna kring de sammanslutningar som är antecknade i registret och i vidare bemärkelse för sammanslutningarnas näringsverksamhet. Utlämnandet av uppgifter ur handelsregistret har begränsats så att uppgifter om personbeteckningens slutled och en utomlands bosatt fysisk persons hemadress får lämnas ut endast om utlämnandet uppfyller kraven i 16 § 3 mom. i lagen om offentlighet i myndigheternas verksamhet och den som begär uppgifterna ger registermyndigheten en utredning om att uppgifterna skyddas på lämpligt sätt. I handelsregistret anges som uppgift över bosättningsort hemkommunen, när det är fråga om personer som är bosatta i Finland. 
Med tanke på regleringen av uppgifterna i handelsregistret i dess helhet och registreringspraxisen ser förvaltningsutskottet det inte som behövligt att i 1 a § i handelsregisterlagen inkludera en bestämmelse som motsvarar exempelvis kravet på enbart enskilda sökningar i registerlagstiftningen för yrkesutbildade personer inom hälso- och sjukvården (GrUU 32/2008 rd). Det register som avses där avviker också från handelsregistret. Efter bedömning av grundlagsutskottets utlåtande och handelsregisterlagens bestämmelse föreslår förvaltningsutskottet dock att 1 a § 1 och 2 mom. preciseras så att det tydligt framgår vilka personuppgifter som kan göras tillgängliga genom ett allmänt datanät eller lämnas ut med hjälp av teknisk anslutning eller på något annat sätt i elektronisk form. De aktuella uppgifterna är en fysisk persons namn, födelsedatum, medborgarskap och hemkommun. Uppgifterna är offentliga personuppgifter som ska antecknas i handelsregistret. Samtidigt är det ändamålsenligt att sammanfoga bestämmelserna i 1 och 2 mom. i ett enda moment (1 mom.), varigenom 3 mom. i propositionens förslag blir 2 mom. 
I den form förvaltningsutskottet föreslår lyder således 1 mom. som följer: ”Var och en har rätt att få uppgifter, utdrag och intyg angående anteckningar i handelsregistret och handlingar som registermyndigheten innehar. Trots bestämmelserna i 16 § 3 mom. i lagen om offentlighet i myndigheternas verksamhet (621/1999) får registermyndigheten lämna ut uppgift om fysiska personers namn, födelsetid, medborgarskap och hemkommun i form av utskrifter, genom teknisk anslutning eller på något annat sätt i elektronisk formeller göra dem allmänt tillgängliga i ett elektroniskt datanät.” 
Skyddet av personuppgifter regleras i personuppgiftslagen (523/1999) som allmän lag och i den samtidigt stiftade offentlighetslagen (621/1999), vilka tillsammans utgör ett lagstiftningskomplex om de registrerades rättigheter när det gäller skyddet av personuppgifter. Utskottet inskärper att den registeransvariga är skyldig att i enlighet med personuppgiftslagstiftningen skydda uppgifterna ändamålsenligt i personregistret och när uppgifterna lämnas ut, oberoende av på vilket sätt den elektroniska överlåtelsen genomförs i tekniskt avseende. 
9 §.
I handelsregisterlagen finns bestämmelser om registrering av verkliga förmånstagare. I lagens nu aktuella 9 § föreskrivs om vilka uppgifter som ska nämnas i ett aktiebolags eller europabolags grundanmälan. I 6 kap. 2 § i propositionens lagförslag 1 ingår bestämmelser om ett företags skyldighet att identifiera och upprätthålla en uppdaterad förteckning över sina verkliga förmånstagare. Förvaltningsutskottet har ovan föreslagit att 6 § 2 mom. i lagförslag 1 preciseras så att företagets skyldighet att identifiera och registrera de verkliga förmånstagarna entydigt framgår av lagen. I bestämmelsen hänvisas vidare till 1 kap. 5 § i penningtvättslagen, där aktieägarna nämns som en grupp av verkliga förmånstagare. 
Enligt utredning kan 9 § 1 mom. 15 punkten strykas, eftersom skyldigheten att uppge aktieägare som äger mer än 25 procent av aktierna i aktiebolaget redan ingår i och med 16 punktens hänvisning till 6 kap. 2 § i penningtvättslagen. Avsikten är att aktieägarna ska antecknas i registret oberoende av om någon annan person utövar bestämmande inflytande enligt 1 kap. 5 § i penningtvättslagen. Utskottet föreslår därför att nämnda 15 punkt stryks, varvid propositionens 1 mom. 16 punkt blir ny 15 punkt och hänvisningen i 7 mom. endast gäller 15 punkten. 
Ikraftträdandebestämmelsen.
Med hänsyn till det som konstaterades i anknytning till 6 kap. 4 § i lagförslag 1 och med tanke på tidsplanen för riksdagsbehandlingen föreslår förvaltningsutskottet att lagen ska träda i kraft stegvis i fråga om vissa föreslagna bestämmelser (1 mom.) och att det föreskrivs om en tidpunkt då de uppgifter om förmånstagare som avses i 6 kap. 2 och 3 § i penningtvättslagen senast ska anmälas till handelsregistret (nytt 2 mom.)
5.
Lagen om ändring av 20 kap. 1 § och 15 kap. 6 § i kreditinstitutslagen
15 kap. Förfaranden vid kundtransaktioner
6 §. Kunders rätt till grundläggande banktjänster.
Paragrafen har ändrats genom lag 1054/2016. Ändringen trädde i kraft i början av 2017. Den paragrafändring som föreslås i propositionen måste samordnas med den lagändringen, och hänvisningen till lagen om förhindrande och utredning av penningtvätt och av finansiering av terrorism i 2 mom. måste ändras. Samtidigt föreslår utskottet att också laghänvisningen i 3 mom. ändras. I propositionen ändras det momentet inte. 
18 §. Kundkontroll. (Ny)
I propositionen föreslås ingen ändring av paragrafen. Dess 3 mom. innehåller dock en hänvisning till den gällande penningtvättslagen. Hänvisningen måste ändras så att den hänvisar till den nya lagen om förhindrande av penningtvätt och av finansiering av terrorism. 
Ingressen.
På grund av de ändringar som utskottet föreslår måste lagförslagets ingress ändras. 
Lagens namn.
Av utskottets förslag till ny paragraf följer att också lagförslagets namn måste ändras. 
6.
Lagen om ändring av 12 kap. 3 § och 15 kap. 2 § i lagen om investeringstjänster
15 kap. Administrativa påföljder
2 §. Påföljdsavgift.
Regeringen föreslår att 2 mom. 6 punkten ändras så att den hänvisar till de bestämmelser som avses i lagförslag 1. Punkten motsvarar i sak 6 punkten i den gällande paragrafen. Utskottet menar dock att 6 punkten måste upphävas, eftersom det i annat fall i fråga om värdepappersföretag föreskrivs om administrativa påföljder för överträdelser av lagförslag 1 i två lagar. 
Ingressen.
Eftersom utskottet föreslår att 15 kap. 2 § 6 punkten ska upphävas i stället för ändras, måste också lagförslagets ingress ändras. 
Lagens namn.
Av utskottets förslag följer att också lagförslagets namn måste ändras. 
7.
Lagen om ändring av 8 kap. 4 § i lagen om värdeandelssystemet och om clearingverksamhet
Regeringen föreslår att 8 kap. 4 § 3 mom. i lagen om värdeandelssystemet och om clearingverksamhet (749/2012) ändras. Riksdagen godkände den 17 maj 2017 en ny lag om värdeandelssystemet och om clearingverksamhet (EkUB 7/2017 rdRP 28/2016 rd) genom vilken den gällande lagen upphävs. Därför föreslår utskottet att lagförslag 7 förkastas. 
12.
Lagen om ändring av 6 § i lagen om Enheten för utredning av grå ekonomi
6 §. Syftet med fullgöranderapporter.
Enheten för utredning av grå ekonomi utarbetar fullgöranderapporter till stöd för bland annat de behöriga myndigheternas bedömning av den tillförlitlighet som avses i 5 kap. 5 och 6 § i lagförslag 1. Av de skäl som nämns nedan i samband med lagförslag 23 måste bestämmelsen om syftet med fullgöranderapporter i 6 § i lagförslag 12 utvidgas så att Enheten för utredning av grå ekonomi utarbetar fullgöranderapporter också till stöd för sådana uppgifter som enligt lagen om fastighetsförmedlingsrörelser och rörelser för förmedling av hyreslägenheter och hyreslokaler hör till regionförvaltningsverket och rör utredning av tillförlitligheten hos den som gjort en anmälan eller dennes ansvariga föreståndare eller strykning ur registret över förmedlingsrörelser. Regionförvaltningsverket kan alltså be Enheten för utredning av grå ekonomi utarbeta fullgöranderapporter för skötseln av dessa uppgifter. Utskottet föreslår att en bestämmelse om saken fogas till paragrafen som en ny 21 punkt. Av det följer att det också i 20 punkten måste göras en lagteknisk ändring. 
13.
Lagen om upphävande av 209 s § 2 mom. i mervärdesskattelagen
1 §.
I propositionen föreslås att 209 s § 2 mom. i mervärdesskattelagen (1501/1993) upphävs. Bestämmelsen i det momentet har dock genom lag 773/2016 flyttats till lagens 209 t §. Ändringen bör beaktas i den nu föreslagna 1 §. 
Ingressen.
Ändringen av paragrafen måste också beaktas i ingressen. 
Lagens namn.
Av de skäl som nämns ovan måste också lagförslagets namn ändras. 
18.
Lagen om ändring av 14 a och 64 § i lotterilagen
Ingressen.
Lotterilagen (1047/2001) ändrades vid ingången av 2017 genom lag 1286/2016. I det sammanhanget ändrades också lagens 14 a och 64 §. Lagändringen måste beaktas i lagförslagets ingress. 
20.
Lagen om ändring av 48 och 52 § i föreningslagen
47 §. Myndigheter. (Ny)
Under behandlingen av propositionen har det framkommit ett behov av att ändra också lagens 47 §, som inte berörs i propositionen. Föreningslagen avviker från andra lagar om de av Patent- och registerstyrelsen förda stamregistren över företag och sammanslutningar på så sätt att den endast innehåller en allmän hänvisning till lagen om offentlighet i myndigheternas verksamhet.  
I fråga om föreningar fäste lagutskottet i sitt utlåtande uppmärksamhet vid oron angående den allmänna offentligheten för registeruppgifter som samlas in om verkliga förmånstagare och om offentlighetens eventuella negativa effekter särskilt på skyddet för privatlivet. Lagutskottet noterade också risken för ett ökande antal bedrägerier och identitetsstölder till följd av att personbeteckningens slutled och hemadressen blir offentliga. 
I samband med en ändring av handelsregisterlagen 2013 (RP 59/2013 rd) fästes uppmärksamhet vid motsvarande problem i anknytning till utlämnande av personuppgifter. Resultatet blev då en begränsning av vilka uppgifter i handelsregistret som får lämnas ut. Lagutskottet såg det som ändamålsenligt — med hänsyn till skyddet för privatlivet — att bestämmelserna om offentligheten för uppgifter i föreningsregistret ändras till den del de gäller personers personbeteckning och hemadress så att de motsvarar lagstiftningen om de andra stamregistren i företags- och organisationsdatasystemet (FODS) och den föreslagna ändringen av 1 a § 3 mom. i handelsregisterlagen i propositionens lagförslag 4. 
Lagutskottet föreslog i sitt utlåtande att hemadressen för personer bosatta i Finland inte ska antecknas i föreningsregistret. Praxisen har i fråga om den motsvarande bestämmelsen i handelsregisterlagen tidigare motiverats inte bara med integritetsskyddet utan också med att personers hemadress enligt den så kallade principen för engångsregistrering kan fås ur befolkningsdatasystemet. För utomlands bosatta räcker det dock inte med uppgift om hemkommun, eftersom utländska adresser inte heltäckande kan fås ur FODS. Därför behövs uppgift om hemadress fortsättningsvis för de sistnämnda. 
Förvaltningsutskottet menar att de ändringar som lagutskottet föreslår behövs och föreslår att det till paragrafen fogas ett nytt 3 mom. på det sätt som framgår av lagutskottets utlåtande. 
I samband med genomförandet av det fjärde penningtvättsdirektivet blir föreningsregistret i likhet med handelsregistret och stiftelseregistret ett stamregister i det av Patent- och registerstyrelsen förda FODS. Det innebär bland annat att FODS:s allmänna registreringssystem och kundtjänster i fortsättningen kan utnyttjas bättre vid utvecklingen av föreningsregistrets funktioner. Det är samtidigt ändamålsenligt att säkerställa att det för samtliga registers del tillämpas enhetliga principer på de uppgifter som antecknas i och lämnas ut ur registret. Utöver de ändringar som nämns i lagutskottets utlåtande måste det till föreningslagen också fogas en allmän bestämmelse, motsvarande den som gäller för de andra stamregistren i FODS, om utlämnande av uppgifter i elektronisk form. Förvaltningsutskottet föreslår att det till 2 mom. fogas en bestämmelse om detta. Bestämmelsen motsvarar till sitt innehåll motsvarande bestämmelse i 1 a § 1 mom. i handelsregisterlagen. 
48 §. Grundanmälan.
Av de skäl som anges i samband med det nya 3 mom. i 47 § föreslår utskottet att också 48 § 2 mom. ändras på det sätt som föreslås i lagutskottets utlåtande. 
Ikraftträdandebestämmelsen.
De ändringar som föreslås i föreningslagen anknyter till att föreningsregistret ska bli ett stamregister i företags- och organisationsdatasystemet. Tidpunkten för lagändringens ikraftträdande beror på när samtliga föreningar tilldelats ett FO-nummer och ändringarna i datasystemen genomförts. Förvaltningsutskottet föreslår därför att ikraftträdandebestämmelsen ändras så att det ska föreskrivas om ikraftträdandet av ändringarna i föreningslagen genom förordning av statsrådet (1 mom.). Till lagen måste också fogas övergångsbestämmelser om tillämpningen av föreningslagens 47 § om utlämnande av uppgifter ur föreningsregistret i elektronisk form på sådana anmälningar till föreningsregistret och uppgifter i registret som antecknats före lagens ikraftträdande. Utskottet föreslår att det till ikraftträdandebestämmelsen fogas nya 2—4 mom. om detta. 
Lagens namn.
Förvaltningsutskottet har ovan föreslagit ändringar i tre paragrafer. Därför måste också lagens namn ändras. 
21. Lagen om ändring av religionsfrihetslagen
Ikraftträdandebestämmelsen.
Lagförslaget har en sedvanlig ikraftträdandebestämmelse. De ändringar som föreslås i religionsfrihetslagen anknyter till omvandlingen av registret över religionssamfund till ett stamregister i företags- och organisationsdatasystemet. Tidpunkten för lagändringens ikraftträdande beror på när samtliga religionssamfund tilldelats ett FO-nummer och ändringarna i datasystemen genomförts. Förvaltningsutskottet föreslår därför att ikraftträdandebestämmelsen ändras så att det ska föreskrivas om ikraftträdandet av ändringarna i religionsfrihetslagen genom förordning av statsrådet. 
22.
Lagen om ändring av företags- och organisationsdatalagen
10 §. Etableringsanmälan.
Enligt förslaget ska uppgifter om sådana verkliga förmånstagare som avses i 6 kap. 2 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism (lagförslag 1) anmälas elektroniskt. Lagutskottet noterar i sitt utlåtande att det är oklart vilka anmälningsskyldiga som ska omfattas av bestämmelsen om elektronisk anmälan. 
Enligt utredning är avsikten inte att man i fortsättningen ska kunna anmäla medlemmar i föreningars, religionssamfunds och stiftelsers styrelser (eller förvaltningsråd) endast elektroniskt, utan grund- och ändringsanmälan kan till denna del också framöver göras med de blanketter som avses i företags- och organisationsdatalagen. Detta har varit avsikten också i fråga om bostadsaktiebolag och ömsesidiga fastighetsaktiebolag. Med tanke också på de sanktioner som kan följa på försummelser föreslår lagutskottet att 3 momentets bestämmelse om elektronisk anmälan i företags- och organisationsdatalagen preciseras så att det säkerställs att det ovannämnda syftet uppnås. 
Förvaltningsutskottet konstaterar att en precisering av 3 mom. är motiverad och föreslår att bestämmelsen ändras på det sätt lagutskottet avser. Enligt inkommen utredning finns det dock inte anledning att infoga någon separat hänvisning till lagen om förhindrande av penningtvätt och av finansiering av terrorism, eftersom det i företags- och organisationsdatalagen inte regleras vad anmälningarna ska innehålla utan på vilket sätt anmälningarna ska göras. Anmälningsskyldigheten grundar sig på bestämmelserna om stamregistren i företags- och organisationsdatasystemet. 
11 §. Anmälan om ändring och nedläggning.
Av de skäl som konstaterades ovan i samband med 10 § föreslår förvaltningsutskottet att bestämmelsen preciseras på motsvarande sätt som 10 §. Det är ändamålsenligt med elektronisk anmälan om ändring och nedläggning också i fråga om utländska truster. 
19 §. Straffbestämmelser.
Lagutskottet noterade i sitt utlåtande bland annat att bestämmelserna om sanktioner för försummelse att göra anmälan är i någon mån oenhetliga i författningarna om de olika registren. Det vore enligt lagutskottet bra att göra en övergripande bedömning av de olika registerförfattningarnas bestämmelser om försummelse att göra anmälan. Bedömningen kunde göras före utgången av den övergångsperiod (30 juni 2019) som föreslås för tillämpningen av 6 kap. 4 § i lagförslag 1. I det sammanhanget vore det dessutom motiverat att granska den föreslagna avgränsningen i fråga om elektronisk anmälan i 19 § 2 mom. i företags- och organisationsdatalagen med avseende på de krav på exakthet och noggrann avgränsning som ingår i den straffrättsliga legalitetsprincipen. Samtidigt finns det skäl att överväga om de straffrättsliga påföljderna kunde ersättas med administrativa påföljder. Anmälningsskyldigheten är en administrativ skyldighet, och efterlevnaden av sådana stärks typiskt genom administrativa tvångsmedel som exempelvis vite, inte genom straffrättsliga påföljder. De behövliga lagändringarna kunde inkluderas i den proposition som syftar till att genomföra de kommande ändringarna i det fjärde penningtvättsdirektivet. Förhandlingarna om ändringarna är inne i slutfasen. 
Förvaltningsutskottet ser det som angeläget att sanktionsbestämmelserna bedöms på det sätt lagutskottet avser. Förvaltningsutskottet har föreslagit ändringar i bestämmelserna om övergångsperioder. De behövliga lagändringarna kan dock införas exempelvis i den kommande propositionen om nationellt genomförande av den tidigare nämnda direktivändringen. 
23.
Lagen om ändring av lagen om fastighetsförmedlingsrörelser och rörelser för förmedling av hyreslägenheter och hyreslokaler
5 a §. Tillförlitlighet.
I paragrafen föreslås det bestämmelser om de villkor som ställs på betydande ägares och ledningens tillförlitlighet när det gäller fastighetsförmedlingsrörelser och rörelser för förmedling av hyreslägenheter och hyreslokaler. Av ordalydelsen i 1 mom. verkar det som om bedömningen av en förmedlingsrörelses tillförlitlighet ska göras främst på grundval av straff- och bötesregistren. I paragrafens detaljmotiv hänvisas dock till 5 kap. 5 § i lagförslag 1, där det föreskrivs betydligt mer ingående om bedömningen av tillförlitligheten. Regeringen har tydligen avsett att det till lagen om fastighetsförmedlingsrörelser och rörelser för förmedling av hyreslägenheter och hyreslokaler ska fogas bestämmelser om bedömning av tillförlitligheten som motsvarar dem i 5 kap. 5 § 2 mom. i lagförslag 1 och bestämmelser om regionförvaltningsverkets rätt att få uppgifter som motsvarar 5—7 mom. i samma paragraf. 
Den föreslagna regleringen bör kompletteras på det sätt som avses i detaljmotiven. Förvaltningsutskottet föreslår därför att det till paragrafen fogas ett nytt 2 mom., enligt vilket, utöver det som föreskrivs i 1 mom., den som gör en registeranmälan inte anses vara tillförlitlig i den mening som avses i det momentet, om 1) han eller hon under tre år före bedömningen upprepade gånger eller i betydande grad har försummat sina registrerings-, rapporterings- och betalningsåtaganden i anslutning till skatter, lagstadgade pensions-, olycksfalls- och arbetslöshetsförsäkringsavgifter samt avgifter som Tullen tar ut eller 2) han eller hon enligt utmätning eller någon annan utredning är oförmögen att svara för sina skulder. Av förslaget följer att propositionens 2 mom. blir 3 mom. 
Av de skäl som nämns ovan föreslår förvaltningsutskottet dessutom att det till paragrafen fogas nya 4—6 mom. med motsvarande bestämmelser om regionförvaltningsverkets rätt att få uppgifter som finns i 5 kap. 5 § 5—7 mom. i lagförslag 1. 
17 §. Tillsyn och tillsynsmyndighetens rätt att få uppgifter. (Ny)
I paragrafen föreskrivs det om regionförvaltningsverkets rätt att få uppgifter ur bötesregistret. I propositionen föreslås det inte att paragrafen ska ändras. Av de skäl som nämns i samband med 5 a § måste dock 3 mom. ändras. I det gällande 3 mom. föreskrivs det enbart om rätten att få uppgifter ur bötesregistret och straffregistret när det gäller en ansvarig föreståndares tillförlitlighet. För att regionförvaltningsverket i enlighet med 5 a § 1 mom. ska kunna bedöma tillförlitligheten hos den som gör en anmälan och dennes ansvariga personer, måste regionförvaltningsverket ha rätt att få uppgifter om dem ur bötesregistret. Därför måste det till gällande 17 § 3 mom. fogas en hänvisning till den som gör en anmälan (8 § 1 mom. 3 punkten) och, om anmälan görs av en juridisk person, en hänvisning till dennes ansvariga personer (5 a §:n 3 mom.) samt en hänvisning till paragrafen om strykning ur registret över förmedlingsrörelser (19 §). Förvaltningsutskottet konstaterar att regleringen dessutom måste preciseras genom ett omnämnande av att regionförvaltningsverket har rätt att få uppgifterna trots sekretessbestämmelserna. Enligt grundlagsutskottets praxis ska uppgifterna dessutom vara nödvändiga för att utföra de aktuella åtgärderna. I slutet av förvaltningsutskottets förslag till 3 mom. finns liksom i den gällande lagen ett omnämnande av att det utfärdas särskilda bestämmelser om rätten att få uppgifter ur straffregistret. 
25. Lagen om ändring av 13 § i lagen om behandling av personuppgifter inom Tullen
13 §. Tullens rätt att få uppgifter ur vissa register och informationssystem.
Paragrafens 1 mom. har ändrats genom lag 1194/2016. Propositionens förslag till 1 mom. måste harmoniseras med den lagändringen. Lagändringen måste också beaktas i den föreslagna ändringen av momentets 4 punkt och i den 21 punkt som enligt förslaget ska fogas till momentet. 
Ingressen.
Av de skäl som nämns ovan måste också ingressen ses över. 
28. Lagen om ändring av 1 § i lagen om verkställighet av böter (Ny)
1 §. Lagens tillämpningsområde.
Av de skäl som anförts i samband med 8 kap. 9 § i lagförslag 1 måste det till lagen om verkställighet av böter (672/2002) fogas en bestämmelse om verkställighet av den ordningsavgift som avses i 8 kap. 1 § i lagförslag 1 och den påföljdsavgift som avses i 8 kap. 3 § i samma lagförslag. Bestämmelsen fogas lämpligast in som en ny 11 punkt i 1 mom., varvid det också i 10 punkten måste göras en lagteknisk ändring. Eftersom det i propositionen inte ingår något förslag till ändring av lagen om verkställighet av böter, föreslår utskottet att riksdagen godkänner ett nytt lagförslag 28 med ovan återgivna innehåll. 
Ikraftträdandebestämmelsen.
Utskottet föreslår en sedvanlig ikraftträdandebestämmelse i lagförslaget. 
29. Lagen om ändring av 8 kap. 3 § i lagen om värdeandelssystemet och om clearingverksamhet (Ny)
Riksdagen godkände den 17 maj 2017 en ny lag om värdeandelssystemet och om clearingverksamhet, genom vilken den gällande lagen med samma namn upphävs (EkUB 7/2017 rdRP 28/2016 rd). I den nya lagens 8 kap. 3 § 4 mom. hänvisas till den gällande lagen om förhindrande och utredning av penningtvätt och av finansiering av terrorism (503/2008). Hänvisningen måste ändras så att den hänvisar till den nya lagen om förhindrande av penningtvätt och av finansiering av terrorism. Utskottet föreslår att lagen preciseras på detta sätt. 
Ikraftträdandebestämmelsen.
Utskottet föreslår en sedvanlig ikraftträdandebestämmelse i lagförslaget. 
FÖRSLAG TILL BESLUT
Förvaltningsutskottets förslag till beslut:
Riksdagen godkänner lagförslag 2, 8—11, 14—17, 19, 24, 26 och 27 i proposition RP 228/2016 rd utan ändringar. 
Riksdagen godkänner lagförslag 1, 3—6, 12, 13, 18, 20—23 och 25 i proposition RP 228/2016 rd med ändringar. (Utskottets ändringsförslag) 
Riksdagen godkänner nya lagförslag 28 och 29. (Utskottets nya lagförslag) 
Riksdagen förkastar lagförslag 7 i proposition RP 228/2016 rd. 
Riksdagen godkänner ett uttalande (Utskottets förslag till uttalande)
Utskottets ändringsförslag
1. 
Lag 
om förhindrande av penningtvätt och av finansiering av terrorism 
I enlighet med riksdagens beslut föreskrivs: 
1 kap. 
Allmänna bestämmelser 
1 § 
Lagens syfte 
Syftet med denna lag är att förhindra penningtvätt och finansiering av terrorism, att främja avslöjande och utredning av sådan verksamhet samt att effektivisera spårning och återtagande av brottsvinningen. 
2 § 
Tillämpningsområde 
Denna lag tillämpas på: 
1) i 4 § 2 mom. i lagen om Finansinspektionen (878/2008) avsedda:
a) auktoriserade tillsynsobjekt, med undantag för börser enligt 2 mom. 6 punkten och centralinstitutet för en sammanslutning enligt 11 punkten i samma moment,
b) filialer till utländska sammanslutningar som motsvarar auktoriserade tillsynsobjekt enligt underpunkt a,
c) representanter i Finland för utländska sammanslutningar som motsvarar auktoriserade tillsynsobjekt enligt underpunkt a, om sammanslutningen tillhandahåller tjänster i Finland utan att etablera filial,
 
2) finansiella institut som hör till samma finansiella företagsgrupp som ett kreditinstitut enligt kreditinstitutslagen (610/2014), 
3) sådana kontoförvaltare och sådana utländska som kontoförvaltare auktoriserade sammanslutningars verksamhetsställen i Finland som avses i lagen om värdeandelssystemet och om clearingverksamhet (749/2012), 
4) fysiska och juridiska personer enligt 7 och 7 a § i lagen om betalningsinstitut (297/2010) och registreringsskyldiga förvaltare av alternativa investeringsfonder enligt lagen om förvaltare av alternativa investeringsfonder (162/2014), 
5) försäkringsföreningar enligt lagen om försäkringsföreningar (1250/1987), 
6) försäkringsförmedlare enligt lagen om försäkringsförmedling (570/2005) och i Finland etablerade filialer till utländska försäkringsförmedlare, 
7) förmedlare av gräsrotsfinansiering enligt lagen om gräsrotsfinansiering (734/2016), 
8) sådana finländska förmedlare av krediter och utländska kreditförmedlares filialer i Finland som avses i lagen om förmedlare av konsumentkrediter som har samband med bostadsegendom ( / ), 
9) penningspelssammanslutningar enligt 11 § i lotterilagen (1047/2001), 
10) penningspelssammanslutningar enligt Ålands landskapslagstiftning, 
11) revisorer enligt revisionslagen (1141/2015) när de utför lagstadgad revision enligt 1 kap. 1 § 1 mom. i den lagen, 
12) advokater enligt lagen om advokater (496/1958) och på dem som biträder advokaterna, till den del det är fråga om att de handlar i en klients namn eller för en klients räkning vid finansiella transaktioner eller transaktioner avseende fast egendom eller att de i en klients namn deltar i planering eller genomförande av följande transaktioner:
a) köp eller försäljning av fastigheter eller affärsenheter,
b) förvaltning av klienters penningmedel, värdepapper och andra tillgångar,
c) öppnande och förvaltning av bank-, spar- eller värdeandelskonton,
d) organisering av medel som behövs för bildande eller ledning av bolag eller för förvaltning av företag, eller
e) bildande och ledning av stiftelser, bolag och motsvarande sammanslutningar samt att svara för deras verksamhet,
 
13) andra som affärs- eller yrkesmässigt tillhandahåller juridiska tjänster, till den del det är fråga om att de handlar i en klients namn eller för en klients räkning vid finansiella transaktioner eller transaktioner avseende fast egendom eller att de i en klients namn deltar i planering eller genomförande av följande transaktioner:
a) köp och försäljning av fastigheter och affärsenheter,
b) förvaltning av klienters penningmedel, värdepapper och andra tillgångar,
c) öppnande och förvaltning av bank-, spar- och värdeandelskonton,
d) organisering av medel som behövs för bildande och ledning av bolag samt för förvaltning av företag, eller
e) bildande och ledning av stiftelser, bolag och motsvarande sammanslutningar samt att svara för deras verksamhet,
 
14) företag som tillhandahåller finansiella tjänste, 
15) näringsidkare som omfattas av tillämpningsområdet för lagen om registrering av vissa kreditgivare och kreditförmedlare ( / ) då de förmedlar person-till-person-lån, 
16) personer som affärs- eller yrkesmässigt tillhandahåller tjänster enligt 2 kap. 3 § 1—7 punkten i lagen om investeringstjänster (747/2012), 
17) pantlåneinrättningar enligt lagen om pantlåneinrättningar (1353/1992), 
18) företag enligt lagen om fastighetsförmedlingsrörelser och rörelser för förmedling av hyreslägenheter och hyreslokaler (1075/2000), 
19) fastighetsförmedlingsrörelser och rörelser för förmedling av hyreslägenheter och hyreslokaler enligt Ålands landskapslagstiftning, 
20) innehavare av koncession för indrivningsverksamhet enligt 1 § 1 mom. i lagen om tillståndsplikt för indrivningsverksamhet (517/1999), 
21) dem som tillhandahåller företagstjänster, 
22) dem som affärs- eller yrkesmässigt tillhandahåller huvudsakligen skatterådgivningstjänster, 
23) dem som affärs- eller yrkesmässigt utför bokföringsuppgifter enligt uppdrag, 
24) dem som affärs- eller yrkesmässigt säljer eller förmedlar varor, till den del de kontant får en betalning eller flera med varandra sammanhängande betalningar som sammanlagt uppgår till minst 10 000 euro. 
Denna lags 3 och 4 kap. ska tillämpas också på näringsidkare och sammanslutningar som förmedlar deltagaranmälningar och -avgifter för penningspel som tillhandahålls av sådana penningspelssammanslutningar som avses i 1 mom. 9 och 10 punkten, om penningspelssammanslutningen till en sådan annan näringsidkare eller sammanslutning har överfört ansvaret för kundkontroll samt rapporteringsskyldigheten. Denna lags 7 och 8 kap. ska, enligt vad som föreskrivs i respektive kapitel, tillämpas på tillsyn över de nämnda näringsidkarna och sammanslutningarna. 
Denna lag ska tillämpas också när de medel som är föremål för en transaktion härrör från åtgärder som vidtagits inom en annan stats territorium. 
Bestämmelser om skyldigheten av vissa sammanslutningar, föreningar, religionssamfund och stiftelser att upprätthålla information om sina verkliga förmånstagare finns i kap. 6. 
3 § 
Avgränsning tillämpningsområdet 
Denna lag tillämpas inte på ekonomisk verksamhet som bedrivs tillfälligt eller i mycket begränsad omfattning och följande förutsättningar uppfylls: 
1) verksamheten är obetydlig, 
2) verksamheten utgör inte en persons huvudsakliga affärsverksamhet utan består av sidotjänster som direkt har samband med den och sidotjänsternas andel av omsättningen under räkenskapsperioden uppgår till högst fem procent, 
3) verksamheten bedrivs av en person som inte bedriver verksamhet enligt 2 § 1 mom. 1—23 punkten som sin huvudsakliga affärsverksamhet, 
4) verksamheten tillhandahålls kunder inom den huvudsakliga affärsverksamheten och tillhandahålls inte allmänheten, 
5) verksamheten är inte penningförmedling enligt 1 § 2 mom. 5 punkten i lagen om betalningsinstitut. 
Denna lag tillämpas inte på ett bolag när i stället för aktieägaren en person som sköter förvaltarregistreringen har införts bolagets aktieägarförteckning , om bolagets värdepapper är föremål för handel på en reglerad marknad enligt 1 kap. 2 § i lagen om handel med finansiella instrument (748/2012). 
Denna lag tillämpas inte på verksamhet som gäller skötsel av uppdrag som utförs i egenskap av rättegångsbiträde eller rättegångsombud. Med sådana uppdrag avses i denna lag, utöver egentliga uppdrag i anslutning till en rättegång, också juridisk rådgivning som gäller en klients rättsliga ställning vid förundersökningen av ett brott eller i någon annan fas av behandlingen av ett ärende inför en rättegång samt inledande eller undvikande av rättegång. 
Denna lag tillämpas inte på verksamhet som består i att tillhandahålla penningautomater för användning utanför kasinon. 
Genom förordning av finansministeriet utfärdas närmare föreskrifter om när finansiell verksamhet ska betraktas som obetydlig på det sätt som avses i 1 mom. 1 punkten. 
4 § 
Definitioner 
I denna lag avses med: 
1) penningtvätt verksamhet enligt 32 kap. 6—10 § i strafflagen (39/1889), 
2) finansiering av terrorism verksamhet enligt 34 a kap. 5 och 5 a § i strafflagen, 
3) penningtvättsdirektivet Europaparlamentets och rådets direktiv (EU) 2015/849 om åtgärder för att förhindra att det finansiella systemet används för penningtvätt eller finansiering av terrorism, om ändring av Europaparlamentets och rådets förordning (EU) nr 648/2012 och om upphävande av Europaparlamentets och rådets direktiv 2005/60/EG och kommissionens direktiv 2006/70/EG, 
4) förordningen om information om betalaren Europaparlamentets och rådets förordning (EU) 2015/847 om uppgifter som ska åtfölja överföringar av medel och om upphävande av förordning (EG) nr 1781/2006, 
5) rapporteringsskyldiga sammanslutningar och näringsidkare enligt 2 § 1 mom.,  
6) identifiering utredning av en kunds identitet på grundval av uppgifter som kunden tillhandahållit, 
7) kontroll av identiteten säkerställande av en kunds identitet utifrån handlingar och uppgifter från en tillförlitlig och oberoende källa, 
8) kreditinstitut ett kreditinstitut enligt 1 kap. 7 § i kreditinstitutslagen, 
9) utländsk trust en trust enligt artikel 3.7 i penningtvättsdirektivet, dock inte sådana tillhandahållare av företagstjänster som avses i den punkten, 
10) tillhandahållare av företagstjänster en sammanslutning eller näringsidkare som tillhandahåller tredje parter någon av följande tjänster som affärsverksamhet:
a) bildar en sammanslutning för en tredje parts räkning,
b) verkar som bolagsrättsligt ansvarig person eller ansvarig bolagsman eller i motsvarande ställning i andra juridiska personer,
c) tillhandahåller hemort, företagsadress, postadress eller andra motsvarande tjänster,
d) förvaltar i Finland en utländsk klassisk trust enligt artikel 3.7 d i penningtvättsdirektivet eller en liknande juridisk konstruktion,
e) sköter förvaltarregistrering, när den som ska sköta registreringen har införts i aktieägarförteckningen för ett annat än ett publikt aktiebolag,
 
11) person i politiskt utsatt ställning en fysisk person som har eller har haft offentliga uppdrag som:
a) statschef, regeringschef, minister, vice minister eller biträdande minister,
b) parlamentsledamot,
c) medlem av politiska partiers styrelser,
d) ledamot i en av de högsta domstolarna, i en konstitutionell domstol eller i ett motsvarande rättsorgan vars beslut endast undantagsvis kan överklagas,
e) ledamot i det högsta beslutande organ som granskar skötseln av en stats finanser och som motsvaras av revisionsrätten eller av statens revisionsverk,
f) ledamot i direktionen för en centralbank,
g) ambassadör eller chargé-d'affaires,
h) minst sådan officer som hör till generalitetet i försvarsmakten,
i) medlem av ett förvaltnings-, lednings- eller tillsynsorgan i ett företag som är helt statsägt eller som
j) direktör, biträdande direktörer eller styrelseledamot i en internationell sammanslutning,
 
12) familjemedlem till en person i politiskt utsatt ställning hans eller hennes:
a) make eller partner som enligt den nationella lagstiftningen i respektive land likställs med make,
b) barn och ett barns make eller sådan partner som avses ovan, och
c) föräldrar,
 
13) medarbetare till en person i politiskt utsatt ställning
a) varje fysisk person om vilken det är känt att han eller hon är verklig samägare eller förmånstagare i en sammanslutning, näringsidkare eller annan juridisk konstruktion eller har andra nära affärsförbindelser med en person i politiskt utsatt ställning eller med en familjemedlem till honom eller henne, och
b) varje fysisk person som är verklig ensamägare till eller förmånstagare i en sammanslutning, näringsidkare eller annan juridisk konstruktion om vilken det är känt att den de facto har upprättats till förmån för en person i politiskt utsatt ställning eller för en familjemedlem till honom eller henne,
 
14) tillsynsmyndighet en myndighet enligt 7 kap. 1 § 1 mom.,  
15) europeiska tillsynsmyndigheter den europeiska bankmyndighet som avses i Europaparlamentets och rådets förordning (EU) nr 1093/2010 om inrättande av en europeisk tillsynsmyndighet (Europeiska bankmyndigheten), om ändring av beslut nr 716/2009/EG och om upphävande av kommissionens beslut 2009/78/EG, den europeiska värdepappers- och marknadsmyndighet som avses i Europaparlamentets och rådets förordning (EU) nr 1095/2010 om inrättande av en europeisk tillsynsmyndighet (Europeiska värdepappers- och marknadsmyndigheten), om ändring av beslut nr 716/2009/EG och om upphävande av kommissionens beslut 2009/77/EG och den europeiska försäkrings- och tjänstepensionsmyndighet som avses i Europaparlamentets och rådets förordning (EU) nr 1094/2010 om inrättande av en europeisk tillsynsmyndighet (Europeiska försäkrings- och tjänstepensionsmyndigheten), om ändring av beslut nr 716/2009/EG och om upphävande av kommissionens beslut 2009/79/EG, 
16) finansiellt institut
a) ett värdepappersföretag enligt 1 kap. 9 § i lagen om investeringstjänster,
b) ett finländskt fondföretag enligt 2 § 1 mom. 3 punkten i lagen om placeringsfonder (48/1999) och en finländsk förvaltare av alternativa investeringsfonder enligt lagen om förvaltare av alternativa investeringsfonder (162/2014),
c) ett försäkringsföretag enligt 26 kap. 1 § 1 mom. 7 punkten i försäkringsbolagslagen (521/2008), som bedriver livförsäkringsverksamhet,
d) en försäkringsförmedlare enligt 3 § 3 punkten i lagen om försäkringsförmedling, om denne förmedlar livsförsäkringar och andra investeringsrelaterade tjänster,
e) inom Europeiska ekonomiska samarbetsområdet etablerade filialer till finansiella institut som avses i a—d punkten, oavsett om de finansiella instituten har hemort inom Europeiska ekonomiska samarbetsområdet eller inte,
 
17) företag som tillhandahåller finansiella tjänster ett annat företag än en sammanslutning eller näringsidkare enligt 1 kap. 2 § 1 mom. 1—8 punkten som bedriver en eller flera verksamheter enligt 5 kap. 1 § 1 mom. 2—11, 13 eller 14 punkten i kreditinstitutslagen samt i Finland etablerade filialer till företag som tillhandahåller finansiella tjänster, 
18) korrespondentförbindelse
a) tillhandahållande av banktjänster från en bank som korrespondent till en annan bank som motpart, inbegripet tillhandahållande av ett löpande konto eller annat passivkonto och härtill knutna tjänster, t.ex. likviditetsförvaltning, internationella överföring av medel, checkavräkning, betalningsförmedlingskonton och valutatjänster,
b) förbindelser mellan kreditinstitut och finansiella institut där liknande tjänster tillhandahålls av ett korrespondentinstitut eller motpartsinstitut, och inbegripet förbindelse som etablerats för värdepapperstransaktioner eller överföring av medel.
 
5 § 
Verkliga förmånstagare i sammanslutningar 
Med en sammanslutnings verkliga förmånstagare avses en fysisk person som ytterst 
1) direkt eller indirekt äger mer än 25 procent av aktierna i den juridiska personen eller annars en motsvarande andel i den juridiska personen, 
2) direkt eller indirekt utnyttjar mer än 25 procent av rösträtten i den juridiska personen och detta röstetal är baserat på ägande, medlemskap, bolagsordningen, bolagsavtalet eller på motsvarande stadgar, eller som 
3) på annat sätt faktiskt utövar ett bestämmande inflytande i den juridiska personen. 
En indikation på direkt ägande är att den fysiska personen äger mer än 25 procent i den juridiska person som gransknas. 
En indikation på indirekt ägande är att 
1) en juridisk person i vilken en eller flera fysiska personer utövar självständig beslutanderätt äger mer än 25 procent eller innehar mer än 25 procent av rösträtten i den juridiska person som gransknas, eller att 
2) en fysisk eller juridisk person, i vilken en fysisk person utövar självständig beslutanderätt, på grund av ägande, medlemskap, bolagsordningen, bolagsavtalet eller motsvarande stadgar har rätt att utse eller entlediga en majoritet av ledamöterna i styrelsen för eller i ett jämförbart organ i den juridiska person som gransknas. 
Om en verklig förmånstagare inte kan identifieras eller om de förutsättningar som anges i 1 mom. inte uppfylls ska som verklig förmånstagare betraktas styrelsen för eller ansvariga bolagsmän, verkställande direktör eller en person i motsvarande ställning i den juridiska person som gransknas. 
6 § 
Verkliga förmånstagare i utländska truster  
Med en utländsk trusts verkliga förmånstagare avses en fysisk person som utövar faktiskt bestämmande inflytande i trusten och som är trustens 
1) instiftare eller beskyddare som instiftaren eventuellt har tillsatt, 
2) förvaltare, eller 
3) förmånstagare. 
Utöver det som föreskrivs i 1 mom. betraktas som verkliga förmånstagare också andra fysiska personer som ytterst utövar bestämmande inflytande över en utländsk trust genom direkt eller indirekt ägande eller på något annat sätt. 
7 § 
Verkliga förmånstagare i föreningar, religionssamfund, stiftelser, bostadsaktiebolag och ömsesidiga fastighetsaktiebolag 
Som verkliga förmånstagare i ideella föreningar enligt föreningslagen (503/1989) betraktas styrelsemedlemmar som är antecknade i föreningsregistret. 
Som verkliga förmånstagare i religionssamfund enligt religionsfrihetslagen (453/2003) betraktas styrelsemedlemmar som är antecknade i registret över religionssamfund. 
Som verkliga förmånstagare i stiftelser enligt stiftelselagen (487/2015) betraktas styrelseledamöter och förvaltningsrådsledamöter som är antecknade i stiftelseregistret. 
Som verkliga förmånstagare i bostadsaktiebolag och ömsesidiga fastighetsaktiebolag enligt lagen om bostadsaktiebolag (1599/2009) betraktas styrelseledamöter som är antecknade i handelsregistret. 
2 kap. 
Riskbedömning 
1 § 
Nationell bedömning av riskerna för penningtvätt och finansiering av terrorism 
Inrikesministeriet samordnar den nationella bedömningen av riskerna för penningtvätt och finansiering av terrorism. I riskbedömningen ska de risker för penningtvätt och finansiering av terrorism som gäller i Finland identifieras och bedömas samt Europeiska kommissionens bedömning på unionsnivå av riskerna för penningtvätt och finansiering av terrorism beaktas. Den nationella riskbedömningen ska uppdateras regelbundet. 
Syftet med riskbedömningen är att 
1) specificera riskerna för penningtvätt och finansiering av terrorism inom olika sektorer, 
2) stödja och effektivisera bekämpningen av penningtvätt och av finansiering av terrorism samt resursfördelningen, 
3) stödja olika sektorer vid upprättandet av enhetliga rutiner för bekämpning av penningtvätt och av finansiering av terrorism, 
4) ge behöriga tillsynsmyndigheter, advokatföreningen och rapporteringsskyldiga information som stöd för riskbedömningen enligt 2 och 3 §.  
Inrikesministeriet ska offentliggöra en sammanfattning av riskbedömningen. 
2 § 
Övervakarspecifik riskbedömning 
Tillsynsmyndigheten och advokatföreningen ska göra en bedömning av riskerna för att penningtvätt och finansiering av terrorism bedrivs genom de rapporteringsskyldiga som omfattas av tillsynen (övervakarspecifik riskbedömning). Tillsynsmyndigheten och advokatföreningen ska när riskbedömningen görs beakta 
1) kommissionens bedömning på unionsnivå av riskerna för penningtvätt och finansiering av terrorism samt de risker för penningtvätt och finansiering av terrorism som framgår av bedömningen, 
2) den nationella riskbedömningen och de nationella risker för penningtvätt och finansiering av terrorism som den anger, 
3) de risker för penningtvätt och finansiering av terrorism som är förenade med rapporteringsskyldiga och deras kunder, produkter och tjänster inom den övervakade sektorn. 
Tillsynsmyndigheten och advokatföreningen ska vid planeringen av tillsynens omfattning och frekvens beakta sin riskbedömning, de undantag som tillåts inom en rapporteringsskyldigs verksamhet samt riskerna inom respektive sektor enligt 1 mom. 3 punkten. 
Tillsynsmyndigheten och advokatföreningen ska uppdatera den övervakarspecifika riskbedömningen regelbundet eller när det i en rapporteringsskyldigs verksamhet förekommer sådana omständigheter eller förändringar som är relevanta för riskbedömningen. 
Tillsynsmyndigheten och advokatföreningen ska offentliggöra ett sammandrag av riskbedömningen. 
3 § 
Rapporteringsskyldigas riskbedömning 
De rapporteringsskyldiga ska göra riskbedömningar för att kunna identifiera och bedöma riskerna för penningtvätt och finansiering av terrorism. Riskbedömningarna ska uppdateras regelbundet. Bedömningarna och ändringar i dem ska utan obefogat dröjsmål ges in till tillsynsmyndigheten eller advokatföreningen på begäran av dem. 
Den rapporteringsskyldig ska i riskbedömningen beakta arten, storleken och omfattningen av sin verksamhet. Den rapporteringsskyldiga ska med beaktande av dessa faktorer ha tillräckliga verksamhetsprinciper, förfaranden och kontroller för att minska och effektivt hantera riskerna för penningtvätt och finansiering av terrorism. Verksamhetsprinciperna, förfarandena och kontrollerna ska åtminstone omfatta 
1) utvecklande av interna verksamhetsprinciper, förfaranden och kontroller, 
2) intern kontroll, om det är motiverat med tanke på arten och storleken av den rapporteringsskyldigas verksamhet. 
Den rapporteringsskyldiga ska följa och utveckla de verksamhetsprinciper, förfaranden och kontroller som avses i 2 mom. samt de åtgärder som anknyter till dem. Om den rapporteringsskyldiga är en juridisk person, ska styrelsen, en ansvarig bolagsman eller någon annan person i motsvarande ställning som hör till den högsta ledningen godkänna de verksamhetsprinciper, förfaranden och kontroller som avses i 2 mom. samt följa och utveckla de åtgärder som anknyter till dem. 
Det centralinstitut som avses i lagen om en sammanslutning av inlåningsbanker (599/2010) kan, med tillstånd av Finansinspektionen, upprätta en riskbedömning för medlemskreditinstitut som hör till sammanslutningen. 
3 kap. 
Kundkontroll 
1 § 
Kundkontroll och riskbaserad bedömning 
En rapporteringsskyldig som inte kan vidta i detta kapitel föreskrivna åtgärder för kundkontroll får inte etablera kundförhållanden, genomföra transaktioner eller upprätthålla affärsförhållanden. En rapporteringsskyldig som är ett kreditinstitut får inte heller genomföra betalningstransaktioner via ett betalkonto, om den rapporteringsskyldiga inte kan vidta åtgärder för kundkontroll. 
Den rapporteringsskyldiga ska vid bedömningen av riskerna för penningtvätt och finansiering av terrorism i anknytning till kundförhållandet beakta de risker för penningtvätt och finansiering av terrorism som är förenade med kunder, länder och geografiska områden, produkter, tjänster och transaktioner samt distributionskanaler (riskbaserad bedömning). 
De åtgärder för kundkontroll som anges i detta kapitel ska med utifrån den riskbaserade bedömningen iakttas i varje kundförhållande så länge det består. 
De rapporteringsskyldiga ska kunna visa tillsynsmyndigheten eller den som ålagts att utöva tillsyn, att deras metoder för kundkontroll och fortlöpande övervakning enligt denna lag är tillräckliga med beaktande av risken för penningtvätt och finansiering av terrorism. 
2 § 
Kundidentifiering och identitetskontroll  
De rapporteringsskyldiga ska identifiera sina kunder och kontrollera deras identitet vid etablering av ett fast kundförhållande. Dessutom ska den rapporteringsskyldiga identifiera sina kunder och kontrollera identiteten, om 
1) en enskild transaktion eller flera sammanhängande transaktioner sammanlagt uppgår till minst 10 000 euro och kundförhållandet är tillfälligt, eller om det är fråga om en sådan överföring av medel enligt artikel 3.9 i förordningen om information om betalaren, som överstiger 1 000 euro, 
2) en enskild transaktion eller flera sammanhängande transaktioner vid kontantförsäljning av varor sammanlagt uppgår till minst 10 000 euro och kundförhållandet är tillfälligt, 
3) det är fråga om en tvivelaktig transaktion eller om den rapporteringsskyldiga misstänker att medel som ingår i transaktionen används för finansiering av terrorism eller för straffbart försök till detta, eller om 
4) den rapporteringsskyldiga misstänker att uppgifterna om en kund vars identitet tidigare har kontrollerats inte är tillförlitliga eller tillräckliga. 
Med avvikelse från 1 mom. 1 och 2 punkten ska kunden vid penningspelsverksamhet identifieras och identiteten kontrolleras antingen i samband med satsningen eller vinstutdelningen, eller i båda situationerna, om det belopp som spelaren satsar eller den vinst som spelaren löser ut per gång eller som sammanhängande utbetalningar uppgår till sammanlagt minst 2 000 euro. 
Om någon handlar för en kunds räkning (representant) ska den rapporteringsskyldiga identifiera representanten och kontrollera också dennas identitet samt förvissa sig om representantens rätt att företräda kunden. 
En rapporteringsskyldig ska identifiera sin kund och kontrollera dennas identitet när kundförhållandet etableras eller senast innan kunden får bestämmanderätt över de medel eller annan egendom som ingår i transaktionen eller innan transaktionen har slutförts. 
Om kunden ska identifieras och identiteten kontrolleras på grund av att det sammanlagda värdet av enskilda transaktioner i sådana fall som avses i 1 mom. 1 punkten är minst 10 000 euro eller en sådan överföring av medel som avses i artikel 3.9 i förordningen om information om betalaren överskrider 1 000 euro eller det sammanlagda värdet av enskilda transaktioner i sådana fall som avses i 1 mom. 2 punkten är minst 10 000 euro eller i sådana fall som avses i 2 mom. minst 2 000 euro, ska identiteten kontrolleras när den nämnda gränsen nås. 
Bestämmelser om åtgärder för identifiering och om kontroll av identiteten finns dessutom i förordningen om information om betalaren. 
3 § 
Uppgifter om kundkontroll och bevarande av uppgifterna 
Den rapporteringsskyldiga ska bevara uppgifter om kundkontroll på ett tillförlitligt sätt i fem år från det att ett fast kundförhållande har upphört. När det är fråga om en tillfällig transaktion enligt 2 § 1 mom. 1 eller 2 punkten eller 2 mom. i den paragrafen, ska uppgifter om kundkontroll bevaras i fem år från det att transaktionen har slutförts. 
Av kundkontrolluppgifterna ska följande bevaras: 
1) namn, födelsetid och personbeteckning, 
2) representanters namn, födelsetid och personbeteckning, 
3) juridiska personers fullständiga namn, registernummer, registreringsdag och registermyndighet, 
4) fullständiga namn samt födelsetider och medborgarskap för ledamöterna i juridiska personers styrelser eller i motsvarande beslutande organ, 
5) juridiska personers bransch, 
6) namn, födelsetid och personbeteckning för verkliga förmånstagare, 
7) namnet på dokument som använts för att kontrollera identiteten, dokumentets nummer eller någon annan identifieringsuppgift och dokumentets utfärdare eller en kopia av dokumentet eller, om kunden har identifierats på distans, uppgifter om de förfaranden eller källor som använts, 
8) uppgifter om kundens verksamhet, arten och omfattningen av kundens affärsverksamhet, kundens ekonomiska ställning, grunderna för användningen av transaktionen eller tjänsten och uppgifter om medlens ursprung samt övriga i 4 § 1 mom. avsedda behövliga uppgifter som inhämtats för kundkontroll, och 
9) nödvändiga uppgifter som inhämtats för fullgörande av utredningsskyldigheten enligt 4 § 3 mom. samt de skärpta åtgärderna för kundkontroll i fråga om personer i politiskt utsatt ställning enligt 13 §. 
Om kunden är utländsk och saknar finsk personbeteckning ska, utöver uppgifterna enligt 2 mom., uppgifter om kundens medborgarskap och resedokument bevaras. 
De rapporteringsskyldiga ska underrätta sina kunder om att uppgifter om kundkontroll och andra personuppgifter kan användas till att förhindra, avslöja och utreda penningtvätt och finansiering av terrorism och för att inleda undersökning av penningtvätt, finansiering av terrorism och det brott genom vilket de tillgångar eller den vinning av brott har erhållits som är föremål för penningtvätt eller finansiering av terrorism. 
Kontrolluppgifter och andra personuppgifter som inhämtats endast för förhindrande och avslöjande av penningtvätt och av finansiering av terrorism, får inte användas för ändamål som strider mot dessa syften. 
4 § 
Inhämtande av uppgifter om kunder samt fortlöpande uppföljning och utredningsskyldighet  
De rapporteringsskyldiga ska inhämta uppgifter om sina kunders verksamhet, arten och omfattningen av deras affärsverksamhet och om grunderna för att en tjänst eller produkt används. 
De rapporteringsskyldiga ska ordna uppföljning som med beaktande av arten och omfattningen av kundernas verksamhet, kundförhållandenas beständighet och varaktighet samt riskerna är tillräcklig för att säkerställa att kundernas verksamhet är förenlig med den rapporteringsskyldigas erfarenheter av och uppgifter om kunden och dennes verksamhet. 
De rapporteringsskyldiga ska särskilt fästa vikt vid transaktioner som till sin struktur eller storlek eller i förhållande till den rapporteringsskyldigas storlek eller driftställe avviker från det normala. Samma förfarande ska tillämpas om transaktionerna inte har något uppenbart ekonomiskt syfte eller inte är förenliga med den rapporteringsskyldigas erfarenheter av eller uppgifter om kunden. Vid behov ska ursprunget till medlen i en transaktion utredas. 
5 § 
Särskild identifieringsskyldighet i anslutning till försäkringsprodukter 
Kreditinstitut och finansiella institut ska, utöver det som föreskrivs någon annanstans i detta kapitel, i fråga om livförsäkringar och andra placeringsförsäkringar utreda 
1) förmånstagarens namn, när en person har identifierats eller nämnts som förmånstagare, 
2) tillräckliga identifieringsuppgifter för förmånstagare som delas in på något annat sätt än enligt 1 punkten, för att utbetalning ska kunna ske när försäkringen faller ut. 
Förmånstagare som avses i 1 mom. ska identifieras vid utbetalningen. 
Kreditinstitut och finansiella institut ska identifiera en tredje part till vilken eller till förmån för vilken en livförsäkring eller placeringsförsäkring överförs när överlåtelsen görs, om institutet hade kännedom om överlåtelsen. 
Kreditinstitut och finansiella institut ska se till att de har tillräckliga uppgifter om verkliga förmånstagare i utländska truster och hos dem som tillhandahåller företagstjänster, så att de kan ta reda på sina rättigheter i anslutning till de utländska trusterna och företagstjänsterna. 
Kreditinstitut och finansiella institut ska senast vid utbetalningen eller när försäkringen helt eller delvis överförs utreda om förmånstagaren i en livförsäkring eller någon annan placeringsförsäkring är en person i politiskt utsatt ställning. Om en försäkring eller dess förmånstagare är förenad med en större risk för penningtvätt eller finansiering av terrorism än normalt, ska en anställd vid kreditinstitutet eller det finansiella institutet dessutom underrätta institutets ledning om saken före utbetalningen av försäkringsersättningen och iaktta bestämmelserna om skärpta åtgärder för kundkontroll. 
6 § 
Identifiering av verkliga förmånstagare 
De rapporteringsskyldiga ska identifiera och upprätthålla tillräckliga, korrekta och aktuella uppgifter om kundernas verkliga förmånstagare och vid behov kontrollera förmånstagarnas identitet. En sammanslutnings verkliga förmånstagare ska alltid identifieras i sådana situationer som avses i 1 kap. 5 § 2 - 4 mom. och 7 §. Dessutom ska de rapporteringsskyldiga med beaktande av de risker för penningtvätt och finansiering av terrorism som är förenade med en kund, på ett ändamålsenligt sätt och i en tillräcklig omfattning utreda om någon annan utövar sådant bestämmande inflytande över kunden som avses i 1 kap. 5 § 1 mom. 
En verklig förmånstagare behöver dock inte identifieras, om kunden är ett bolag vars värdepapper är föremål för handel 
1) på en reglerad marknad enligt 2 kap. 5 § i värdepappersmarknadslagen (746/2012), eller 
2) på en reglerad marknad som motsvarar en reglerad marknad enligt 1 punkten i ett land utanför Europeiska ekonomiska samarbetsområdet och om bolaget är informationsskyldigt på ett sätt som motsvarar informationsskyldigheten enligt Europaparlamentets och rådets direktiv 2014/65/EU om marknader för finansiella instrument och om ändring av direktiv 2002/92/EG och av direktiv 2011/61/EU. 
Kreditinstitut behöver inte identifiera de verkliga förmånstagarna för gemensamma konton som förvaltas av en advokat eller någon annan som tillhandahåller juridiska tjänster, om advokaten eller den som tillhandahåller juridiska tjänster är verksam i Finland eller i en annan EES-stat och om uppgifter om en verklig förmånstagares identitet finns tillgängliga för kreditinstitutet på begäran. 
Kreditinstitut behöver inte heller identifiera de verkliga förmånstagarna för gemensamma konton som förvaltas av en advokat eller någon annan som tillhandahåller juridiska tjänster, om advokaten eller den som tillhandahåller juridiska tjänster är verksam i någon annan än en EES-stat och om 
1) uppgifter om en verklig förmånstagares identitet på begäran finns tillgängliga för kreditinstitutet, och om 
2) advokaten eller någon annan som tillhandahåller juridiska tjänster har skyldigheter som motsvarar skyldigheterna enligt denna lag och fullgörandet av skyldigheterna övervakas. 
Kreditinstitut behöver inte heller identifiera de verkliga förmånstagarna för gemensamma konton i anslutning till uppdrag som utförs av ett rättegångsbiträde eller rättegångsombud eller sådana uppdrag som utförs av en advokat eller någon annan som tillhandahåller juridiska tjänster och som inte omfattas av tillämpningsområdet för denna lag. 
7 § 
Fullgörande av skyldigheter i fråga om kundkontroll för den rapporteringsskyldigas räkning 
Åtgärder för kundkontroll kan på en rapporteringsskyldigs vägnar vidtas av en annan rapporteringsskyldig enligt 1 kap. 2 § 1 mom. eller av en motsvarande aktör som har beviljats koncession eller registrerats i en annan EES-stat (tredje part), om denna har sådana skyldigheter i fråga om kundkontroll och bevarande av uppgifter som motsvarar skyldigheterna enligt denna lag och fullgörandet av skyldigheterna övervakas. 
Åtgärder för kundkontroll kan vidtas också av en aktör som motsvarar en rapporteringsskyldig enligt 1 kap. 2 § 1 mom. och som har beviljats koncession eller registrerats i någon annan än en EES-stat, om denna aktör är grundad i en stat vars system för förhindrande och utredning av penningtvätt och av finansiering av terrorism enlig kommissionens bedömning inte innebär någon avsevärd risk för EU:s inre marknad. 
Med avvikelse från 1 och 2 mom. får en rapporteringsskyldig för att fullgöra sina skyldigheter inte anlita 
1) betalningsinstitut vars betaltjänster huvudsakligen består i att tillhandahålla penningförmedling enligt lagen om betalningsinstitut, 
2) fysiska eller juridiska personer enligt 7 och 7 a § i lagen om betalningsinstitut, eller 
3) någon som bedriver valutaväxlingsverksamhet. 
De rapporteringsskyldiga ska se till att de innan en transaktion genomförs får de uppgifter som avses i 3 § 2 mom. 1—6 punkten av en tredje part. En rapporteringsskyldig ska dessutom se till att den har tillgång till alla uppgifter om kundkontroll och att en tredje part på dennas begäran lämnar uppgifterna till den rapporteringsskyldiga. 
Tillsynsmyndigheten kan anse att en rapporteringsskyldig uppfyller de förutsättningar i denna paragraf som avser en tredje part, om 
1) den rapporteringsskyldiga får uppgifterna av en tredje part som hör till samma koncern som den rapporteringsskyldiga eller till någon annan finansiell sammanslutning, 
2) koncernen eller en annan finansiell sammanslutning iakttar sådana interna samt för koncernen eller sammanslutningen gemensamma förfaranden för kundkontroll, bevarande av kunduppgifter samt för förhindrande och avslöjande av penningtvätt och av finansiering av terrorism som motsvarar bestämmelserna i denna lag, samt 
3) tillsynsmyndigheten i hemstaten för koncernens eller en annan finansiell sammanslutnings moderbolag övervakar att 2 punkten följs. 
När det gäller penningspelsverksamhet kan tillsynsmyndigheten anse att en penningspelssammanslutning i egenskap av rapporteringsskyldig uppfyller de förutsättningar som föreskrivs i denna paragraf, om en näringsidkare eller sammanslutning enligt 1 kap. 2 § 2 mom. som handlar på dess vägnar och förmedlar deltagaranmälningar och -avgifter i anslutning till penningspel iakttar bestämmelserna om kundkontroll i 1, 2 och 10 § i detta kapitel, och om penningspelssammanslutningen på begäran utan dröjsmål av denna får uppgifter om kundkontroll och för kontroll av en kunds identitet. Penningspelssammanslutningen ska upprätthålla uppgifter om sådana näringsidkare och sammanslutningar som avses ovan och på begäran hålla uppgifterna tillgängliga för tillsynsmyndigheten. 
De rapporteringsskyldiga ska enligt 4 § 2 mom. fortlöpande följa upp kundförhållanden där en tredje part har vidtagit åtgärder för kundkontroll. 
En rapporteringsskyldig befrias inte från ansvar enligt denna lag på den grunden att åtgärder för kundkontroll har vidtagits av en tredje part på den rapporteringsskyldigas vägnar. 
8 § 
Förenklade åtgärder för kundkontroll 
De rapporteringsskyldiga kan vid tillämpningen av 2, 3, 4 och 6 § tillämpa ett förenklade åtgärder för kundkontroll, om de utifrån den i 2 kap. 3 § avsedda riskbedömningen bedömer att ett kundförhållande eller en enskild transaktion är förenad med låg risk för penningtvätt och finansiering av terrorism. De rapporteringsskyldiga ska dock följa kundförhållanden på det sätt som anges i 4 § 2 mom. i detta kapitel för att upptäcka exceptionella eller ovanliga transaktioner. 
Genom förordning av statsrådet utfärdas närmare föreskrifter om sådana kunder, produkter, tjänster, transaktioner, leveranssätt och geografiska riskfaktorer som kan vara förenade med låg risk för penningtvätt eller finansiering av terrorism samt om förfarandena i sådana situationer. 
9 § 
Undantag från kundkontroll i samband med elektroniska pengar 
Om den rapporteringskyldiga utifrån en riskbedömning gör den bedömningen att risken för penningtvätt och finansiering av terrorism i anslutning till elektroniska pengar är låg tillämpas inte bestämmelserna om identifiering av en kund i 2 §, bestämmelserna om uppgifterna om kundkontroll och bevarande av dem i 3 § samt om inhämtande av uppgifter om en kund i 4 § 1 mom. förutsatt att följande förutsättningar för riskhantering är uppfyllda: 
1) det elektroniska mediet kan inte laddas på nytt eller i mediet kan enligt lagen om betalningsinstitut lagras elektroniska pengar till ett belopp av högst 250 euro per månad och mediet kan användas endast i Finland, 
2) i det elektroniska mediet kan lagras högst 500 euro och mediet kan användas endast i Finland, 
3) det elektroniska mediet kan användas endast för köp av varor eller tjänster, 
4) det elektroniska mediet kan inte laddas med anonyma elektroniska pengar, 
5) utgivaren av det elektroniska mediet har tillgång till tillräckliga tillsynsförfaranden för att upptäcka ovanliga eller tvivelaktiga transaktioner, 
6) högst 100 euro i kontanter kan lösas in via det elektroniska mediet. 
10 § 
Skärpta åtgärder för kundkontroll 
De rapporteringsskyldiga ska tillämpa ett skärpt förfarande för kundkontroll om de utifrån den i 2 kap. 3 § avsedda riskbedömningen bedömer att den risk för penningtvätt och finansiering av terrorism som är förenad med ett kundförhållande eller en enskild transaktion är högre än vanligt. Detsamma gäller om kunden eller transaktionen har beröringspunkter med en stat vars system för förhindrande och utredning av penningtvätt och av finansiering av terrorism enligt kommissionens bedömning utgör en avsevärd risk för EU:s inre marknad eller inte uppfyller de internationella förpliktelserna. 
Genom förordning av statsrådet utfärdas närmare föreskrifter om sådana kunder, produkter, tjänster, transaktioner, leveranssätt och geografiska riskfaktorer som är förenade med extra hög risk för penningtvätt eller finansiering av terrorism samt om förfarandena i sådana situationer. 
11 § 
Skärpta åtgärder för kundkontroll vid identifiering på distans 
Om kunden inte är närvarande vid identifieringen och identitetskontrollen (identifiering på distans) ska den rapporteringsskyldiga vidta följande åtgärder för att minska risken för penningtvätt och finansiering av terrorism: 
1) kontrollera kundens identitet med hjälp av ytterligare dokument och uppgifter från en tillförlitlig källa, 
2) säkerställa att betalningen i samband med en transaktion görs från ett kreditinstituts konto eller betalas in på ett konto som tidigare öppnats i kundens namn, eller 
3) kontrollera en kunds identitet med ett identifieringsverktyg enligt lagen om stark autentisering och elektroniska signaturer (617/2009) eller med ett kvalificerat certifikat för elektroniska underskrifter enligt artikel 28 i Europaparlamentets och rådets förordning (EU) nr 910/2014 om elektronisk identifiering och betrodda tjänster för elektroniska transaktioner på den inre marknaden och om upphävande av direktiv 1999/93/EG, eller med någon annan elektronisk identifieringsteknik som är datasäker och bevislig. 
12 § 
Skärpta åtgärder för kundkontroll vid korrespondentförbindelser 
Om ett kreditinstitut eller finansiellt institut ingår avtal om skötsel av betalningar och andra uppdrag (korrespondentförbindelse) med ett kreditinstitut eller finansiellt institut i ett land utanför EES-staterna, ska institutet före avtalsslutet inhämta tillräckliga uppgifter om det kreditinstitut eller finansiella institut som är motpart. 
Kreditinstitutet eller det finansiella institutet ska göra en bedömning av motpartens anseende, kvaliteten på den tillsyn som motparten utövar och motpartens åtgärder för förhindrande av penningtvätt och av finansiering av terrorism. Kreditinstitutets eller det finansiella institutets högre ledning ska godkänna att korrespondentförbindelsen inleds. Avtalet ska uttryckligen avse genomförande av åtgärderna för kundkontroll och lämnande av relevanta uppgifter om dessa åtgärder, på begäran, till det kreditinstitut eller finansiella institut som är motpart. 
Ett kreditinstitut eller finansiellt institut får inte inleda eller fortsätta en korrespondentförbindelse med ett institut som är en brevlådebank eller vars konton används i detta syfte. 
Om värdepappersföretag, betalningsinstitut, fondbolag, AIF-förvaltare eller försäkringsbolag ingår avtal om arrangemang som motsvarar arrangemangen enligt 1 mom., ska den rapporteringsskyldiga iaktta denna paragraf. 
13 § 
Skärpta åtgärder för kundkontroll i fråga om personer i politiskt utsatt ställning 
De rapporteringsskyldiga ska ha lämpliga på riskbaserad bedömning grundade förfaranden för att konstatera om en kund är eller har varit en person i politiskt utsatt ställning eller en sådan persons familjemedlem eller medarbetare. 
Om den rapporteringsskyldiga utifrån den i 2 kap. 3 § avsedda riskbedömningen bedömer att den risk för penningtvätt och finansiering av terrorism som är förenad med ett kundförhållande eller en enskild transaktion är högre än vanligt, ska det inom ramen för det förfarande som avses i 1 mom. alltid utredas om kunden är eller har varit en person i politiskt utsatt ställning. (Nytt 2 mom.) 
Om en kund är eller har varit en person i politiskt utsatt ställning eller är en sådan persons familjemedlem eller är känd som meddelägare till en sådan person, ska 
1) den rapporteringsskyldigas högre ledning godkänna att ett kundförhållande inleds med en sådan person, 
2) den rapporteringsskyldiga vidta lämpliga åtgärder för att få reda på ursprunget till den förmögenhet och de medel som hör till kundförhållandet eller transaktionen, och 
3) den rapporteringsskyldiga ordna skärpt och fortlöpande övervakning av kundförhållandet. (2 mom. i RP) 
En person betraktas inte längre som en person i politiskt utsatt ställning när han eller hon inte har haft något betydande offentligt uppdrag under minst ett år. (3 mom. i RP) 
Med avvikelse från 1 mom. den rapporteringsskyldiga kan tillämpa förenklade åtgärder enligt 8 § om uppdragsavtalet gäller en lagstadgad arbetspensionsförsäkring, företagarpensionsförsäkring, arbetsolycksfallsförsäkring eller yrkessjukdomsförsäkring som ingår i socialskyddet. 
14 § 
Central kontaktperson 
Ett betalningsinstitut eller institut för elektroniska pengar enligt lagen om betalningsinstitut som via en representant från området för en EES-stat utan att etablera filial tillhandahåller betaltjänster eller utgivning av elektroniska pengar i Finland, ska utse en central kontaktperson. Den centrala kontaktpersonen svarar på institutets vägnar för att 
1) de krav som föreskrivs i denna lag uppfylls, 
2) handlingar och information ges in till Finansinspektionen. 
15 § 
De som tillhandahåller utlagda tjänster samt representanter som en del av en rapporteringsskyldig 
Bestämmelserna i detta kapitel om tredje part och skärpta åtgärder för kundkontroll tillämpas inte om den rapporteringsskyldiga har lagt ut en uppgift som gäller kundkontroll på entreprenad eller anlitar en representant på basis av ett avtalsförhållande, och tillhandahållaren av de utlagda tjänsterna eller representanten anses ingå i den rapporteringsskyldiga. 
4 kap. 
Rapporteringsskyldighet, tystnadsplikt och avbrytande av transaktioner 
1 § 
Skyldighet att rapportera tvivelaktiga transaktioner 
Efter att ha fullgjort utredningsskyldigheten enligt 3 kap. 4 § 3 mom. ska en rapporteringsskyldig enligt lagen om centralen för utredning av penningtvätt ( / ) utan dröjsmål till centralen för utredning av penningtvätt rapportera tvivelaktiga transaktioner eller misstankar av finansiering av terrorism. 
En rapporteringsskyldig kan rapportera tvivelaktiga transaktioner också när det är fråga om enskilda betalningar eller andra prestationer eller om flera separata sammanhängande betalningar eller prestationer, om de överskrider det högsta tröskelvärde som den rapporteringsskyldiga anger. Den som tillhandahåller en penningförmedlingstjänst enligt 1 § 2 mom. 5 punkten i lagen om betalningsinstitut ska dock göra en anmälan för varje enskild betalning eller flera sammanhängande betalningar eller prestationer till ett värde av minst 1 000 euro. 
Näringsidkare och sammanslutningar enligt 1 kap. 2 § 2 mom. kan genom förmedling av en penningspelssammanslutning rapportera tvivelaktiga transaktioner. 
De rapporteringsskyldiga ska avgiftsfritt ge centralen för utredning av penningtvätt alla uppgifter och handlingar som är nödvändiga för att utreda misstankarna. De rapporteringsskyldiga ska inom en rimlig tid som denne anger svara på en uppgiftsbegäran från centralen för utredning av penningtvätt. 
2 § 
Rapportens form och innehåll 
Tvivelaktiga transaktioner ska rapporteras elektroniskt med en särskild tillämpning som centralen för utredning av penningtvätt har reserverat för ändamålet. Av särskilda skäl kan rapporteringen också ske via en krypterad anslutning eller på något annat datasäkert sätt.  
Rapporter om tvivelaktiga transaktioner ska innehålla de uppgifter om kundkontroll som avses i 3 kap. 3 § samt uppgifter om transaktionens art, beloppet av och valutan för de medel eller övrig egendom som ingår i transaktionen, medlens eller den övriga egendomens ursprung, hur medlen och egendomen avses bli omsatta och de omständigheter som gjorde transaktionen tvivelaktig, samt uppgift om huruvida transaktionen har utförts, avbrutits eller avböjts. 
Genom förordning av statsrådet utfärdas närmare föreskrifter om formen för och innehållet i rapporter om tvivelaktiga transaktioner. 
3 § 
Bevarande av uppgifter om tvivelaktiga transaktioner 
De rapporteringsskyldiga ska i fem år bevara de nödvändiga uppgifter som inhämtats för fullgörande av anmälningsskyldigheten enligt 1 §, och handlingarna i anslutning till dessa uppgifter. Uppgifterna och handlingarna ska hållas åtskilda från kundregistret, och de får inte användas för andra ändamål än de som anges i denna lag. Uppgifterna och handlingarna ska avföras fem år från det att kundförhållandet har upphört eller den tvivelaktiga transaktionen har slutförts, om de inte fortfarande behöver bevaras för brottsutredning eller en anhängig rättegång eller för att trygga den rapporteringsskyldigas eller dess anställdas rättigheter. Behovet av fortsatt bevarande uppgifterna och handlingarna ska granskas senast tre år efter att behovet av att bevara dem senast granskades. En anteckning ska göras om granskningen och om tidpunkten för den. 
De registrerade har inte rätt till insyn i de uppgifter som avses i 1 mom. eller de uppgifter och handlingar som inhämtats för fullgörande av utredningsskyldigheten enligt 3 kap. 4 § 3 mom. Dataombudsmannen kan på begäran av en registrerad kontrollera att behandlingen av uppgifterna är lagenlig. 
4 § 
Tystnadsplikt och undantag från tystnadsplikten i fråga om tvivelaktiga transaktioner 
De rapporteringsskyldiga får inte för den som misstanken gäller eller för någon annan röja en anmälan enligt 1 § . Tystnadsplikten gäller också den rapporteringsskyldigas anställda och dem som med stöd av denna paragraf har fått uppgifter som omfattas av tystnadsplikten. 
En rapporteringsskyldig får trots tystnadsplikten enligt 1 mom. informera en sammanslutning enligt lagen om tillsyn över finans- och försäkringskonglomerat (699/2004) som ingår i samma finans- och försäkringskonglomerat och som har beviljats koncession i Finland eller i en annan EES-stat om att en anmälan enligt 1 § har gjorts och om innehållet i anmälan. Informationen får också delges en sammanslutning som ingår i samma finans- och försäkringskonglomerat och har beviljats koncession i någon annan stat än en EES-stat, om sammanslutningen har skyldigheter som motsvarar skyldigheterna enligt denna lag och fullgörandet av skyldigheterna övervakas. 
Trots tystnadsplikten enligt 1 mom. får en rapporteringsskyldig informera om rapporteringen sådana rapporteringsskyldiga som avses i 1 kap. 2 § 1 mom. 1 och 2 punkten och har fått koncession i Finland eller i en annan EES-stat och som medverkar i en enskild transaktion som hänför sig till den kund och den transaktion som en rapport enligt 1 § avser. Under samma förutsättningar får informationen delges också en rapporteringsskyldig enligt 1 kap. 2 § 1 mom. 1 eller 2 punkten som har beviljats koncession i någon annan stat än en EES-stat, om mottagaren av informationen har skyldigheter som motsvarar skyldigheterna enligt denna lag och fullgörandet av skyldigheterna övervakas och mottagaren dessutom har sådana skyldigheter i fråga om skydd för personuppgifter som motsvarar personuppgiftslagen (523/1999). 
I samband med utlämnande av information enligt 3 mom. får kundens namn, födelsetid och personbeteckning samt grunden för rapporten lämnas ut. Om personen saknar finsk personbeteckning, får också uppgifter om personens medborgarskap lämnas ut. 
5 § 
Avbrytande av transaktioner och vägran att utföra sådana 
En rapporteringsskyldig ska avbryta en transaktion för ytterligare utredningar eller vägra utföra en transaktion, om 
1) transaktionen är tvivelaktig, eller om 
2) den rapporteringsskyldiga misstänker att medel som ingår i transaktionen används för finansiering av terrorism eller för straffbart försök till detta.  
Om transaktionen inte kan avbrytas eller om det sannolikt blir svårare att ta reda på transaktionens verkliga förmånstagare om den avbryts eller förvägras, får den rapporteringsskyldiga slutföra transaktionen.  
Bestämmelser om den rätt som centralen för utredning av penningtvätt har att bestämma om avbrytande av en transaktion för viss tid finns i 6 § i lagen om centralen för utredning av penningtvätt. 
5 kap. 
Registret för övervakning av penningtvätt  
1 § 
Tillämpningsområde 
Detta kapitel tillämpas på sådana rapporteringsskyldiga enligt 1 kap. 2 § 1 mom. 13—18 och 20—24 punkten som inte är auktoriserade tillsynsobjekt eller skyldiga att låta registrera sig i ett annat register som förs av tillsynsmyndigheten än det register som avses i detta kapitel. 
2 § 
Registeransvarig och användningsändamål för registret för övervakning av penningtvätt 
Regionförvaltningsverket för ett register över rapporteringsskyldiga enligt 1 §, för förhindrande av penningtvätt och av finansiering av terrorism (registret för övervakning av penningtvätt). 
Användningsändamål för registret för övervakning av penningtvätt är att övervaka åtgärder för förhindrande av penningtvätt och av finansiering av terrorism. 
3 § 
Ansökan om införande i registret och förutsättningar för registrering 
En rapporteringsskyldig enligt 1 § ska inom 14 dagar från det att den rapporteringsskyldiga omfattas av tillämpningsområdet för denna lag göra en ansökan om att införas i registret för övervakning av penningtvätt. 
Regionförvaltningsverket ska registrera en sökande om sökanden 
1) har rätt att bedriva näring i Finland, 
2) inte har meddelats näringsförbud, 
3) lämnar uppgifter enligt 4 §, 
4) är rapporteringsskyldig enligt 1 kap. 2 § 21 punkten och bedriver valutaväxlingsverksamhet samt är tillförlitlig på det sätt som avses i 5 §. 
Sökanden ska i sin ansökan uppge den näringsverksamhet som bedrivs och som ligger till grund för sökandens rapporteringsskyldighet. 
Genom förordning av statsrådet utfärdas närmare föreskrifter om innehållet i en registreringsansökan. 
4 § 
Uppgifter som ska föras in i registret för övervakning av penningtvätt samt anmälan om ändringar 
Följande uppgifter ska föras in i registret för övervakning av penningtvätt: 
1) en enskild näringsidkares fullständiga namn och personbeteckning eller, om sådan saknas, födelsetid och medborgarskap samt firma, eventuella bifirma, företags- och organisationsnummer eller annan motsvarande beteckning, datum för registreringen och besöksadress för varje driftställe där verksamhet bedrivs, 
2) en juridisk persons firma, eventuella bifirma, företags- och organisationsnummer eller annan motsvarande beteckning, datum för registreringen och besöksadress för varje driftställe där verksamhet bedrivs, 
3) näringsverksamhet enligt 3 § 3 mom. i detta kapitel, 
4) fullständigt namn, personbeteckning eller, om sådan saknas, födelsetid och medborgarskap och ställning hos den registrerade för den person vars tillförlitlighet har kontrollerats med stöd av 5 §, 
5) administrativa påföljder enligt 8 kap. som har påförts enskilda näringsidkare och juridiska personer samt uppmaningar och förbud som har förenats med vite enligt 7 kap. 7 §; sådana uppgifter ska avföras ur registret tre år från utgången av det år då påföljden påfördes, och 
6) skälet till och tidpunkten för avförande av en uppgift. 
En rapporteringsskyldig ska utan dröjsmål underrätta regionförvaltningsverket om ändringar i de uppgifter som avses i 1 mom. 
5 § 
Tillförlitlighet 
En rapporteringsskyldig som bedriver valutaväxlingsverksamhet eller verksamhet enligt 1 kap. 2 § 1 mom. 21 punkten anses inte vara tillförlitlig, om 
1) han eller hon genom en lagakraftvunnen dom under fem år före bedömningen har dömts till fängelsestraff eller under tre år före bedömningen har dömts till bötesstraff för ett brott som kan anses visa att han eller hon är uppenbart olämplig att bedriva näringsverksamhet som ska registreras i registret för övervakning av penningtvätt, eller 
2) han eller hon annars genom sin tidigare verksamhet har visat sig vara uppenbart olämplig för verksamhet som avses i 1 punkten.  
Utöver det som föreskrivs i 1 mom. anses en rapporteringsskyldig enligt nämnda moment inte vara tillförlitlig, om 
1) han eller hon under tre år före bedömningen upprepade gånger eller i betydande grad har försummat skötseln av sina registrerings-, rapporterings- och betalningsåtaganden i anslutning till skatter, lagstadgade pensions-, olycksfalls- och arbetslöshetsförsäkringsavgifter samt avgifter som Tullen tar ut, eller  
2) han eller hon enligt utmätning eller någon annan utredning är oförmögen att svara för sina skulder. 
Om den som gör anmälan är en juridisk person, gäller kravet på tillförlitlighet verkställande direktören och dennas ställföreträdare, ledamöter och ersättare i styrelsen, förvaltningsrådet och jämförbara organ, ansvariga bolagsmän och andra som hör till den högsta ledningen och även personer som direkt eller indirekt har mer än 25 procent av aktierna i ett aktiebolag eller av den rösträtt som aktierna medför eller motsvarande ägande- eller bestämmanderätt i en annan sammanslutning. 
Regionförvaltningsverket har oberoende av sekretessbestämmelserna rätt att ur det bötesregister som avses i 46 § i lagen om verkställighet av böter (672/2002) få uppgifter som är nödvändiga för utredning av den tillförlitlighet som avses i denna paragraf eller för avregistrering enligt 6 §. 
Regionförvaltningsverket har, trots sekretessbestämmelserna, rätt att avgiftsfritt av myndigheter och aktörer som sköter offentliga uppdrag få uppgifter om hur den som ansöker om registrering sköter sina registrerings-, rapporterings- och betalningsåtaganden i anslutning till skatter, lagstadgade pensions-, olycksfalls- och arbetslöshetsförsäkringsavgifter samt avgifter som Tullen tar ut samt sådana uppgifter om sökandens verksamhet, ekonomi och kopplingar som behövs för utredning av den tillförlitlighet som avses i denna paragraf eller för avregistrering enligt 6 §. 
Regionförvaltningsverket har rätt att få behövliga uppgifter som motsvarar de uppgifter som avses i 5 mom. också om en sådan organisation och en sådan organisationsanknuten person som avses i 2 § i lagen om Enheten för utredning av grå ekonomi (1207/2010) och om en sådan person som avses i 3 mom
Uppgifter som avses ovan i denna paragraf får sökas med hjälp av en teknisk anslutning eller på något annat sätt i elektronisk form utan samtycke av den vars intresse skyddas genom sekretessbestämmelsen. 
6 § 
Avförande av uppgifter ur registret för övervakning av penningtvätt 
Regionförvaltningsverket ska avregistrera en rapporteringsskyldig i registret för övervakning av penningtvätt, om 
1) den rapporteringsskyldiga inte längre uppfyller registreringsvillkoren, 
2) det i den rapporteringsskyldigas verksamhet har förekommit väsentliga överträdelser av denna lag eller av föreskrifter som regionförvaltningsverket meddelat med stöd av denna lag, eller om 
3) den rapporteringsskyldiga har upphört med sin verksamhet. 
Regionförvaltningsverket ska före ett beslut som grundar sig på 1 mom. 2 punkten reservera en rimlig tid för den rapporteringsskyldiga att avhjälpa bristen. 
Uppgifterna om registeranteckningar ska bevaras i fem år från utgången av det år då uppgiften har avförts ur registret. 
7 § 
Utlämnande av uppgifter ur registret för övervakning av penningtvätt  
Var och en har rätt att genom att ange företags- och organisationsnummer, firma eller bifirma för ett företag få uppgifter om företaget ur registret för övervakning av penningtvätt. Uppgifter om de rapporteringsskyldiga som antecknats i registret kan också sökas samlat på grundval av näringsverksamhet. 
Trots bestämmelserna i 16 § 3 mom. i lagen om offentlighet i myndigheternas verksamhet (621/1999) får regionförvaltningsverket lämna ut uppgifter om fysiska personers namn eller födelsetid i form av utskrifter, genom teknisk anslutning eller på något annat sätt i elektronisk form eller göra dem allmänt tillgängliga i ett elektroniskt datanät eller i övrigt lämna ut dem i elektronisk form. Via ett elektroniskt datanät kan personuppgifter endast sökas som enskilda sökningar. 
Regionförvaltningsverket får lämna ut uppgifter om personbeteckningens slutled ur sitt register för övervakning av penningtvätt endast om utlämnandet uppfyller kraven i 16 § 3 mom. i lagen om offentlighet i myndigheternas verksamhet. För att uppgifter om personbeteckningens slutled ska lämnas ut ur registret krävs det att den som ber om uppgifterna ger regionförvaltningsverket en utredning om att de skyddas på ett ändamålsenligt sätt. 
8 § 
Uppdatering av uppgifter via befolkningsdatasystemet, handelsregistret och företags- och organisationsdatasystemet 
Regionförvaltningsverket har rätt att uppdatera sina register med uppgifter ur befolkningsdatasystemet och att granska personuppgifterna för de personer som har anmälts för registrering, i syfte att konstatera uppgifternas riktighet. 
Regionförvaltningsverket har rätt att uppdatera registret för övervakning av penningtvätt med uppgifter ur handelsregistret samt företags- och organisationsdatasystemet. 
6 kap. 
Uppgifter om förmånstagare 
1 § 
Tillämpningsområde 
I detta kapitel föreskrivs om skyldigheten att upprätthålla information om verkliga förmånstagare i sådana sammanslutningar som avses i 3 § 1 mom. 1 och 4—6 punkten i handelsregisterlagen (129/1979), sådana föreningar som är införda i föreningsregistret, sådana religionssamfund som är införda i registret över religionssamfund och sådana stiftelser som är införda i stiftelseregistret. 
Vad som föreskrivs i detta kapitel tillämpas dock inte på bolag som är föremål för handel på en reglerad marknad enligt lagen om handel med finansiella instrument. 
2 § 
Sammanslutningars skyldighet att upprätthålla information om verkliga förmånstagare 
Sådana sammanslutningar som avses i 3 § 1 mom. 1—2 eller 4—6 punkten i handelsregisterlagen, sådana föreningar som är införda i föreningsregistret, sådana religionssamfund som är införda i registret över religionssamfund samt sådana stiftelser som är införda i stiftelseregistret ska på ett lämpligt sätt inhämta och upprätthålla exakt och uppdaterad information om sina verkliga förmånstagare enligt 1 kap. 5 § 2—4 mom. eller 7 § samt tillhandahålla den rapporteringsskyldiga som avses i 1 kap. 1 § uppgifter om sina verkliga huvudmän, när den rapporteringsskyldiga vidtar åtgärder för kundkännedom. 
Utöver vad som föreskrivs i 1 mom. ska sammanslutningar som avses i 3 § 1 mom. 1 och 4—6 punkten i handelsregisterlagen, med undantag för bostadsaktiebolag och ömsesidiga fastighetsaktiebolag enligt lagen om bostadsaktiebolag, på basis av tillgängliga uppgifter upprätthålla exakt och uppdaterad information om andra personer som utövar sådant bestämmande inflytande som avses i 1 kap. 5 § 1 mom. samt om grunden för och omfattningen av deras bestämmande inflytande eller ägarandelar. 
En person som är styrelseledamot eller ansvarig bolagsman i en sammanslutning som avses i 1 mom. ska se till att det upprättas en förteckning över sammanslutningens verkliga förmånstagare. I förteckningen antecknas ägarens eller förmånstagarens namn, födelsetid, medborgarskap och bosättningsland samt grunden för och omfattningen av det bestämmande inflytandet eller ägarandelen. Förteckningen ska upprättas utan dröjsmål efter det att den juridiska personen har bildats, och den ska föras på ett tillförlitligt sätt. 
3 § 
Skyldighet för förvaltare av utländska truster att ha kännedom om verkliga förmånstagare 
Förvaltaren av en utländsk klassisk trust eller liknande juridisk konstruktion enligt artikel 3.7 d i penningtvättsdirektivet ska i enlighet med 1 kap. 6 § inhämta och uppdatera information om trustens verkliga förmånstagare. 
4 § 
Registrering av sammanslutningars verkliga förmånstagare 
Bestämmelser om hur verkliga förmånstagare i företag som avses i 3 § 1 mom. 1 och 4-6 punkten i handelsregisterlagen samt verkliga förmånstagare i utländska truster ska registreras i handelsregistret finns i handelsregisterlagen. 
Bestämmelser om registrering av föreningars styrelsemedlemmar finns i föreningslagen. 
Bestämmelser om registrering av religionssamfunds styrelsemedlemmar finns i religionsfrihetslagen. 
Bestämmelser om registrering av stiftelsers styrelseledamöter och förvaltningsrådsledamöter finns i stiftelselagen. 
Uppgifter som avses i 1-4 mom. och som avser förmånstagare ska senast den 30 juni 2019 tillställas handelsregistret enligt handelsregisterlagen, föreningsregistret enligt föreningslagen, registret över religionssamfund enligt religionsfrihetslagen och stiftelseregistret enligt stiftelselagen. 
7 kap. 
Tillsyn 
1 § 
Tillsynsmyndigheterna och anmälan till centralen för utredning av penningtvätt 
Tillsyn över efterlevnaden av denna lag samt bestämmelser och föreskrifter som utfärdats med stöd av den utövas av följande myndigheter: 
1) Finansinspektionen när det är fråga om rapporteringsskyldiga enligt 1 kap. 2 § 1 mom. 1—8 punkten, 
2) Polisstyrelsen när det är fråga om penningspelssammanslutningar enligt 1 kap. 2 § 1 mom. 9 punkten samt i 1 kap. 2 § 2 mom. avsedda näringsidkare och sammanslutningar som förmedlar deltagaravgifter och deltagaranmälningar för penningspel som tillhandahålls av sådana penningspelssammanslutningar som avses i 1 kap. 2 § 1 mom. 9 punkten, 
3) Patent- och registerstyrelsen när det är fråga om rapporteringsskyldiga enligt 1 kap. 2 § 1 mom. 11 punkten, 
4) regionförvaltningsverket när det är fråga om rapporteringsskyldiga enligt 1 kap. 2 § 1 mom. 13—18 och 20—24 punkten, till den del de inte med stöd av 1 punkten står under Finansinspektionens tillsyn. 
Advokatföreningen utövar tillsyn över rapporteringsskyldiga enligt 1 kap. 2 § 1 mom. 12 punkten. 
Finansinspektionen utövar dessutom tillsyn över att de rapporteringsskyldiga som står under dess tillsyn följer förordningen om information om betalaren när de tar emot eller gör överföringar av medel enligt den förordningen. (Nytt 3 mom.) 
Tillsynsmyndigheterna, Energimyndigheten, advokatföreningen, en börs enligt lagen om handel med finansiella instrument samt centralinstitutet för den sammanslutning som avses i lagen om en sammanslutning av inlåningsbanker (599/2010) ska underrätta centralen för utredning av penningtvätt ifall de på basis av omständigheter som kommer fram i samband med tillsynen eller annars vid skötseln av sina uppgifter observerar en tvivelaktig transaktion eller misstänker finansiering av terrorism eller straffbart försök till detta. (3 mom. i RP) 
2 § 
Rätt att få uppgifter av rapporteringsskyldiga 
Utöver vad som föreskrivs någon annanstans i lag ska de rapporteringsskyldiga trots sekretessbestämmelserna utan ogrundat dröjsmål avgiftsfritt på begäran ge tillsynsmyndigheten och advokatföreningen sådana uppgifter och utredningar som är nödvändiga för skötseln av uppgifter som avses i denna lag eller i bestämmelser eller föreskrifter som utfärdats med stöd av den. 
En näringsidkare och sammanslutning enligt 1 kap. 2 § 2 mom. ska på begäran av Polisstyrelsen avgiftsfritt ge denna sådana uppgifter som är nödvändiga för tillsynen. 
3 § 
Inspektionsrätt 
Tillsynsmyndigheten och advokatföreningen har trots sekretessbestämmelserna rätt att på rapporteringsskyldigas andra driftställen än utrymmen som används för boende av permanent natur granska handlingar, upptagningar och datasystem som gäller dessas verksamhet och förvaltning, i den utsträckning som behövs för fullgörandet av tillsynsuppdraget enligt denna lag eller bestämmelser eller föreskrifter som utfärdats med stöd av den. Tillsynsmyndigheten och advokatföreningen har rätt att av rapporteringsskyldiga avgiftsfritt få behövliga kopior av handlingar och upptagningar som avses i denna paragraf. 
Polisstyrelsen har rätt att utföra en inspektion som är nödvändig för tillsynen också i utrymmen som innehas av näringsidkare och sammanslutningar som avses i 1 kap. 2 § 2 mom. 
Andra tillsynsmyndigheter än Patent- och registerstyrelsen har rätt att för tillsynen över efterlevnaden av denna lag och bestämmelser som utfärdats med stöd av den också utföra inspektioner i utrymmen som används för den rapporteringsskyldigas boende av permanent natur, med undantag av rapporteringsskyldiga som avses i 1 kap. 2 § 2 mom., om det finns grundad anledning att misstänka att den rapporteringsskyldiga uppsåtligen eller av oaktsamhet allvarligt, upprepade gånger eller systematiskt har försummat att iaktta eller brutit mot denna lag på ett sätt som avses i 8 kap. 3 § 1 eller 2 mom. och inspektionen är nödvändig för att utreda omständigheter som är föremål för inspektion.  
Vid inspektionen ska 39 § i förvaltningslagen (434/2003) iakttas. 
Bestämmelser om polisens skyldighet att ge handräckning finns i 9 kap. 1 § i polislagen (872/2011). 
4 § 
Begränsning av rapporteringsskyldigas koncessionsenliga verksamhet och återkallande av koncessionen 
Särskilda bestämmelser utfärdas om begränsning av rapporteringsskyldigas koncessionsenliga verksamhet och återkallande av koncessionen.  
5 § 
Begränsning av ledningens verksamhet för viss tid 
Tillsynsmyndigheten kan för viss tid, högst fem år, förbjuda en person att vara ledamot eller ersättare i styrelsen eller verkställande direktör eller dennas ställföreträdare hos en rapporteringsskyldig eller att i övrigt höra till den högsta ledningen, om 
1) han eller hon vid skötseln av sina uppgifter har visat uppenbar oskicklighet eller oförsiktighet och om det är uppenbart att detta allvarligt kan äventyra de syften som anges i denna lag, eller 
2) han eller hon inte uppfyller de krav på yrkesskicklighet och tillförlitlighet som anges i denna lag. 
En förutsättning för att utfärda ett förbud är dessutom att den som avses i 1 mom. tidigare har fått en rättelseuppmaning, anmärkning eller varning som inte har lett till att allvarliga och väsentliga brister i verksamheten har rättats till. 
Bestämmelser om Finansinspektionens rätt att besluta att verksamheten inom ledningen för de sammanslutningar som står under dess tillsyn ska begränsas finns i 28 § i lagen om Finansinspektionen. 
6 § 
Verkställighetsförbud och rättelseuppmaning 
Tillsynsmyndigheten kan förbjuda verkställighet av rapporteringsskyldigas beslut och av åtgärder som de har planerat eller ålägga dem att upphöra med ett förfarande, om beslutet, åtgärden eller förfarandet strider mot de bestämmelser i denna lag som förpliktar den rapporteringsskyldiga eller mot bestämmelser eller föreskrifter som har utfärdats med stöd av denna lag, mot koncessionsvillkor eller mot stadgar som gäller rapporteringsskyldigas verksamhet. Den behöriga tillsynsmyndigheten ska ge en rapporteringsskyldig tillfälle att inom skälig tid rätta sitt förfarande. 
Om en rapporteringsskyldig har verkställt ett beslut enligt 1 mom. eller genomfört andra sådana åtgärder som avses i 1 mom., kan tillsynsmyndigheten ålägga den rapporteringsskyldiga att inom skälig tid vidta åtgärder för att återkalla verkställigheten eller åtgärden eller att inom skälig tid för att göra en rättelse. 
7 § 
Vite 
Om en rapporteringsskyldig försummar att i sin verksamhet följa denna lag, bestämmelser och föreskrifter som har utfärdats med stöd av den, ett verkställighetsförbud eller en rättelseuppmaning enligt 6 §, villkoren i sin koncession eller stadgarna om sin verksamhet, kan tillsynsmyndigheten vid vite ålägga den rapporteringsskyldiga att fullgöra sin skyldighet, om försummelsen inte är obetydlig. 
Vite kan också föreläggas näringsidkare och sammanslutningar enligt 1 kap. 2 § 2 mom., om 3 och 4 kap. tillämpas på dem. 
En fysisk persons informationsskyldighet enligt denna lag får inte förenas med vite när det finns anledning att misstänka denna för brott och informationen har samband med det ärende som brottsmisstanken avser. 
Till övriga delar finns bestämmelser om föreläggande och utdömande av vite i viteslagen (1113/1990). På vite som förelagts av Finansinspektionen ska dock lagen om Finansinspektionen tillämpas. 
8 § 
Förfarandet vid rapportering om misstankar om överträdelser hos en rapporteringsskyldig 
De rapporteringsskyldiga ska ha rutiner för att deras anställda eller ombud internt genom en oberoende kanal ska kunna rapportera misstankar om överträdelser av denna lag samt bestämmelser och föreskrifter som utfärdats med stöd av den. En rapporteringsskyldig behöver dock inte ha ovan avsedda rutiner, om tillsynsmyndigheten eller advokatföreningen utifrån den rapporteringsskyldigas riskbedömning enligt 2 kap. 3 § beslutar att tillsynsmyndighetens och advokatföreningens rapporteringskanal är tillräcklig med tanke på den rapporteringsskyldigas storlek och verksamhet samt riskerna för penningtvätt och finansiering av terrorism. Personuppgifter om den rapporterande och den rapporterade personen ska sekretessbeläggas, om inte något annat föreskrivs i lag. 
De rapporteringsskyldiga ska bevara information om rapporter som avses i 1 mom. Informationen ska avföras fem år efter rapporteringen, om den inte fortfarande behövs för en brottsutredning, en pågående rättegång eller en myndighetsundersökning eller för att trygga den rapporterande och den rapporterade personens rättigheter. Behovet av fortsatt bevarande ska granskas senast tre år efter den senaste granskningen. En anteckning ska göras om granskningen. 
En registrerad person som en rapport avser har inte rätt till insyn i information som avses i 1 och 2 mom., om utlämnande av informationen skulle försvåra utredningen av brott eller missbruk. Dataombudsmannen kan på begäran av en registrerad person granska att de uppgifter om den registrerade som avses i 1 och 2 mom. är lagenliga. 
De rapporteringsskyldiga ska vidta lämpliga och tillräckliga åtgärder för att skydda rapporterande personer. 
9 § 
System för mottagande av anmälan om misstanke om överträdelser 
Tillsynsmyndigheten och advokatföreningen ska ha ett system för att ta emot rapporter om misstankar om överträdelser av bestämmelserna i denna lag. 
Tillsynsmyndigheten och advokatföreningen ska i fem år bevara nödvändig information som gäller anmälningar enligt 1 mom. Informationen ska avföras fem år efter rapporteringen, om den inte fortfarande behövs för en brottsutredning, en pågående rättegång eller en myndighetsundersökning eller för att trygga rapporterande och rapporterade personess rättigheter. Behovet av fortsatt bevarande ska granskas senast tre år efter den föregående granskningen. En anteckning ska göras om granskningen. 
En registrerad person som en rapport avser har inte rätt till insyn i information som avses i 1 och 2 mom., om utlämnande av informationen skulle försvåra utredningen av brott eller missbruk. Dataombudsmannen kan på begäran av en registrerad granska att de uppgifter om den registrerade som avses i 1 och 2 mom. är lagenliga. 
Bestämmelser om Finansinspektionens skyldighet att upprätthålla ett system genom vilket den ka ta emot rapporter om misstänkta missbruk som har samband med bestämmelserna om finansmarknaden finns i 71 a § i lagen om Finansinspektionen. 
8 kap. 
Administrativa påföljder 
1 § 
Ordningsavgift 
Tillsynsmyndigheten ska påföra rapporteringsskyldiga tillsynsobjekt enligt 7 kap. 1 § 1 mom. en ordningsavgift, med undantag för näringsidkare och sammanslutningar som avses i 1 kap. 2 § 2 mom., om tillsynsobjekten uppsåtligen eller av oaktsamhet 
1) försummar eller bryter mot skyldigheten att enligt 3 kap. 1 § att utföra kundkontroll eller specificera och bedöma riskerna för penningtvätt och finansiering av terrorism, 
2) försummar eller bryter mot skyldigheten enligt 3 kap. 2 § att identifiera kunder och konstatera deras identitet, 
3) försummar eller bryter mot skyldigheten enligt 3 kap. 3 § att bevara uppgifterna om kundkontroll, 
4) försummar eller bryter mot skyldigheten enligt 3 kap. 4 § att inhämta uppgifter om kunder, fortlöpande följa kundförhållanden och utreda kundtransaktioner som avviker från det vanliga,  
5) försummar eller bryter mot skyldigheten enligt 3 kap. 6 § att identifiera verkliga förmånstagare,  
6) försummar eller bryter mot skyldigheten att enligt 3 kap. 10 § vidta skärpta åtgärder för kundkontroll, 
7) försummer eller bryter mot skyldigheten enligt 3 kap. 11 § att identifiera kunden när denna inte är närvarande vid identifieringen och vid konstaterande av identiteten, 
8) försummar eller bryter mot skyldigheten att enligt 3 kap. 12 § att inhämta tillräckliga uppgifter om det kreditinstitut eller finansiella institut som är motpart,  
9) försummar eller bryter mot skyldigheten att enligt 3 kap. 13 § att skapa och iaktta på riskbaserad bedömning grundade förfaranden för att bedöma huruvida en kund är en person i politiskt utsatt ställning eller en sådan persons familjemedlem eller medarbetare, 
10) försummar eller bryter mot skyldigheten enligt 4 kap. 1 § att rapportera tvivelaktiga transaktioner till centralen för utredning av penningtvätt, 
11) försummar eller bryter mot skyldigheten enligt 5 kap. 3 § att ansöka om registrering i registret för övervakning av penningtvätt, 
12) försummar eller bryter mot skyldigheten enligt 7 kap. 8 § att utarbeta rutiner för rapportering om misstanke om överträdelser, 
13) försummar eller bryter mot skyldigheten enligt 9 kap. 1 § att ordna utbildning och skydd för de anställda eller att utarbeta anvisningar, 
Finansinspektionen ska påföra ordningsavgift också för den 
1) som uppsåtligen eller av oaktsamhet, i strid med artiklarna 4—6 i förordningen om information om betalaren, utelämnar uppgifter som krävs om betalare eller betalningsmottagare, 
2) upprepade gånger, systematiskt eller allvarligt i strid med artikel 16 i den förordning som nämns i 1 punkten försummar sin skyldighet att se till att uppgifter bevaras, 
3) i strid med artikel 8 eller 12 i den förordning som nämns i 1 punkten underlåter att genomföra effektiva riskbaserade förfaranden, eller 
4) allvarligt försummar sin skyldighet enligt artikel 11 i den förordning som nämns i 1 punkten att skapa förfaranden som gör det möjligt att upptäcka de uppgifter om betalare eller betalningsmottagare som saknas, eller skyldigheten enligt artikel 12 att fastställa riskbaserade förfaranden för att verkställa, avvisa eller avbryta transaktioner i sådana fall då uppgifterna om dem är bristfälliga. 
Ordningsavgiftens belopp ska basera sig på en samlad bedömning. Vid bedömningen av beloppet ska hänsyn tas till förfarandets art, omfattning och varaktighet. För juridiska personer är ordningsavgiften minst 5 000 och högst 100 000 euro. För fysiska personer är ordningsavgiften minst 500 och högst 10 000 euro. 
Ordningsavgiften ska betalas till staten. 
Ordningsavgift kan påföras under förutsättning att ärendet som helhet betraktat inte ger anledning till strängare åtgärder. 
Advokatföreningen gör en framställning till regionförvaltningsverket om att en advokat som avses i 1 kap. 2 § 1 mom. 12 punkten eller advokatens biträde ska påföras ordningsavgift. 
Den ordningsavgift som avses i denna paragraf påförs av revisionsnämnden vid Patent- och registerstyrelsen. (Nytt 7 mom.) 
2 § 
Offentlig varning 
Tillsynsmyndigheten ska meddela rapporteringsskyldiga som enligt 7 kap. 1 § 1 mom. står under dess tillsyn en offentlig varning om de uppsåtligen eller av oaktsamhet handlar i strid med andra bestämmelser i denna lag eller i strid med andra bestämmelser och föreskrifter som utfärdats med stöd av den eller i strid med andra bestämmelser i förordningen om information om betalaren än de som avses i 1 § 1 eller 2 mom. och 3 § 1 och 2 mom. i detta kapitel. 
Offentlig varning kan meddelas under förutsättning att ärendet som helhet betraktat inte ger anledning till strängare åtgärder. 
Advokatföreningen gör en framställning till regionförvaltningsverket om att meddela en advokat som avses i 1 kap. 2 § 1 mom. 12 punkten eller advokatens biträde en offentlig varning. 
Den offentliga varning som avses i denna paragraf meddelas av revisionsnämnden vid Patent- och registerstyrelsen. (Nytt 4 mom.) 
3 § 
Påföljdsavgift 
Tillsynsmyndigheten ska påföra rapporteringsskyldiga tillsynsobjekt enligt 7 kap. 1 § 1 mom. en påföljdsavgift, med undantag för näringsidkare och sammanslutningar som avses i 1 kap. 2 § 2 mom., om de uppsåtligen eller av oaktsamhet allvarligt, upprepade gånger eller systematiskt 
1) försummar eller bryter mot skyldigheten enligt 3 kap. 1 § att utföra kundkontroll eller att specificera och bedöma riskerna för penningtvätt och finansiering av terrorism, 
2) försummar eller bryter mot skyldigheten enligt 3 kap. 2 § att identifiera kunder och konstatera deras identitet, 
3) försummar eller bryter mot skyldigheten enligt 3 kap. 3 § att bevara uppgifterna om kundkontroll, 
4) försummar eller bryter mot skyldigheten enligt 3 kap. 4 § att inhämta uppgifter om kunder, fortlöpande följa kundförhållanden och utreda kundtransaktioner som avviker från det vanliga,  
5) försummar eller bryter mot skyldigheten enligt 3 kap. 6 § att identifiera verkliga förmånstagare,  
6) försummar eller bryter mot skyldigheten enligt 3 kap. 10 § att vidta skärpta åtgärder för kundkontroll, 
7) försummer eller bryter mot skyldigheten enligt 3 kap. 11 § att identifiera kunden när denna inte är närvarande vid identifieringen och vid konstaterande av identiteten, 
8) försummar eller bryter mot skyldigheten enligt 3 kap. 12 § att inhämta tillräckliga uppgifter om det kreditinstitut eller finansiella institut som är motpart,  
9) försummar eller bryter mot skyldigheten enligt 3 kap. 13 § att skapa och iaktta på riskbaserad bedömning grundade förfaranden för att bedöma huruvida en kund är en person i politiskt utsatt ställning eller en sådan persons familjemedlem eller medarbetare, 
10) försummar eller bryter mot skyldigheten enligt 4 kap. 1 § att rapportera tvivelaktiga transaktioner till centralen för utredning av penningtvätt, 
11) försummar eller bryter mot skyldigheten enligt 7 kap. 8 § 1 mom. att utarbeta rutiner för rapportering av misstanke om överträdelser, 
12) försummar eller bryter mot skyldigheten att enligt 9 kap. 1 § ordna utbildning och skydd för de anställda eller att utarbeta anvisningar, 
Finansinspektionen ska påföra en påföljdsavgift också för den som uppsåtligen eller av oaktsamhet: 
1) allvarligt, upprepade gånger eller systematiskt, i strid med artikel 4, 5 eller 6 i förordningen om information om betalaren, utelämnar uppgifter som krävs om betalare eller betalningsmottagare;  
2) upprepade gånger, systematiskt eller allvarligt i strid med artikel 16 i den förordningen försummar sin skyldighet att se till att uppgifterna bevaras; 
3) i strid med artikel 8 eller 12 i förordningen underlåter att genomföra effektiva riskbaserade förfaranden eller allvarligt, upprepade gånger; eller 
4) systematiskt i strid med artikel 11 i förordningen underlåter att skapa förfaranden som gör det möjligt att upptäcka de uppgifter om betalare eller betalningsmottagare som saknas eller i strid med artikel 12 i förordningen underlåter att fastställa riskbaserade förfaranden för att verkställa, avvisa eller avbryta medelöverföringar då uppgifterna är bristfälliga. 
Tillsynsmyndigheten kan inte påföra en fysisk person påföljdsavgift för en gärning eller försummelse som enligt lag är straffbar. Med hänsyn till gärningens eller försummelsens menlighet, gärningsmannens skuld sådan den framgår av gärningen, den vinning som fåtts och övriga omständigheter i anslutning till gärningen eller försummelsen som helhet betraktad, kan tillsynsmyndigheten dock påföra påföljdsavgift och avstå från att anmäla ärendet till förundersökningsmyndigheten. 
Advokatföreningen gör en framställning till regionförvaltningsverket om att påföra en advokat som avses i 1 kap. 2 § 1 mom. 12 punkten eller advokatens biträde en påföljdsavgift. 
Påföljdsavgift kan, utöver eller i stället för en påföljdsavgift som påförs en juridisk person, påföras en sådan person i den juridiska personens ledning som har åsidosatt sina förpliktelser genom en gärning eller försummelse som avses i denna paragraf. En förutsättning för att personen i fråga ska påföras påföljdsavgift är att han eller hon på ett betydande sätt har bidragit till gärningen eller försummelsen. 
Den påföljdsavgift som avses i denna paragraf påförs av revisionsnämnden vid Patent- och registerstyrelsen. (Nytt 6 mom.) 
4 § 
Storleken på påföljdsavgiften för kreditinstitut och finansiella institut 
Beloppet av den påföljdsavgift som Finansinspektionen påför kreditinstitut och finansiella institut baseras på en samlad bedömning. Vid bedömningen av beloppet ska hänsyn tas till förfarandets art, omfattning och varaktighet samt gärningsmannens ekonomiska ställning. Dessutom ska vid bedömningen tas hänsyn till den vinning som erhållits eller den skada som orsakats genom förfarandet, om vinningen eller skadan kan bestämmas, gärningsmannens samarbete med Finansinspektionen för att utreda ärendet, gärningsmannens tidigare överträdelser och försummelser i fråga om bestämmelserna om finansmarknaden samt förfarandets eventuella konsekvenser för det finansiella systemets stabilitet. Vid den samlade bedömningen ska dessutom beaktas överträdelser och försummelser av de föreskrifter som Finansinspektionen meddelat med stöd av 9 kap. 6 §. 
En påföljdsavgift som Finansinspektionen påför får uppgå till antingen högst tio procent av kreditinstitutets eller det finansiella institutets omsättning under året före gärningen eller försummelsen eller fem miljoner euro, beroende på vilket belopp som är större. Om kreditinstitutet eller det finansiella institutet hör till en koncern, avses med omsättning den omsättning som framgår av koncernbokslutet för koncernens yttersta moderföretag. Om bokslutet ännu inte är klart när påföljdsavgiften bestäms, ska avgiften bestämmas utifrån omsättningen enligt bokslutet för det föregående året. Om kreditinstitutet eller det finansiella institutet nyligen har inlett sin verksamhet och något bokslut inte finns att tillgå, ska omsättningen uppskattas utifrån någon annan tillgänglig utredning. 
En påföljdsavgift som Finansinspektionen påför en fysisk person får uppgå till högst fem miljoner euro. 
Trots det som föreskrivs i denna paragraf får påföljdsavgiften emellertid vara högst dubbelt så stor som den vinning som erhållits genom gärningen eller försummelsen, om vinningen kan bestämmas. 
Med omsättning avses i denna paragraf 
1) ett kreditinstituts, ett värdepappersföretags och ett annat till dessas finansiella företagsgrupp hörande företags intäkter enligt artikel 316 i Europaparlamentets och rådets förordning (EU) nr 575/2013 om tillsynskrav för kreditinstitut och värdepappersföretag och om ändring av förordning (EU) nr 648/2012, 
2) ett försäkringsbolags, en försäkringsförenings, en pensionsanstalts eller ett i 2 kap. 18 b § i försäkringsbolagslagen avsett specialföretags premieinkomst, 
3) i fråga om andra företag än sådana som avses i 1 och 2 punkten, omsättningen enligt 4 kap. 1 § i bokföringslagen (1336/1997) eller motsvarande omsättning. 
Påföljdsavgiften betalas till staten. 
Vad som i denna paragraf föreskrivs om storleken på den påföljdsavgift som påförs kredit- eller finansinstitut ska, med undantag av den fjärde meningen i 1 mom., tillämpas också på påföljdsavgifter som regionförvaltningsverket påför företag som tillhandahåller finansiella tjänster.  
5 § 
Storleken på påföljdsavgiften för andra än kreditinstitut och finansiella institut 
Beloppet av den påföljdsavgift som påförs andra rapporteringsskyldiga än de som avses i 4 § baseras på en samlad bedömning. Vid bedömningen av beloppet ska hänsyn tas till förfarandets art, omfattning och varaktighet samt gärningsmannens ekonomiska ställning. Dessutom ska vid bedömningen tas hänsyn till den vinning som erhållits eller den skada som orsakats genom förfarandet, om vinningen eller skadan kan bestämmas, gärningsmannens samarbete med den behöriga tillsynsmyndigheten för att utreda ärendet samt gärningsmannens tidigare försummelser och överträdelser av denna lag eller av bestämmelser som utfärdats med stöd av den. Vid den samlade bedömningen av beloppet av en påföljdsavgift som påförs av Finansinspektionen ska dessutom beaktas överträdelser och försummelser av de föreskrifter som Finansinspektionen meddelat med stöd av 9 kap. 6 §. 
En påföljdsavgift som den behöriga tillsynsmyndigheten påför en juridisk eller fysisk person får vara antingen högst dubbelt så stor som den vinning som fåtts genom gärningen eller försummelsen, om vinningen kan bestämmas, eller en miljon euro, beroende på vilket belopp som är större. 
Påföljdsavgiften betalas till staten. 
6 § 
Avstående från administrativa påföljder 
Tillsynsmyndigheten kan avstå från att påföra ordningsavgift eller från att meddela offentlig varning, om 
1) en rapporteringsskyldig enligt 1 eller 2 § i detta kapitel självmant har vidtagit tillräckliga korrigerande åtgärder omedelbart efter att ha upptäckt överträdelsen och utan dröjsmål har anmält överträdelsen till tillsynsmyndigheten, 
2) överträdelsen kan anses vara obetydligt, eller om 
3) det annars måste anses vara uppenbart oskäligt att påföra en ordningsavgift eller meddela en offentlig varning. 
Ordningsavgift eller påföljdsavgift kan inte påföras en person som misstänks för samma gärning i samband med en förundersökning eller en åtalsprövning eller i ett brottmål som är anhängigt vid domstol. Ordningsavgift eller påföljdsavgift kan inte heller påföras den som har dömts för samma gärning genom en lagakraftvunnen dom. 
Tillsynsmyndigheten kan avstå från att påföra en juridisk eller fysisk person påföljdsavgift eller skjuta upp påförandet, om myndigheten vidtar någon annan sådan tillsynsåtgärd som föreskrivs i lagen. 
7 § 
Preskription av rätten att påföra administrativa påföljder 
Tillsynsmyndigheten får inte påföra ordningsavgift eller meddela offentlig varning och regionförvaltningsverket får inte med anledning av advokatföreningens framställning påföra ordningsavgift eller meddela offentlig varning, om beslutet inte har fattats inom fem år från den dag då överträdelsen eller försummelsen skedde eller, i fråga om en fortsatt överträdelse eller försummelse, inom fem år från den dag då överträdelsen eller försummelsen upphörde. 
Tillsynsmyndigheten får inte påföra påföljdsavgift och regionförvaltningsverket får inte med anledning av advokatföreningens framställning påföra påföljdsavgift, om beslutet inte har fattats inom tio år från den dag då överträdelsen eller försummelsen skedde eller, i fråga om en fortsatt överträdelse eller försummelse, inom fem år från den dag då överträdelsen eller försummelsen upphörde. 
8 § 
Offentliggörande av administrativa påföljder och andra beslut 
Tillsynsmyndigheten ska offentliggöra beslut om ordningsavgifter, offentliga varningar eller påföljdsavgifter omedelbart efter att den person som beslutet avser har underrättats om saken. Av offentliggörandet ska framgå huruvida beslutet att meddela påföljden har vunnit laga kraft, överträdelsens art och typ samt den för överträdelsen ansvariga personens identitet. Om besvärsmyndigheten upphäver beslutet helt eller delvis ska tillsynsmyndigheten offentliggöra besvärsmyndighetens beslut på samma sätt som meddelandet av påföljden har offentliggjorts. Information om en påföljd ska finnas tillgänglig på tillsynsmyndighetens webbplats i fem år. 
Om det är oskäligt att offentliggöra namnet på en fysisk eller juridisk person som ålagts en påföljd eller om offentliggörandet av påföljden skulle äventyra finansmarknadens stabilitet eller en pågående myndighetsundersökning, kan tillsynsmyndigheten 
1) skjuta upp offentliggörandet av ett påföljdsbeslut tills det inte längre finns grunder för att låta bli att offentliggöra beslutet,  
2) offentliggöra påföljdsbeslutet utan att ange namnet på den som påförts påföljden,  
3) låta bli att offentliggöra beslutet om påföljd, om de åtgärder som anges i 1 och 2 punkten inte är tillräckliga för att säkerställa att finansmarknadens stabilitet inte äventyras. 
Om tillsynsmyndigheten offentliggör ett påföljdsbeslut utan att ange namnet på den som påförts påföljden, kan den samtidigt besluta offentliggöra namnet senare efter en skälig tid, om grunderna för att inte offentliggöra namnet upphör under den tiden. 
Det som i denna paragraf föreskrivs om att offentliggöra ordningsavgifter, offentliga varningar och påföljdsavgifter ska på motsvarande sätt tillämpas på beslut som avses i 7 kap. 4—7 §. Tillsynsmyndigheten kan dock låta bli att offentliggöra ett beslut om det inte skulle vara skäligt att offentliggöra beslutet på grund av att den åtgärd som beslutet avser är obetydlig. 
Regionförvaltningsverket ska också offentliggöra sina beslut om ordningsavgifter, offentliga varningar och påföljdsavgifter som verket meddelat på framställning av advokatföreningen. Den information som offentliggörs får inte innehålla uppgifter om en advokats klienter eller uppgifter som de facto avslöjar en klients identitet. 
9 § 
Verkställighet och återbetalning av ordningsavgifter och påföljdsavgifter 
Rättsregistercentralen sköter verkställigheten av ordningsavgifter och påföljdsavgifter. Närmare bestämmelser om verkställigheten utfärdas genom förordning av statsrådet. 
Ordningsavgift och påföljdsavgift som påförts med stöd av denna lag verkställs i den ordning som föreskrivs i lagen om verkställighet av böter (672/2002). (Nytt 2 mom.) 
10 § 
Advokatföreningens framställning till regionförvaltningsverket om meddelande av administrativa påföljder  
Ärenden som gäller påförande av ordningsavgift, offentlig varning och påföljdsavgift för en i 1 kap. 2 § 1 mom. 12 punkten avsedd advokat och dennes biträde inleds vid regionförvaltningsverket på framställning av advokatföreningen. Advokatföreningen ska medan undersökning pågår samarbeta med regionförvaltningsverket innan en framställning görs. 
Advokatföreningens framställning om påförande av ordningsavgift, offentlig varning eller påföljdsavgift ska vara skriftlig. Av framställningen ska framgå 
1) den persons namn, hemort och adress som yrkandet avser, 
2) yrkandet och dess grunder, och 
3) de fakta och handlingar som advokatföreningen åberopar. 
Advokatföreningen ska trots sekretessbestämmelserna på begäran av regionförvaltningsverket ge verket ytterligare information som är nödvändig för att avgöra ärendet. 
Regionförvaltningsverket ska iaktta sekretessplikten enligt 22 § i lagen om offentlighet i myndigheternas verksamhet då verket behandlar uppgifter som omfattas av tystnadsplikten enligt lagen om advokater. 
11 § 
Rapportering till den europeiska tillsynsmyndigheten om påföljder för kreditinstitut och finansiella institut 
Finansinspektionen ska till den behöriga europeiska tillsynsmyndighet som saken gäller ge in 
1) information om påförda och offentliggjorda påföljder enligt detta kapitel för kreditinstitut och finansiella institut, samtidigt som påföljden offentliggörs, samt om eventuellt ändringssökande och resultatet av detta, 
2) årligen sammanställda uppgifter om de påföljder som enligt detta kapitel varje år påförts kreditinstitut och finansiella institut. 
Det som i 1 mom. föreskrivs om påföljder tillämpas också på beslut enligt 7 kap. 4—7 §. 
Regionförvaltningsverket ska ge Finansinspektionen information enligt 1 och 2 mom. om företag som tillhandahåller finansiella tjänster. Finansinspektionen ska vidarebefordra informationen till den europeiska tillsynsmyndigheten. 
9 kap. 
Särskilda bestämmelser 
1 § 
Utbildning och skydd för anställda samt anvisningar 
Genom att se till att de anställda får utbildning ska en rapporteringsskyldig säkerställa att denna lag och de bestämmelser som utfärdats med stöd av den iakttas. Den rapporteringsskyldiga ska utse en person som ansvarar för den interna kontrollen över efterlevnaden av denna lag och de bestämmelser som utfärdats med stöd av den, om det är motiverat med tanke på den rapporteringsskyldigas storlek och art. Om den rapporteringsskyldiga hör till en koncern eller en annan finansiell sammanslutning ska den dessutom iaktta koncernens eller den finansiella sammanslutningens interna förfaranden och anvisningar för att säkerställa att denna lag och de bestämmelser som utfärdats med stöd av den iakttas. 
En rapporteringsskyldig ska vidta åtgärder för att skydda anställda som gör en anmälan enligt 4 kap. 1 §. 
En rapporteringsskyldig ska dessutom ha för sin verksamhet lämpliga anvisningar om förfaranden för kundkontroll och, i anslutning till förhindrande av penningtvätt och av finansiering av terrorism, om inhämtande av uppgifter om kunderna, fortlöpande övervakning och utredningsskyldighet samt fullgörande av rapporteringsskyldigheten. 
2 § 
Rapporteringsskyldigas filialer och andra bolag 
De rapporteringsskyldiga ska också i sina filialer andra än EES-stater fullgöra sin i denna lag föreskrivna skyldighet att utföra kundkontroll.  
De rapporteringsskyldiga ska se till att skyldigheterna enligt denna lag fullgörs också i sådana dotterbolag i andra än EES-stater där den rapporteringsskyldiga innehar mer än 50 procent av det röstetal som aktierna eller andelarna i bolaget medför. 
Om lagstiftningen i den andra staten inte tillåter att de förfaranden för kundkontroll som anges i denna lag iakttas, ska den rapporteringsskyldiga anmäla detta till tillsynsmyndigheten och till advokatföreningen. 
3 § 
Samarbete och informationsutbyte mellan tillsynsmyndigheterna och advokatföreningen  
Tillsynsmyndigheter och advokatföreningen ska samarbeta för att förhindra och avslöja penningtvätt och finansiering av terrorism. 
Tillsynsmyndigheter och advokatföreningen ska, trots vad som någon annanstans i lag föreskrivs om sekretess, utan dröjsmål utbyta information som de innehar och som är nödvändig för förhindrande och avslöjande av penningtvätt och av finansiering av terrorism. 
4 § 
Ändringssökande 
Tillsynsmyndighetens beslut får överklagas genom besvär hos förvaltningsdomstolen på det sätt som anges i förvaltningsprocesslagen, om inte något annat föreskrivs nedan i denna paragraf eller någon annanstans i lag. I förvaltningsdomstolens beslut får ändring sökas genom besvär endast om högsta förvaltningsdomstolen beviljar besvärstillstånd. 
Tillsynsmyndigheten har rätt att genom besvär överklaga förvaltningsdomstolens beslut som innebär att domstolen har ändrat eller upphävt tillsynsmyndighetens beslut. Förvaltningsdomstolen ska när den behandlar ett besvärsärende ge advokatföreningen tillfälle att bli hörd med anledning av besvären och att vid behov lägga fram bevisning och annan utredning i de fall då ärendet gäller en rapporteringsskyldig vars verksamhet övervakas av advokatföreningen enligt 7 kap. 1 § 2 mom. 
Tillsynsmyndighetens beslut ska iakttas trots att det överklagas, om inte besvärsmyndigheten beslutar något annat eller om inte annat föreskrivs någon annanstans i lag. 
På överklagande av Finansinspektionens beslut tillämpas 73 § i lagen om Finansinspektionen. 
På överklagande av Patent- och registersstyrelsens beslut tillämpas 11 kap. 1 § i revisionslagen. 
5 § 
Verkställighet av vite, ordningsavgifter och påföljdsavgifter 
Vite som dömts ut i enlighet med denna lag samt ordningsavgift och påföljdsavgift som påförts i enlighet med denna lag får verkställas endast med stöd av beslut som vunnit laga kraft. 
5 § 
Vissa myndigheters allmänna omsorgsplikt  
Tull-, gränsbevaknings-, skatte- och utsökningsmyndigheterna samt konkursombudsmannen ska i sin verksamhet se till att uppmärksamhet riktas på förhindrande och avslöjande av penningtvätt och av finansiering av terrorism samt att tvivelaktiga transaktioner och misstänkt finansiering av terrorism som uppdagas i samband med skötseln av deras uppgifter anmäls till centralen för utredning av penningtvätt. 
I fråga om tull- och gränsbevakningsmyndigheternas uppgifter i egenskap av förundersökningsmyndigheter föreskrivs särskilt. 
6 § 
Bemyndigande att meddela föreskrifter 
Tillsynsmyndigheterna kan meddela närmare föreskrifter om riskfaktorer enligt 3 kap. 1 § 2 mom. och som de rapporteringsskyldiga ska beakta samt om de förenklade åtgärder som avses i 3 kap. 8 § och som anknyter till en lägre risk än vanligt för penningtvätt och finansiering av terrorism och de skärpta åtgärder som avses i 3 kap. 10 § och som anknyter till en högre risk än vanligt för penningtvätt och finansiering av terrorism. 
7 § 
Ikraftträdande 
Denna lag träder i kraft den 20 . 
Lagens 5  kap. och 6 kap. 2 och 3 § träder dock i kraft den 20 . 
Lagens 6 kap. 2 och 3 § träder dock i kraft den 20 . (Nytt 3 mom.) 
Genom denna lag upphävs lagen om förhindrande och utredning av penningtvätt och av finansiering av terrorism (503/2008). (3 mom. i RP) 
8 § 
Övergångsbestämmelser 
Den rapporteringsskyldigas riskbedömning enligt 2 kap. 3 § ska vara klar före den 31 december 2017. 
Det på riskbaserad bedömning grundade förfarandet enligt 3 kap. 13 § ska vara klart före den 31 december 2017. 
Den som när denna lag träder i kraft är införd i registret över företagstjänster eller i valutaväxlingsregistret ska inom sex månader efter det att lagen har trätt i kraft göra en anmälan enligt 5 kap. 3 § om införande i registret för övervakning av penningtvätt.  
Vad som i 3 kap. 2 § 2 mom. föreskrivs om kundidentifiering och identitetskontroll i samband med sammanhängande transaktioner i penningspelsverksamhet tillämpas från och med den 1 januari 2018 på i 14 § 1 mom. i lotterilagen avsedd verksamhet som gäller penningspel som förmedlas elektroniskt. 
Bestämmelserna om straffansvar i lagen om förhindrande och utredning av penningtvätt och finansiering av terrorism, som upphävs genom denna lag, ska tillämpas på de brott och förseelser som inträffat innan denna lag träder i kraft. Om den nya lagen leder till ett lindrigare slutresultat, ska detta beaktas när straffet bestäms. 
2. 
Lag 
om centralen för utredning av penningtvätt 
I enlighet med riksdagens beslut föreskrivs: 
1 § 
Tillämpningsområde 
Denna lag innehåller bestämmelser om centralen för utredning av penningtvätt samt om ett register för förhindrande, avslöjande och utredning av penningtvätt och av finansiering av terrorism. 
2 § 
Centralen för utredning av penningtvätt och dess uppgifter 
Vid centralkriminalpolisen finns centralen för utredning av penningtvätt som har till uppgift att 
1) förhindra, avslöja och utreda penningtvätt och finansiering av terrorism samt föra sådana ärenden till undersökning, 
2) ta emot och analysera rapporter enligt 4 kap. 1 § i lagen om förhindrade av penningtvätt och av finansiering av terrorism ( / ) och ge återkoppling om verkningarna av dem, 
3) samarbeta med myndigheterna vid bekämpning av penningtvätt och av finansiering av terrorism, 
4) samarbeta och utbyta information med sådana myndigheter i en främmande stat och internationella organisationer som har till uppgift att förhindra och utreda penningtvätt och finansiering av terrorism, 
5) samarbeta med rapporteringsskyldiga, 
6) föra statistik över antalet rapporter enligt 4 kap. 1 § i lagen om förhindrade av penningtvätt och av finansiering av terrorism och antalet avbrutna transaktioner enligt 5 § i det kapitlet, antalet anmälningar om tvivelaktiga transaktioner som förts till undersökning samt över gjorda, mottagna, avvisade och besvarade informationsförfrågningar, 
7) ta emot och behandla anmälningar enligt 3 § 2 mom. i lagen om frysning av tillgångar i syfte att bekämpa terrorism (325/2013), utreda grunderna för frysningsbeslut som avses i 4 § i den lagen och göra framställningar om frysningsbeslut. 
Med förhindrande, avslöjande och utredning av penningtvätt och av finansiering av terrorism avses i 1 mom. 1 punkten mottagande, registrering och annan handläggning av rapporter om misstankar om penningtvätt och om finansiering av terrorism och, i anslutning till dessa misstankar, av uppgifter om penningtvätt och finansiering av terrorism samt förhindrande, avslöjande och utredning av penningtvätt, av finansiering av terrorism och av det brott genom vilket den egendom eller den vinning har fåtts eller kan fås som är föremål för penningtvätt eller finansiering av terrorism. 
Bestämmelser om befogenheterna för centralen för utredning av penningtvätt finns dessutom i polislagen (872/2011). 
Centralkriminalpolisen ska årligen ge Polisstyrelsen en rapport om verksamheten vid centralen för utredning av penningtvätt, om antalet rapporter enligt 4 kap. 1 § i lagen om förhindrade av penningtvätt och av finansiering av terrorism och om antalet förordnanden enligt 6 § i denna lag om att avbryta transaktioner samt om framstegen i allmänhet när det gäller åtgärder som i Finland vidtas mot penningtvätt och mot finansiering av terrorism. 
3 § 
Registret för förhindrande, avslöjande och utredning av penningtvätt och av finansiering av terrorism 
Registret för förhindrande, avslöjande och utredning av penningtvätt och av finansiering av terrorism är ett permanent personregister (penningtvättsregistret) som används av centralen för utredning av penningtvätt och förs med hjälp av automatisk databehandling. Centralen för utredning av penningtvätt är registeransvarig. 
I penningtvättsregistret får införas uppgifter och handlingar som har inhämtats för fullgörande av uppdrag enligt 2 § eller fåtts med stöd av 4 och 5 §. 
I penningtvättsregistret får registreras följande uppgifter som behövs för syftet med informationssystemet: 
1) namnet på den rapporterande och på den rapporterade personen, 
2) födelsedatum, hemkommun och hemstat, 
3) personbeteckning, 
4) uppgifterna i den handling som använts vid identifieringen, 
5) kön, 
6) modersmål,  
7) medborgarskap, avsaknad av medborgarskap eller nationalitet, 
8) hemstat, 
9) civilstånd, 
10) yrke, 
11) adress och telefonnummer samt annan kontaktinformation, 
12) uppgift om att personen avlidit eller om dödförklaring av personen, 
13) klientnummer som en myndighet gett, 
14) FO-nummer, 
15) bankkontouppgifter, 
16) i fråga om en utländsk person föräldrarnas namn och adress, uppgifterna i resedokument samt övrig behövlig information som gäller inresa och passerande av gräns. 
Penningtvättsregistret får användas endast av anställda vid centralen för utredning av penningtvätt. Uppgifterna får oberoende av sekretessbestämmelserna användas och lämnas ut för att förhindra, avslöja och utreda penningtvätt, finansiering av terrorism och det brott genom vilket den egendom eller den vinning har fåtts eller kan fås som är föremål för penningtvätt eller finansiering av terrorism samt för att föra ärendet till undersökning. 
Namnet på och identiteten hos den som rapporterar tvivelaktiga transaktioner är sekretessbelagd information. Oberoende av sekretessplikten får denna information dock lämnas ut för ändamål som anges i 4 § 4 mom. och 5 § 3 mom..  
De registrerade har inte rätt till annan insyn i registret än till uppgifter i anslutning till de frysningsbeslut som avses i 2 § 1 mom. 7 punkten. Dataombudsmannen kan på begäran av en registrerad kontrollera att behandlingen av uppgifterna om den registrerade är lagenlig. 
Rapporten och uppgifterna i den stryks i penningtvättsregistret tio år från det att anteckningen om misstänkt penningtvätt eller finansiering av terrorism gjordes. Uppgifter som avses i 2 § 1 mom. 7 punkten ska strykas utan dröjsmål om frysningsbeslutet upphävs med stöd av 12 § i lagen om frysning av tillgångar i syfte att bekämpa terrorism (325/2013). 
Logguppgifter och övervakningsuppgifter om databehandling enligt 5 § 5 mom. ska på begäran tillställas dataskyddsombudsmannen för påseende. Logguppgifter ska bevaras endast i syfte att säkerställa skyddet för personuppgifter samt för att trygga datasäkerheten och rättssäkerheten och de ska skyddas mot osaklig hantering. Logguppgifter och övervakningsuppgifter ska bevaras i tio år. 
Bestämmelser om polisens personregister och polisens behandling av personuppgifter finns dessutom i lagen om behandling av personuppgifter i polisens verksamhet (761/2003) och personuppgiftslagen (523/1999). 
4 § 
Rätten för centralen för utredning av penningtvätt att få, använda och lämna ut uppgifter 
Trots bestämmelserna om hemlighållande av uppgifter om affärs- och yrkeshemligheter eller uppgifter om en enskild persons, sammanslutnings eller stiftelses ekonomiska förhållanden, ekonomiska ställning eller beskattningsuppgifter har centralen för utredning av penningtvätt rätt att av myndigheter, av sammanslutningar som har ålagts en offentlig uppgift och av rapporteringsskyldiga avgiftsfritt få uppgifter och handlingar som är nödvändiga för förhindrande och utredning av penningtvätt och av finansiering av terrorism. Beslut om inhämtande av sekretessbelagda uppgifter fattas av en polisman som hör till befälet och arbetar vid centralen för utredning av penningtvätt. 
Trots tystnadsplikten för en medlem, en revisor, en verksamhetsgranskare, en styrelseledamot eller en anställd har centralen för utredning av penningtvätt på skriftlig begäran av en polisman som hör till befälet och arbetar vid centralen rätt att av en enskild sammanslutning, stiftelse eller person avgiftsfritt få uppgifter som är nödvändiga för förhindrande och utredning av penningtvätt och av finansiering av terrorism. 
Uppgifter som avses i 1 och 2 mom. får lämnas ut till centralen för utredning av penningtvätt som en datamängd eller i elektronisk form. 
De uppgifter som centralen erhållit får oberoende av sekretessbestämmelserna användas och lämnas ut endast för att förhindra, avslöja och utreda penningtvätt, finansiering av terrorism och det brott genom vilket den egendom eller den vinning har fåtts eller kan fås som är föremål för penningtvätt eller finansiering av terrorism samt för att föra ärendet till undersökning. Centralen för utredning av penningtvätt kan lämna ut uppgifter också utan begäran. Dessutom får uppgifter lämnas ut till utrikesministeriet för skötsel av uppgifter enligt 9 § i lagen om frysning av tillgångar i syfte att bekämpa terrorism och till utmätningsmannen för skötsel av uppgifter enligt 14 § i den lagen och uppgifter enligt 2 b § i lagen om uppfyllande av vissa förpliktelser som grundar sig på Finlands medlemskap i Förenta Nationerna och Europeiska unionen (659/1967). Uppgifter kan lämnas ut också till en behörig tillsynsmyndighet som avses i denna lag, om den uppgift som lämnas ut är nödvändig för att den behöriga tillsynsmyndigheten ska kunna utföra de uppgifter som avses i denna lag. Sådant beslut om utlämnande av uppgifter som avses i detta moment fattas av en polisman som hör till befälet och arbetar vid centralen för utredning av penningtvätt. Uppgifter som avses i detta moment får lämnas ut som en datamängd eller i elektronisk form. 
Centralen för utredning av penningtvätt kan sätta begränsningar och ställa villkor för användning av de uppgifter enligt 1, 2 och 4 mom. som lämnas ut. Centralen kan vägra att lämna ut uppgifter till någon annan än en förundersökningsmyndighet, om det i ärendet finns skäl att misstänka penningtvätt eller finansiering av terrorism och målen för utredningen kan äventyras om uppgifter lämnas ut. 
De förfrågningar som centralen för utredning av penningtvätt gjort med stöd av den rätt att få uppgifter som anges i 1 och 2 mom. eller innehållet i förfrågningarna får inte avslöjas för den som förfrågningarna gäller. På bevarande och kontroll av förfrågningarna och de svar som getts med anledning av dem tillämpas bestämmelserna om bevarande och kontroll av uppgifter om tvivelaktiga transaktioner i 4 kap. 3 § 1 och 2 mom. i lagen om förhindrande av penningtvätt och av finansiering av terrorism. 
5 § 
Utbyte av information 
Centralen för utredning av penningtvätt har rätt att begära uppgifter som avses i 4 § 1 och 2 mom. av en främmande stats finansunderrättelseenhet eller en annan behörig myndighet för att förhindra, avslöja och utreda penningtvätt, finansiering av terrorism och det brott genom vilket den egendom eller den vinning har fåtts eller kan fås som är föremål för penningtvätt eller finansiering av terrorism samt för att föra ärendet till undersökning. I en begäran om utlämnande av uppgifter ska ändamålet med uppgifterna specificeras, och begäran ska innehålla tillräckliga fakta, bakgrundsuppgifter och motiveringar för att begäran ska kunna besvaras. 
Uppgifter från en myndighet i en främmande stat får användas och lämnas ut vidare för något annat ändamål än det ändamål för vilket de har lämnats ut endast om den myndigheten har gett sitt samtycke i förväg. 
Centralen för utredning av penningtvätt kan efter en motiverad begäran lämna ut uppgifter som avses i 4 § 1 och 2 mom. till finansunderrättelseenheten eller en annan behörig myndighet i en främmande stat för att förhindra, avslöja och utreda penningtvätt, finansiering av terrorism och det brott genom vilket den egendom eller den vinning har fåtts eller kan fås som är föremål för penningtvätt eller finansiering av terrorism samt för att föra ärendet till undersökning. En begäran om utlämnande av uppgifter ska besvaras utan ogrundat dröjsmål. Centralen för utredning av penningtvätt kan sätta begränsningar och ställa villkor för användningen av de uppgifter som lämnas ut. Centralen kan vägra att lämna ut uppgifter om det kan vara till skada för arbetet med att förhindra, avslöja och utreda penningtvätt, finansiering av terrorism eller det brott genom vilket egendom eller vinning har fåtts av penningtvätt eller av finansiering av terrorism, eller om det kan utgöra hinder för att ärendet förs till undersökning, eller av någon annan grundad anledning. 
Centralen för utredning av penningtvätt kan lämna ut uppgifter till finansunderrättelseenheten eller en annan behörig myndighet i en främmande stat också utan begäran, om det behövs för ett ändamål som anges i 4 mom. 
Uppgifter som avses i denna paragraf får tas emot och lämnas ut som en datamängd eller i elektronisk form i ett gemensamt överenskommet förfarande. Centralen för utredning av penningtvätt kan söka träffar i ett register som förvaltas av finansunderrättelseenheten i någon av Europeiska unionens medlemsstater, om den behöriga myndigheten i den medlemsstaten har gett sitt samtycke. Finansunderrättelseenheten i någon av Europeiska unionens medlemsstater kan ges rätt att söka träffar i ett register som avses i 3 § för att utreda om registret innehåller uppgifter om ett föremål för den statens sökningar. Beslut om utlämnande av uppgifter som avses i denna lag och av uppgifter om sökträffar fattas av en polisman som hör till befälet och arbetar vid centralen för utredning av penningtvätt. 
Bestämmelser om internationell rättshjälp i brottmål utfärdas särskilt. 
6 § 
Förordnande av centralen för utredning av penningtvätt om avbrytande av en transaktion 
En polisman som hör till befälet och arbetar vid centralen för utredning av penningtvätt kan ålägga en rapporteringsskyldig att avbryta en transaktion för högst tio vardagar, om ett sådant avbrott är nödvändigt för att förhindra, avslöja och utreda penningtvätt, finansiering av terrorism och det brott genom vilket den egendom eller den vinning har fåtts eller kan fås som är föremål för penningtvätt eller finansiering av terrorism samt för att föra ärendet till undersökning. 
En polisman som hör till befälet och arbetar vid centralen för utredning av penningtvätt kan på begäran av en utländsk myndighet som ansvarar för bekämpning av penningtvätt eller av finansiering av terrorism meddela en rapporteringsskyldig ett förordnande att avbryta en transaktion för högst tio vardagar, om ett sådant avbrott är nödvändigt för att förhindra, avslöja eller utreda penningtvätt, finansiering av terrorism eller det brott genom vilket den egendom eller den vinning har fåtts eller kan fås som är föremål för penningtvätt eller finansiering av terrorism samt för att föra ärendet till undersökning. 
Centralen för utredning av penningtvätt har för ändamål som anges i 1, 2 eller 4 mom. rätt att be den vars tillgångar eller egendom avbrottet gäller inkomma med en utredning om transaktionen. Ett förordnande att avbryta en transaktion ska utan dröjsmål återkallas när avbrottet inte längre behövs. 
En polisman som hör till befälet och arbetar vid centralen för utredning av penningtvätt kan för verkställande meddela tullmyndigheten och gränsbevakningsmyndigheten ett förordnande att under högst tio vardagar hålla inne medel som påträffats i samband med en tullåtgärd eller gränskontroll eller gränsövervakning, om en sådan åtgärd är nödvändig för att förhindra, avslöja eller utreda penningtvätt, finansiering av terrorism eller det brott genom vilket den egendom eller den vinning har fåtts eller kan fås som är föremål för penningtvätt eller finansiering av terrorism samt för att föra ärendet till undersökning. Med medel som ska hållas inne avses kontanta medel enligt artikel 2 i Europaparlamentets och rådets förordning (EG) nr 1889/2005 om kontroller av kontanta medel som förs in i eller ut ur gemenskapen samt annan lös egendom som har ett ekonomiskt värde. 
Som vardagar enligt denna paragraf räknas inte lördagar. 
7 § 
Ikraftträdande 
Denna lag träder i kraft den 20 . 
3. 
Lag 
om ändring av lagen om Finansinspektionen 
I enlighet med riksdagens beslut 
ändras i lagen om Finansinspektionen (878/2008) 10 § 1 mom. 5 punkten och 71 § 1 mom. 14 punkten, sådana de lyder i lag 1442/2016, och 
fogas till lagen en ny 40 a § och till 71 § 1 mom., sådant det lyder delvis ändrat i lagarna 752/2012, 611/2014, 651/2014, 1198/2014, 505/2015, 520/2016 och 1442/2016, en ny 15 punkt som följer: 
10 § 
Direktionens uppgifter 
Direktionen ska i fråga om tillsynen över finansmarknaden 
5) döma ut vite som Finansinspektionen har förelagt och besluta om andra administrativa påföljder enligt 4 kap. samt om administrativa påföljder enligt lagen om förhindrande av penningtvätt och av finansiering av terrorism ( / ), 
40 a § 
Ordningsavgift, offentlig varning och påföljdsavgift för vissa överträdelser 
Bestämmelserna om ordningsavgift, offentlig varning och påföljdsavgift för den som försummar eller överträder lagstiftningen om förhindrande av penningtvätt och av finansiering av terrorism eller Europaparlamentets och rådets förordning (EU) 2015/847 om uppgifter som ska åtfölja överföringar av medel och om upphävande av förordning (EG) nr 1781/2006 finns i lagen om förhindrande av penningtvätt och av finansiering av terrorism. 
71 § (Ny) 
Rätt och skyldighet att lämna ut information 
Utöver vad som föreskrivs i lagen om offentlighet i myndigheternas verksamhet (621/1999) har Finansinspektionen utan hinder av sekretessbestämmelserna rätt att lämna ut information till 
14) arbetarskyddsmyndigheterna för att de ska kunna fullgöra sina uppgifter och för att fullfölja samarbetsskyldigheterna enligt artikel 8 i kommissionens genomförandedirektiv (EU) 2015/2392 om Europaparlamentets och rådets förordning (EU) nr 596/2014 vad gäller rapportering till behöriga myndigheter av faktiska eller potentiella överträdelser av den förordningen, nedan genomförandedirektivet för marknadsmissbruksförordningen, 
15) de myndigheter som avses i 7 kap. 1 § 1 mom. i lagen om förhindrande av penningtvätt och av finansiering av terrorism och den advokatförening som avses i 2 mom. i samma paragraf när informationen är nödvändig för att förhindra och avslöja penningtvätt och finansiering av terrorism. (Ny) 
Denna lag träder i kraft den 20 . 
4. 
Lag 
om ändring av handelsregisterlagen 
I enlighet med riksdagens beslut 
ändras i handelsregisterlagen (129/1979) 1 a §, 5 § 7 och 8 punkten, 6 § 8 och 9 punkten, 9 § 1 mom. 13 och 14 punkten, 10 § 1 mom. 16 och 17 punkten, 11 § 1 mom. 6 och 7 punkten, 12 §, 13 § 12 och 13 punkten, 13 c § 8 och 9 punkten och 13 d § 1 mom. 9 och 10 punkten, 
sådana de lyder, 1 a § i lag 962/2013, 5 § 7 punkten och 6 § 8 punkten i lag 390/1988, 5 § 8 punkten, 6 § 9 punkten, 11 § 1 mom. 6 och 7 punkten, 12 § samt 13 § 12 och 13 punkten i lag 1122/1993, 9 § 1 mom. 13 punkten i lag 636/2006, 9 § 1 mom. 14 punkten i lag 147/1997, 10 § 1 mom. 16 punkten i lag 432/2013, 10 § 1 mom. 17 punkten i lag 908/2006, 13 c § 8 och 9 punkten i lag 1075/1994 och 13 d § 1 mom. 9 och 10 punkten i lag 1300/1994, samt 
fogas till 5 §, sådan den lyder i lagarna 390/1988 och 1122/1993, en ny 9 punkt, till 6 §, sådan den lyder i lagarna 390/1988 och 1122/1993, en ny 10 punkt, till 9 § 1 mom., sådant det lyder i lagarna 351/1987, 1616/1992, 1122/1993, 147/1997, 744/2004 och 636/2006, en ny 15 och en ny 16 punkt och till 9 §, sådan den lyder i lagarna 351/1987, 1616/1992, 1122/1993, 147/1997, 744/2004, 636/2006, 529/2008, 1602/2009 och 609/2010, ett nytt 7 mom., till 10 § 1 mom., sådant det lyder i lagarna 1490/2001, 908/2006 och 432/2013, en ny 18 punkt, till 11 § 1 mom., sådant det lyder delvis ändrat i lagarna 1278/1990 och 1122/1993, en ny 8 punkt, till 13 §, sådan den lyder i lagarna 1252/1987 och 1122/1993, en ny 14 punkt, till 13 c, sådan den lyder i lag 1075/1994, § en ny 10 punkt, till 13 d § 1 mom., sådan det lyder i lag 1300/1994, en ny 11 punkt och till lagen en ny 13 e §, som följer: 
1 a § 
Var och en har rätt att få uppgifter, utdrag och intyg angående anteckningar i handelsregistret och handlingar som registermyndigheten innehar. Trots bestämmelserna i 16 § 3 mom. i lagen om offentlighet i myndigheternas verksamhet (621/1999) får registermyndigheten lämna ut uppgifter om fysiska personers namn, födelsetid, medborgarskap och hemkommun i form av utskrifter, genom teknisk anslutning eller på något annat sätt i elektronisk form eller göra dem allmänt tillgängliga i ett elektroniskt datanät. 
Trots bestämmelserna i 16 § 3 mom. i lagen om offentlighet i myndigheternas verksamhet (621/1999) får registermyndigheten lämna ut personuppgifter ur registret i form av utskrifter eller göra dem allmänt tillgängliga i ett elektroniskt datanät. 
Registermyndigheten får lämna ut i handelsregistret införda uppgifter om personbeteckningens slutled och en utomlands bosatt fysisk persons hemadress ur registret endast om utlämnandet uppfyller kraven i 16 § 3 mom. i lagen om offentlighet i myndigheternas verksamhet. I övriga fall ska i stället för uppgift om en utomlands bosatt fysisk persons hemadress lämnas ut uppgift om personens bosättningsland. En förutsättning för att i handelsregistret införda uppgifter om personbeteckningens slutled och om en utomlands bosatt fysisk persons hemadress ska lämnas ut ur registret är att den som begär uppgifterna ger registermyndigheten en utredning om att uppgifterna skyddas på ändamålsenligt sätt. (3 mom. i RP) 
5 § 
I ett öppet bolags grundanmälan skall nämnas 
7) vem eller vilka av bolagsmännen som tecknar bolagets firma, 
8) om bolaget har en verkställande direktör, direktörens personuppgifter,  
9) om bolaget har en annan verklig förmånstagare enligt 6 kap. 2 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism ( / ), denna förmånstagares personuppgifter samt grunden för och omfattningen av det bestämmande inflytandet eller ägarandelen.  
6 §  
I ett kommanditbolags grundanmälan skall nämnas 
8) vem eller vilka av de ansvariga bolagsmännen som tecknar bolagets firma, 
9) om bolaget har en verkställande direktör, direktörens personuppgifter, och 
10) om bolaget har en annan verklig förmånstagare enligt 6 kap. 2 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism, denna förmånstagares personuppgifter samt grunden för och omfattningen av det bestämmande inflytandet eller ägarandelen. 
9 § 
I ett aktiebolags eller europabolags grundanmälan skall nämnas  
13) bolagsordningens bestämmelse om företrädande av bolaget samt, om någon givits rätt att företräda bolaget ensam eller tillsammans med någon annan, denna persons uppgifter,  
14) bolagets räkenskapsperiod,  
15) personuppgifterna för en aktieägare som äger mer än 25 procent av aktierna eller om ägaren är en juridisk person, dennas namn, det register där den juridiska personen är införd och FO-nummer eller motsvarande, 
15) om aktiebolaget eller europabolaget har en annan verklig förmånstagare enligt 6 kap. 2 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism, denna förmånstagares personuppgifter samt grunden för och omfattningen av det bestämmande inflytandet eller ägarandelen. 
Vad som föreskrivs i 1 mom. 15 och 16 punkten tillämpas inte på bostadsaktiebolag eller ömsesidiga fastighetsaktiebolag som avses i lagen om bostadsaktiebolag. 
10 §  
I ett andelslags och ett europaandelslags grundanmälan ska nämnas  
16) för det fall att det i stadgarna föreskrivs om medlemmarnas tillskottsplikt, de uppgifter som avses i 14 kap. 1 § 2 mom. i lagen om andelslag, 
17) ett europaandelslags andelskapital,  
18) om andelslaget har en annan verklig förmånstagare enligt 6 kap. 2 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism, denna förmånstagares personuppgifter samt grunden för och omfattningen av det bestämmande inflytandet eller ägarandelen. 
11 § 
I sparbanks grundanmälan skall nämnas: 
6) bankens verkställande direktörs samt styrelsens ordförandes, vice ordförandes och alla medlemmars och suppleanters personuppgifter samt, om banken har ett förvaltningsråd, ordförandens och alla övriga medlemmars personuppgifter,  
7) bestämmelsen i stadgarna om tecknande av sparbankens firma och, om någon givits rätt att teckna firman ensam eller tillsammans med någon annan, dennes personuppgifter, 
8) i 6 kap. 2 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism avsedda verkliga förmånstagares personuppgifter samt grunden för och omfattningen av det bestämmande inflytandet eller ägarandelen. 
12 § 
I en hypoteksförenings grundanmälan ska, utöver det som i 10 § 1 mom. i lagen om hypoteksföreningar (936/1978) föreskrivs om anmälan till handelsregistret, nämnas 
1) föreningens postadress, 
2) alla styrelsemedlemmars och suppleanters övriga personuppgifter, 
3) bestämmelsen i stadgarna om tecknande av föreningens firma samt, om någon givits rätt att teckna firman ensam eller tillsammans med någon annan, dennes övriga personuppgifter,  
4) om hypoteksföreningen har en annan verklig förmånstagare enligt 6 kap. 2 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism, denna förmånstagares personuppgifter samt grunden för och omfattningen av det bestämmande inflytandet eller ägarandelen. 
13 §  
I en försäkringsförenings grundanmälan skall nämnas 
12) om föreningen har ett förvaltningsråd, ordförandens och alla medlemmars och suppleanters personuppgifter,  
13) bestämmelsen i stadgarna om tecknande av föreningens firma samt, om någon givits rätt att teckna firman ensam eller tillsammans med någon annan, denna persons personuppgifter,  
14) om föreningen har en annan verklig förmånstagare enligt 6 kap. 2 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism, denna förmånstagares personuppgifter samt grunden för och omfattningen av det bestämmande inflytandet eller ägarandelen. 
13 c § 
I en bostadsrättsförenings grundanmälan skall nämnas 
8) personuppgifterna för varje boendeförvaltningsområdes boendekommittés ordförande, alla medlemmar och suppleanter samt disponenten, 
9) bestämmelsen i stadgarna om tecknande av föreningens firma samt, om någon person givits rätt att teckna firman på föreningens eller boendeförvaltningsområdets vägnar ensam eller tillsammans med någon annan, denna persons personuppgifter,  
10) om bostadsrättsföreningen har en annan verklig förmånstagare enligt 6 kap. 2 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism, denna förmånstagares personuppgifter samt grunden för och omfattningen av det bestämmande inflytandet eller ägarandelen. 
13 d § 
I grundanmälan om en europeisk ekonomisk intressegruppering skall nämnas 
9) verksamhetsperioden, om en sådan har avtalats, 
10) intressegrupperingens driftställen, om sådana finns, 
11) om den europeiska ekomiska intressegrupperingen har en annan verklig förmånstagare enligt 6 kap. 2 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism, denna förmånstagares personuppgifter samt grunden för och omfattningen av det bestämmande inflytandet eller ägarandelen. 
13 e § 
I en sådan anmälan om de verkliga förmånstagarna för en express trust som avses i artikel 31.1 i Europaparlamentets och rådets direktiv (EU) 2015/849 om åtgärder för att förhindra att det finansiella systemet används för penningtvätt eller finansiering av terrorism, om ändring av Europaparlamentets och rådets förordning (EU) nr 648/2012 och om upphävande av Europaparlamentets och rådets direktiv 2005/60/EG och kommissionens direktiv 2006/70/EG ska nämnas 
1) den utländska trustens namn och den stat enligt vars lagstiftning trusten bildats, 
2) om den utländska trusten har registrerats, det register där trusten har införts och trustens registernummer i registret, 
3) personuppgifterna för de verkliga förmånstagarna enligt 6 kap. 3 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism samt grunden för och omfattningen av det bestämmande inflytandet eller ägarandelen. 
Denna lag träder i kraft den 20 . Lagens 5, 6, 9—13 och 13 c—13 e träder dock i kraft den 1 juli 2019. 
Uppgifterna om verkliga förmånstagare enligt 6 kap. 2 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism samt uppgifterna om utländska trusters verkliga förmånstagare enligt 6 kap. 3 § i samma lag ska meddelas handelsregistret senast den 1 juli 2020. (Nytt) 
5. 
Lag 
om ändring av 20 kap. 1 § och 15 kap. 6 § i kreditinstitutslagen 
I enlighet med riksdagens beslut 
upphävs i kreditinstitutslagen (610/2014) 20 kap. 1 § 2 mom. 6 punkten, sådan den lyder i lag 1199/2014, och 
ändras 15 kap. 6 § 2 och 3 mom. samt 18 § 3 mom., av dem 15 kap. 6 § 2 och 3 mom. sådana de lyder i lag 1054/2016, som följer: 
15 kap. 
Förfaranden vid kundtransaktioner 
6 § 
Kunders rätt till grundläggande banktjänster 
En inlåningsbank ska utan obefogat dröjsmål och senast inom tio bankdagar efter att ha tagit emot ansökan godkänna eller avslå en kunds ansökan om ett betalkonto med grundläggande funktioner. Inlåningsbanken får vägra öppna ett betalkonto med grundläggande funktioner och tillhandahålla betaltjänster i anslutning till kontot endast av skäl som anges i lagen om förhindrande av penningtvätt och av finansiering av terrorism (   /   ) och i lagen om uppfyllande av vissa förpliktelser som grundar sig på Finlands medlemskap i Förenta Nationerna och Europeiska unionen (659/1967). 
Kunden ska utan dröjsmål, skriftligen och avgiftsfritt underrättas om den exakta orsaken till vägran. Kunden ska dock inte underrättas ifall det skulle strida mot den nationella säkerheten, den allmänna ordningen eller mot lagen om förhindrande av penningtvätt och av finansiering av terrorism. Inlåningsbanken ska ge kunden tillräcklig utredning om förfarandet för överklagande av avslagsbeslutet och om rätten att kontakta den behöriga myndigheten och det alternativa organet för tvistlösning samt tillhandahålla relevanta kontaktuppgifter. (Nytt) 
18 § (Ny) 
Kundkontroll 
I fråga om kundkontroll gäller dessutom vad som föreskrivs i lagen om förhindrande av penningtvätt och av finansiering av terrorism
Denna lag träder i kraft den 20 . 
6. 
Lag 
om ändring av 12 kap. 3 § och 15 kap. 2 § i lagen om investeringstjänster 
I enlighet med riksdagens beslut 
upphävs i lagen om investeringstjänster (747/2012) 15 kap. 2 § 2 mom. 6 punkten, sådan den lyder i lag 1201/2014, och 
ändras i lagen om investeringstjänster (747/2012) 12 kap. 3 § 3 mom. och 15 kap. 2 § 2 mom. 6 punkten, av dem 15 kap. 2 § 2 mom. 6 punkten sådan den lyder i lag 1201/2014, som följer: 
12 kap. 
Sekretess och kundkontroll 
3 § 
Kundkontroll 
Bestämmelser om kundkontroll finns dessutom i lagen om förhindrande av penningtvätt och av finansiering av terrorism ( /  )
15 kap. 
Administrativa påföljder 
2 § 
Påföljdsavgift 
Bestämmelser och beslut som avses i 40 § 1 mom. i lagen om Finansinspektionen är, utöver de som anges i 1 mom., dessutom 
6) bestämmelserna om kundkontroll och identifiering i 3 kap. 1 och 2 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism, om bevarande av uppgifter om kundkontroll i 3 kap. 3 § i den lagen samt om rapporteringsskyldighet i 4 kap. 1 § i den lagen. 
Denna lag träder i kraft den 20 . 
Utskottet föreslår att lagförslag 7 förkastas.
8. 
Lag 
om ändring av 45 och 144 § i lagen om placeringsfonder 
I enlighet med riksdagens beslut 
ändras i lagen om placeringsfonder (48/1999) 45 § 5 mom. och 144 § 3 mom., 
sådana de lyder, 45 § 5 mom. i lag 1490/2011 och 144 § 3 mom. i lag 507/2008, som följer: 
45 § 
Bestämmelserna i 4 mom. tillämpas inte om något annat följer av 144 § eller av lagen om förhindrande av penningtvätt och av finansiering av terrorism ( / ). 
144 § 
Bestämmelser om kundkontroll finns dessutom i lagen om förhindrande av penningtvätt och av finansiering av terrorism. 
Denna lag träder i kraft den 20 . 
9. 
Lag 
om ändring av 7 och 24 § i lagen om betalningsinstitut 
I enlighet med riksdagens beslut 
ändras i lagen om betalningsinstitut (297/2010) 7 § 4 mom. och 24 § 4 mom., 
av dem 7 § 4 mom. sådant det lyder i lag 899/2011, som följer: 
7 § 
Undantag från tillståndsplikten för tillhandahållande av andra betaltjänster än utgivning av elektroniska pengar 
Betaltjänster får inte tillhandahållas i enlighet med denna paragraf om en fysisk person som deltar i eller ansvarar för tillhandahållandet av tjänsterna inte är tillförlitlig på det sätt som avses i 13 a § eller om betaltjänstleverantören inte uppfyller de krav som ställs i lagen om förhindrande av penningtvätt och av finansiering av terrorism ( / ). 
24 § 
Ombud 
Betalningsinstitutet ska underrätta Finansinspektionen om de interna kontrollmetoder med vilka ombudet uppfyller sina skyldigheter enligt lagen om förhindrande av penningtvätt och av finansiering av terrorism och de skyldigheter som föreskrivs med stöd av den. 
Denna lag träder i kraft den 20 . 
10. 
Lag 
om ändring av 22 och 12 kap. i lagen om förvaltare av alternativa investeringsfonder 
I enlighet med riksdagens beslut 
upphävs i lagen om förvaltare av alternativa investeringsfonder (162/2014) 22 kap. 7 § och 
ändras 12 kap. 8 § 3 mom. som följer: 
12 kap. 
Erbjudande av andelar 
8 § 
Kundkontroll 
AIF-förvaltaren ska utan dröjsmål göra en anmälan till centralen för utredning av penningtvätt om tvivelaktiga transaktioner eller misstanke om finansiering av terrorism så som föreskrivs i 4 kap. i lagen om förhindrande av penningtvätt och av finansiering av terrorism ( / ). 
Denna lag träder i kraft den 20 . 
11. 
Lag 
om ändring av 28 och 40 § i lagen om pantlåneinrättningar 
I enlighet med riksdagens beslut 
ändras i lagen om pantlåneinrättningar (1353/1992) 28 § 2 mom. och 40 § 2 mom., sådana de lyder, 28 § 2 mom. i lag 77/1998 och 40 § 2 mom. i lag 1430/2009, som följer: 
28 § 
På panter av betydande ekonomiskt värde tillämpas med avvikelse från 1 mom. lagen om förhindrande av penningtvätt och av finansiering av terrorism ( / ). 
40 § 
Om koncessionshavaren försummar sina skyldigheter enligt denna lag, lagen om förhindrande av penningtvätt och av finansiering av terrorism eller sin bolagsordning, kan regionförvaltningsverket uppmana koncessionshavaren att fullgöra sina skyldigheter inom en viss tid. 
Denna lag träder i kraft den 20 . 
12. 
Lag 
om ändring av 6 § i lagen om Enheten för utredning av grå ekonomi 
I enlighet med riksdagens beslut 
ändras i lagen om Enheten för utredning av grå ekonomi (1207/2010) 6 § 1 mom. 13 och 20 punkten, sådana de lyder, 6 § 1 mom. 13 punkten i lag 308/2016 och 6 § 1 mom. 20 punkten i lag 1413/2016, och 
fogas till 6 § 1 mom., sådant det lyder delvis ändrat i lagarna 858/2016, 1159/2016, 1413/2016 och 1419/2016, en ny 21 punkt som följer: 
6 § 
Syftet med fullgöranderapporter 
Fullgöranderapporter utarbetas till stöd för 
13) förhindrande och avslöjande av penningtvätt och av finansiering av terrorism i enlighet med lagen om förhindrande av penningtvätt och av finansiering av terrorism ( / ) samt bedömning av tillförlitlighet enligt 5 kap. 5 och 6 § i den lagen, samt förhindrande, avslöjande och utredning av penningtvätt och finansiering av terrorism samt förande till undersökning enligt 2 § 1 mom. 1 punkten i lagen om centralen för utredning av penningtvätt ( / ); 
20) möjligheten för upphandlande enheter att i upphandlingsförfaranden i enlighet med lagen om offentlig upphandling och koncession (1397/2016) och lagen om upphandling och koncession inom sektorerna vatten, energi, transporter och posttjänster (1398/2016) kontrollera huruvida de av prövning beroende grunder för uteslutning av anbudsgivare som avses i 81 § 1 mom. i den förstnämnda lagen föreligger, 
21) utredning av de uppgifter som avses i 5 a, 8 och 19 § i lagen om fastighetsförmedlingsrörelser och rörelser för förmedling av hyreslägenheter och hyreslokaler (1075/2000). 
Denna lag träder i kraft den 20 . 
13. 
Lag 
om upphävande av 209 t § 2 mom. i mervärdesskattelagen 
I enlighet med riksdagens beslut föreskrivs: 
1 § 
Genom denna lag upphävs i mervärdesskattelagen (1501/1993) 209 t § 2 mom., sådant det lyder i lag 773/2016
2 § 
Denna lag träder i kraft den 20 . 
14. 
Lag 
om ändring av 3 § i lagen om frysning av tillgångar i syfte att bekämpa terrorism 
I enlighet med riksdagens beslut 
ändras i lagen om frysning av tillgångar i syfte att bekämpa terrorism (325/2013) 3 § 2 mom. som följer: 
3 § 
Frysning av tillgångar 
En anhållningsberättigad polisman eller åklagare ska vid misstanke eller en dom som avses i 1 mom. 2 punkten göra en anmälan till centralen för utredning av penningtvätt enligt 2 § i lagen om centralen för utredning av penningtvätt ( / ) och som finns vid Centralkriminalpolisen. 
Denna lag träder i kraft den 20 . 
15. 
Lag 
om ändring av 7 kap. 15 § i konsumentskyddslagen 
I enlighet med riksdagens beslut 
ändras i konsumentskyddslagen (38/1978) 7 kap. 15 § 3 mom., sådant det lyder i lag 746/2010, som följer: 
7 kap. 
Konsumentkrediter 
15 § 
Kontroll av kreditsökandens identitet  
Bestämmelser om kundkontroll finns dessutom i lagen om förhindrande av penningtvätt och av finansiering av terrorism ( / ). 
Denna lag träder i kraft den 20 . 
16. 
Lag 
om ändring av 6 a och 16 § i lagen om försäkringsavtal 
I enlighet med riksdagens beslut 
ändras i lagen om försäkringsavtal (543/1994) 6 a § och 16 § 2 mom., sådana de lyder i lag 426/2010, som följer: 
6 a § 
Meddelande om avslagsgrund 
Om en konsument eller den som enligt 3 § 2 mom. kan jämställas med en konsument inte meddelas försäkring ska grunden för avslaget meddelas försäkringssökanden, om inte avslaget grundar sig på 4 kap. 5 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism ( / ). Grunden ska meddelas skriftligen. Den ska vara förenlig med lag och god försäkringssed. 
16 § 
Uppsägning av fortlöpande skadeförsäkring 
Försäkringsgivaren har rätt att säga upp en fortlöpande skadeförsäkring att upphöra i slutet av försäkringsperioden. För uppsägningen ska det finnas en grund som överensstämmer med god försäkringssed. Uppsägningsmeddelandet ska sändas till försäkringstagaren senast en månad före försäkringsperiodens utgång. I meddelandet ska uppsägningsgrunden anges, om inte uppsägningen grundar sig på 4 kap. 5 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism. Om uppsägningen inte görs på det sätt som anges i detta moment är uppsägningen ogiltig. 
Denna lag träder i kraft den 20 . 
17. 
Lag 
om ändring av 19 och 30 § i kreditupplysningslagen 
I enlighet med riksdagens beslut 
ändras i kreditupplysningslagen (527/2007) 19 § 2 mom. 7 punkten och 30 § 3 mom., 
sådana de lyder i lag 509/2008, som följer: 
19 § 
Allmänna förutsättningar för utlämnande och användning av personkreditupplysningar 
Utan hinder av vad som föreskrivs i 1 mom. får personkreditupplysningar lämnas ut och användas 
7) till ett kreditinstitut eller en försäkringsanstalt för att denna på begäran av en registrerad ska kunna upprätta ett intyg eller en rekommendation om den registrerades förmåga att sköta sina åtaganden samt för uppfyllande av förpliktelser i samband med förhindrande eller avslöjande av penningtvätt till dem som är rapporteringsskyldiga enligt lagen om förhindrande av penningtvätt och av finansiering av terrorism ( / ), 
30 § 
Rätt till insyn 
Det som i 2 mom. föreskrivs om rätt för en registrerad att få veta till vem personkreditupplysning om honom eller henne har lämnats ut ska dock inte tillämpas om uppgifterna har lämnats ut under de förutsättningar som anges i 19 § 2 mom. 7 punkten för att fullgöra skyldigheter enligt 3 kap. 4 § 3 mom. i lagen om förhindrande av penningtvätt och av finansiering av terrorism eller om uppgifter har lämnats ut till centralen för utredning av penningtvätt för att förhindra, avslöja eller utreda penningtvätt eller finansiering av terrorism. Dataombudsmannen kan granska att begränsningen av rätten att få uppgifter är lagenlig. 
Denna lag träder i kraft den 20 . 
18. 
Lag 
om ändring av 14 a och 64 § i lotterilagen 
I enlighet med riksdagens beslut 
upphävs i lotterilagen (1047/2001) 64 § 2 mom., sådant det lyder i lag 1286/2016, och 
ändras 14 a § 3 mom., sådant det lyder i lag 1286/2016, som följer: 
14 a § 
Åldergränsen för penningspel 
Bestämmelser om de åtgärder för kundkontroll som hänför sig till förhindrande och avslöjande av penningtvätt och av finansiering av terrorism finns i lagen om förhindrande av penningtvätt och av finansiering av terrorism ( / ). 
Denna lag träder i kraft den 20 . 
19. 
Lag 
om ändring av 6 kap. 13 § i försäkringsbolagslagen 
I enlighet med riksdagens beslut 
ändras i försäkringsbolagslagen (521/2008) 6 kap. 13 § 3 mom., sådant det lyder i lag 981/2013, som följer: 
6 kap. 
Försäkringsbolagets ledning och företagsstyrningssystem 
13 § 
Kundkontroll 
Bestämmelser om kundkontroll finns dessutom i lagen om förhindrande av penningtvätt och av finansiering av terrorism ( / ). 
Denna lag träder i kraft den 20 . 
20. 
Lag 
om ändring av 48 och 52 § i föreningslagen 
I enlighet med riksdagens beslut 
ändras i föreningslagen (503/1989) 47 § 2 mom., 48 § 1 och 2 mom. och 52 § 1 mom., sådana de lyder, 47 § 2 mom. i lag 685/1999, 48 § 1 mom. i lag 1098/2014 samt 48 § 2 mom. och 52 § 1 mom. i lag 497/2016, 
fogastill 47 §, sådan den lyder delvis ändrad i lag 685/1999 och 1098/2014, ett nytt 3 mom. som följer: 
47 § (Ny) 
Myndigheter 
Föreningsregistret jämte därtill hörande handlingar är offentligt. Var och en har rätt att få uppgifter, utdrag och intyg från föreningsregistret och de därtill hörande handlingarna. Trots vad som föreskrivs i 16 § 3 mom. i lagen om offentlighet i myndigheternas verksamhet (621/1999) får Patent- och registerstyrelsen lämna ut uppgifter om fysiska personers namn, födelsetid, medborgarskap och hemkommun i form av utskrifter, genom teknisk anslutning eller på något annat sätt i elektronisk form eller göra dem allmänt tillgängliga i ett elektroniskt datanät. 
Uppgifter om personbeteckningens slutled och en utomlands bosatt fysisk persons hemadress lämnas ut ur föreningsregistret endast om utlämnandet uppfyller kraven i 16 § 3 mom. i lagen om offentlighet i myndigheternas verksamhet. I övriga fall lämnas i stället för uppgift om en utomlands bosatt fysisk persons hemadress ut uppgift om personens bosättningsland. En förutsättning för att i föreningsregistret införda uppgifter om personbeteckningens slutled och om en utomlands bosatt fysisk persons hemadress ska lämnas ut ur registret är att den som begär uppgifterna ger Patent- och registerstyrelsen en utredning om att uppgifterna skyddas på ändamålsenligt sätt. (Nytt 3 mom.) 
48 § 
Grundanmälan 
Anmälan om registrering av en förening (grundanmälan) ska på det sätt som föreskrivs i 10 § i företags- och organisationsdatalagen (244/2001) göras på en blankett för etableringsanmälan som har fastställts för detta ändamål. 
I grundanmälan, till vilken stiftelseurkunden och föreningens stadgar ska fogas, ska anges fullständigt namn, adress, hemkommun och personbeteckning, hemkommun och medborgarskap i fråga om föreningens styrelseordförande och namntecknare samt sådana eventuella begränsningar av namnteckningsrätten som avses i 36 § 3 mom. Om en person saknar finländsk personbeteckning anges födelsetiden. I fråga om utomlands bosatta personer anges hemadress i stället för hemkommun. Också alla andra styrelsemedlemmar får uppges i grundanmälan. (Nytt) 
52 § 
Ändringsanmälningar 
En anmälan (ändringsanmälan) ska enligt 11 § i företags- och organisationsdatalagen göras till registret när en förenings stadgar har ändrats samt när styrelseordföranden, någon annan i registret antecknad styrelsemedlem eller en namntecknare har bytts ut. Vid stadgeändring ska de ändrade stadgarna fogas till anmälan. På upprättande och undertecknande av anmälan ska i övrigt tillämpas vad som i 48 § föreskrivs om upprättande och undertecknande av grundanmälan. Ändringsanmälan får undertecknas också av en person som är bemyndigad av den som är ansvarig för att anmälningarna görs. Dessutom får den som har avgått från sin i föreningsregistret antecknade post eller vars i registret antecknade uppdrag har upphört själv göra anmälan om detta. 
Bestämmelser om ikraftträdandet av denna lag utfärdas genom förordning av statsrådet. 
Om en anmälan till registret har blivit anhängig innan denna lag har trätt i kraft, tillämpas de bestämmelser som gällde vid ikraftträdandet. (Nytt 2 mom.) 
Om en begäran om utlämnande av uppgifter görs efter att denna lag har trätt i kraft och de uppgifter som ska lämnas ut finns i elektronisk form i registret ska dock 47 § 3 mom. tillämpas. (Nytt 3 mom.) 
Vad som föreskrivs i 3 mom ska tillämpas också på utlämnande av uppgift om hemadress för en i Finland bosatt fysisk person. (Nytt 4 mom.) 
21. 
Lag 
om ändring av religionsfrihetslagen 
I enlighet med riksdagens beslut 
ändras i religionsfrihetslagen (453/2003) 18 § 1 mom., 19 § 1 mom. och 20 § 1 mom., av dem 20 § 1 mom. sådant det lyder i lag 499/2016, som följer:  
18 § 
Anmälan om bildande av ett samfund 
Anmälan om registrering av ett religionssamfund ska göras på en för detta ändamål fastställd blankett så som föreskrivs i 10 § i företags- och organisationsdatalagen (244/2001).  
19 § 
Anmälan om bildande av ett lokalsamfund 
Anmälan om registrering av ett lokalsamfund ska göras på en för ändamålet fastställd blankett så som föreskrivs i 10 § i företags- och organisationsdatalagen. 
20 § 
Anmälan om ändring och upplösning 
En ändring av samfundsordningen för ett registrerat religionssamfund och av de lokala stadgarna för ett registrerat lokalsamfund samt byte av styrelseordförande, någon annan i registret antecknad styrelsemedlem och namntecknare för samfundet och det registrerade lokalsamfundet ska anmälas till registret (ändringsanmälan) så som föreskrivs i 11 § i företags- och organisationsdatalagen. 
Bestämmelser om ikraftträdandet av denna lag utfärdas genom förordning av statsrådet. 
22. 
Lag 
om ändring av företags- och organisationsdatalagen 
I enlighet med riksdagens beslut 
ändras i företags- och organisationsdatalagen (244/2001) 2 § 1 mom. 7 punkten, 10 § 2 mom. 3 punkten, 11 § 2 mom. och 16 § 1 mom., av dem 2 § 1 mom. sådant det lyder i lag 192/2014, och 
fogas till 4 § 2 mom., sådant det lyder delvis ändrat i lag 192/2014, en ny 9 a och en ny 9 b punkt, och till 10 §, sådan den lyder delvis ändrad i lag 192/2014, ett nytt 3 mom., varvid nuvarande 3 mom. blir 4 mom., till 14 § 1 mom., sådant det lyder delvis ändrat i lagarna 909/2006, 1419/2007 och 498/2016, en ny 7 a punkt samt till 19 § ett nytt 2 mom. varvid nuvarande 2 mom. blir 3 mom., som följer: 
2 § 
Definitioner 
I denna lag avses med 
7) stamregister handelsregistret, föreningsregistret, registret över religionssamfund och stiftelseregistret som förs av Patent- och registerstyrelsen samt arbetsgivarregistret, förskottsuppbördsregistret och registret över mervärdesskattskyldiga som förs av skatteförvaltningen, vilka samtliga anknyter till företags- och organisationsdatasystemet, 
4 § 
Uppgifter som skall lagras i företags- och organisationsdatasystemet 
I företags- och organisationsdatasystemet lagras i fråga om de registreringsskyldiga i tillämpliga delar också basuppgifter om 
9 a) anmälan till och införande i föreningsregistret, 
9 b) anmälan till och införande i registret över religionssamfund, 
10 § 
Etableringsanmälan 
I etableringsanmälan skall följande uppgifter och handlingar lämnas: 
3) i Patent- och registerstyrelsens del av blanketten sådana uppgifter som ska registreras i handelsregistret, föreningsregistret, registret över religionssamfund och stiftelseregistret och som inte har anmälts i grunddelen samt bilagor enligt verksamhetsform. 
Trots 1 mom. och 2 mom. 3 punkten ska uppgifter om sammanslutningars verkliga förmånstagare enligt 3 § 1 mom. 1 och 4—6 punkten i handelsregisterlagen, med undantag av bostadsaktiebolag och ömsesidiga fastighetsaktiebolag enligt lagen om bostadsaktiebolag, och om utländska trusters verkliga förmånstagare enligt 1 kap. 6 § i den lagen samt om aktiebolags och europabolags aktieägare anmälas elektroniskt på det sätt som föreskrivs i handelsregisterlagen
11 § 
Anmälan om ändring och nedläggning 
Uppgifter om en sammanslutnings verkliga förmånstagare enligt 3 § 1 mom. 1 och 4—6 punkten i handelsregisterlagen, med undantag av bostadsaktiebolag och ömsesidiga fastighetsaktiebolag enligt lagen om bostadsaktiebolag, samt om utländska trusters verkliga förmånstagare ska anmälas elektroniskt. När anmälan lämnas ska i övrigt iakttas bestämmelserna i 10 § 1 mom. om lämnande av etableringsanmälan. 
14 § 
Ansvaret för att anmälningarna görs 
Ansvariga för att en anmälan till registret görs är 
7 a) för ett religionssamfund de myndiga medlemmar i styrelsen som anmälts till registret över religionssamfund, 
16 § 
Utlämnande av uppgifter ur registret över företags- och organisationsnummer 
Var och en har rätt att få uppgifter, utdrag och intyg över anteckningarna i registret över företags- och organisationsnummer. Trots 16 § 3 mom. i lagen om offentlighet i myndigheternas verksamhet (621/1999) kan uppgifter ur registret över företags- och organisationsnummer lämnas ut genom teknisk anslutning eller på något annat sätt i elektronisk form. 
19 § 
Straffbestämmelser 
Vad som föreskrivs i 1 mom. ska tillämpas på anmälan om en sammanslutnings verkliga förmånstagare enligt 6 kap. 2 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism, på utländska trusters verkliga förmånstagare enligt 1 kap. 6 § i den lagen samt på uppgifter om aktieägare i aktiebolag och europabolag, endast om den person som ansvarar för registeranmälan faktiskt har haft möjlighet att göra en elektronisk anmälan. 
Denna lag träder i kraft den 20 . 
23. 
Lag 
om ändring av lagen om fastighetsförmedlingsrörelser och rörelser för förmedling av hyreslägenheter och hyreslokaler 
I enlighet med riksdagens beslut 
ändras i lagen om fastighetsförmedlingsrörelser och rörelser för förmedling av hyreslägenheter och hyreslokaler (1075/2000) 8 § 1 mom., 9 § 1 mom., 17 § 3 mom. och 19 § 1 mom., av dem 8 § 1 mom., 17 § 3 mom. och 19 § 1 mom. sådana de lyder i lag 1523/2009, och 
fogas till lagen en ny 5 a § som följer: 
5 a § 
Tillförlitlighet 
Den som gör en registeranmälan anses inte vara tillförlitlig i den mening som avses i 8 § 1 mom. 3 punkten, om 
1) han eller hon genom en lagakraftvunnen dom under de senaste fem åren före bedömningen har dömts till fängelsestraff eller under de senaste tre åren före bedömningen har dömts till bötesstraff för ett brott som kan anses visa att han eller hon är uppenbart olämplig att utöva förmedlingsverksamhet,  
2) han eller hon annars genom sin tidigare verksamhet har visat sig vara uppenbart olämplig för verksamhet som avses i 1 punkten. 
Utöver vad som föreskrivs i 1 mom. anses en i det momentet avsedd person som gör en registeranmälan inte tillförlitlig, om 
1) han eller hon under tre år före bedömningen upprepade gånger eller i betydande grad har försummat sina registrerings-, rapporterings- och betalningsåtaganden i anslutning till skatter, lagstadgade pensions-, olycksfalls- och arbetslöshetsförsäkringsavgifter samt avgifter som Tullen tar ut, eller 
2) han eller hon enligt utmätning eller någon annan utredning är oförmögen att svara för sina skulder. (Nytt 2 mom.) 
Om den som gör anmälan är en juridisk person, gäller kravet på tillförlitlighet verkställande direktören och dennes ställföreträdare, medlemmar och suppleanter i styrelsen, medlemmar och suppleanter i förvaltningsrådet och jämförbara organ, ansvariga bolagsmän och andra som hör till den högsta ledningen och även dem som direkt eller indirekt innehar mer än 25 procent av aktierna i ett aktiebolag eller av den rösträtt som aktierna medför eller motsvarande ägande- eller bestämmanderätt i en annan sammanslutning. (2 mom. i RP) 
Regionförvaltningsverket har trots sekretessbestämmelserna rätt att avgiftsfritt av myndigheter och aktörer som sköter offentliga uppdrag få uppgifter om hur den som gör en anmälan sköter sina registrerings-, rapporterings- och betalningsåtaganden i anslutning till skatter, lagstadgade pensions-, olycksfalls- och arbetslöshetsförsäkringsavgifter samt avgifter som Tullen tar ut samt sådana uppgifter om personens verksamhet, ekonomi och kopplingar som behövs för utredning av den tillförlitlighet som avses i denna paragraf eller för strykning ur registret enligt 19 §. (Nytt 4 mom.) 
Regionförvaltningsverket har rätt att få sådana uppgifter som motsvarar de uppgifter som avses i 4 mom. också om en sådan organisation som avses i 2 § i lagen om Enheten för utredning av grå ekonomi (1207/2010) och som anknyter till den som gjort en anmälan samt om en sådan person som avses i 3 mom. (Nytt 5 mom.) 
Uppgifter som avses ovan i denna paragraf får sökas med hjälp av en teknisk anslutning eller på något annat sätt i elektronisk form utan samtycke av den vars intresse skyddas genom sekretessbestämmelsen. (Nytt 6 mom.) 
8 § 
Förutsättningar för registrering 
Regionförvaltningsverket ska registrera den som gjort en registeranmälan som avses i 7 § 2 mom. som fastighetsförmedlingsrörelse eller rörelse för förmedling av hyreslägenheter och hyreslokaler, om 
1) anmälaren har rätt att utöva näring i Finland, 
2) anmälaren inte har försatts i konkurs och, när det är fråga om en fysisk person, har uppnått myndighetsåldern och inte har fått sin handlingsbehörighet begränsad, 
3) anmälaren är tillförlitlig, 
4) anmälaren har en ansvarsförsäkring vars försäkringsbelopp med beaktande av förmedlingsverksamhetens art och omfattning kan bedömas vara tillräckligt för att de skador som verksamheten eventuellt ger upphov till ska kunna ersättas och vilken till sina övriga villkor motsvarar sedvanlig försäkringspraxis i branschen, 
5) anmälaren har anmält en ansvarig föreståndare som uppfyller kraven i 5 § 2 och 3 mom. 
9 § 
Uppgifter som skall föras in i förmedlingsrörelseregistret 
I förmedlingsrörelseregistret antecknas 
1) en enskild näringsidkares fullständiga namn och personbeteckning eller, om sådan saknas, födelsetid samt firma, eventuell bifirma, företags- och organisationsnummer eller annan motsvarande beteckning och besöksadress till varje verksamhetsställe där förmedlingsverksamheten utövas, 
2) en juridisk persons firma, eventuella bifirma, företags- och organisationsnummer eller annan motsvarande beteckning och besöksadress till varje verksamhetsställe där förmedlingsverksamheten utövas, 
3) fullständigt namn och personbeteckning eller, om sådan saknas, födelsetid för de personer vars tillförlitlighet har kontrollerats i samband med handläggningen av registeranmälan, 
4) huruvida förmedlingsrörelsen är en fastighetsförmedlingsrörelse eller en rörelse för förmedling av hyreslägenheter och hyreslokaler, 
5) ansvariga föreståndarens fullständiga namn och personbeteckning eller, om sådan saknas, födelsetid, 
6) vem som meddelat ansvarsförsäkringen samt försäkringsbeloppet, 
7) registerbeteckningen och datum för registreringen, 
8) varningar samt sådana uppmaningar och förbud som har förstärkts med vite och som har meddelats förmedlingsrörelsen med stöd av 18 § 2 mom.; en sådan uppgift ska utplånas ur registret när tre år har förflutit från utgången av det år då tvångsmedlet i fråga påfördes, 
9) skälet till strykning ur registret samt tidpunkten då detta har skett. 
17 § (Ny) 
Tillsyn och tillsynsmyndighetens rätt att få uppgifter 
Regionförvaltningsverket har trots sekretessbestämmelserna rätt att ur det bötesregister som avses i 46 § i lagen om verkställighet av böter (672/2002) få de uppgifter som är nödvändiga för att en ansvarig föreståndares och en i 5 a § 3 mom. och 8 § 1 mom. 3 punkten avsedd persons tillförlitlighet ska kunna utredas eller för strykning ur registret enligt 19 §. Bestämmelser om rätten att få uppgifter ur straffregistret utfärdas särskilt. 
19 § 
Strykning ur registret 
Regionförvaltningsverket ska stryka en förmedlingsrörelse ur registret, om 
1) förmedlingsrörelsen har upphört med sin verksamhet, 
2) de förutsättningar för registrering som anges i 8 § 1 mom. 1–4 punkten inte längre uppfylls, 
3) förmedlingsrörelsen utövar förmedlingsverksamheten som bulvan för någon annan, 
4) förmedlingsrörelsen inte längre har en ansvarig föreståndare enligt 8 § 1 mom. 5 punkten och förmedlingsrörelsen inte inom den tidsfrist som regionförvaltningsverket har ställt i sin uppmaning har anmält en ny ansvarig föreståndare, eller om 
5) det i förmedlingsrörelsens eller dess ansvariga föreståndares verksamhet förekommer allvarliga eller upprepade försummelser och rörelsen redan tidigare har meddelats ett verksamhetsförbud för viss tid. 
Denna lag träder i kraft den 20 . 
En förmedlingsrörelse som vid denna lags ikraftträdande är införd i förmedlingsrörelseregistret ska inom ett år från lagens ikraftträdande till regionförvaltningsverket anmäla de uppgifter om tillförlitlighet enligt 5 a § som ska införas i förmedlingsrörelseregistret. I annat fall stryks rörelsen ur registret. 
24. 
Lag 
om ändring av 67 och 73 § i lagen om utsläppshandel 
I enlighet med riksdagens beslut 
ändras i lagen om utsläppshandel (311/2011) 73 § 1 mom. 7 punkten, och 
fogas till 67 §, sådan den lyder delvis ändrad i lag 533/2014, ett nytt 3 mom., varvid nuvarande 3 mom. blir 4 mom., som följer: 
67 § 
Insyns- och granskningsrätt 
Oberoende av sekretessbestämmelserna har utsläppshandelsmyndigheten rätt att av en kontoinnehavare och de kontoombud som avses i kommissionens registerförordning utan ogrundat dröjsmål få de uppgifter och utredningar som myndigheten begär och som behövs för skötseln av de uppgifter som anges i 7 kap. 1 § 2 mom. i lagen om förhindrande av penningtvätt och av finansiering av terrorism ( / ). 
73 § 
Utsläppshandelsförseelse 
Den som uppsåtligen eller av grov oaktsamhet 
7) försummar att visa upp de handlingar och registreringar som avses i 67 § 4 mom., 
ska, om inte strängare straff för gärningen föreskrivs någon annanstans i lag, för utsläppshandelsförseelse dömas till böter. 
Denna lag träder i kraft den 20 . 
25. 
Lag 
om ändring av 13 § i lagen om behandling av personuppgifter inom Tullen 
I enlighet med riksdagens beslut 
ändras i lagen om behandling av personuppgifter inom Tullen (639/2015) 13 § 1 mom., sådant det lyder i lag 1194/2016, som följer: 
13 § 
Tullens rätt att få uppgifter ur vissa register och informationssystem 
Utöver vad som föreskrivs någon annanstans i lag har Tullen trots sekretessbestämmelserna rätt att i enlighet med vad som avtalas om saken med den registeransvarige, ur vissa register och även genom teknisk anslutning eller som en datamängd få och i övrigt behandla sådan information som Tullen behöver för att utföra sina uppdrag och föra sina personregister, enligt följande: 
1) ur samfunds och sammanslutningars personregister och övriga register för tullbrottsbekämpning behövliga uppgifter om passagerare, fordons personal samt om fordon och varor som transporteras, 
2) ur Skatteförvaltningens datasystem och register sådana uppgifter jämte identifieringsuppgifter om den skattskyldige som behövs för beskattning, skattekontroll och indrivning samt för tullbrottsbekämpning samt de uppgifter som behövs för tillståndsprövning behövliga uppgifter om tillståndssökandens fullgörande av sin skattebetalningsskyldighet och betalningsarrangemang i anslutning till tillståndssökandens betalning av skatter samt, när det är ett villkor för beviljande av tillstånd ska beviljas, uppgifter om brott mot tullagstiftningen eller skattelagstiftningen, 
3) ur det fordonstrafikregister som avses i lagen om fordonstrafikregistret (541/2003) sådana uppgifter som behövs för tullövervakning, skattekontroll, beskattning och indrivning samt för tullbrottsbekämpning, 
4) ur Patent- och registerstyrelsens handelsregister sådana uppgifter om anmälningar och meddelanden som gäller näringsidkare och som behövs för tullövervakning, skattekontroll, beskattning och indrivning samt för tullbrottsbekämpning, samt för tullövervakning, skattekontroll och brottsbekämpning uppgifter ur handelsregistret om förmånstagare jämte identifieringsuppgifter om dem, 
5) ur polisens personregister sådana uppgifter som behövs för tullövervakning och skattekontroll samt för tullbrottsbekämpning och för Tullens övriga uppdrag i enlighet med de ändamål som uppgifterna har samlats in och registrerats för samt för andra ändamål än de som uppgifterna har samlats in och registrerats för när det gäller fall som avses i 16 § 1 mom., 
6) ur gränsbevakningsväsendets personregister sådana uppgifter som behövs för tullövervakning och skattekontroll samt för tullbrottsbekämpning och för Tullens övriga uppdrag i enlighet med de ändamål som uppgifterna har samlats in och registrerats för samt för andra ändamål än de som uppgifterna har samlats in och registrerats för när det gäller fall som avses i 16 § 1 mom., 
7) ur Brottspåföljdsmyndighetens personregister sådana uppgifter som behövs för tullbrottsbekämpning samt för andra ändamål än de som uppgifterna har samlats in och registrerats för när det gäller fall som avses i 16 § 1 mom., 
8) av dem som utövar inkvarteringsverksamhet och av polisen sådana uppgifter som avses i 6 § 1 mom. i lagen om inkvarterings- och förplägnadsverksamhet (308/2006) och som behövs för tullbrottsbekämpning, 
9) sådana uppgifter som avses i 13—17 § i lagen om befolkningsdatasystemet och Befolkningsregistercentralens certifikattjänster (661/2009) och som behövs för tullövervakning, skattekontroll, beskattning och indrivning samt för tullbrottsbekämpning, 
10) ur det bötesregister som avses i lagen om verkställighet av böter (672/2002) uppgifter om bötesstraff och verkställigheten av dem, ur det straffregister som avses i straffregisterlagen (770/1993) och för de ändamål som nämns i 4 och 4 a § i den lagen uppgifter om personer och juridiska personer och ur det register över avgöranden och meddelanden om avgöranden som avses i lagen om justitieförvaltningens riksomfattande informationssystem (372/2010) uppgifter om avgöranden i brottmål och om avgörandenas laga kraft samt ur det rikssystem för behandling av diarie- och ärendehanteringsuppgifter som avses i den lagen uppgifter om brottmål som är eller har varit anhängiga vid åklagarmyndigheter eller domstolar, 
11) av justitieförvaltningsmyndigheterna uppgifter om personer som är efterlysta av justitieförvaltningen,  
12) ur utrikesministeriets informationssystem uppgifter om dem som hör till personalen vid diplomatiska beskickningar och konsulat som representerar den utsändande staten i Finland och om dem som hör till personalen vid en internationell organisations organ i Finland eller något annat internationellt organ i samma ställning samt om dessa personers familjemedlemmar och om dem som är i privat tjänst hos dessa personer, för utförande av de uppdrag som föreskrivs för Tullen i utlänningslagen (301/2004) och för tullövervakning och skattekontroll samt för tullbrottsbekämpning, 
13) ur Migrationsverkets informationssystem uppgifter om ärenden som gäller resedokument, visum, vistelse, internationellt skydd, avlägsnande ur landet, inreseförbud och medborgarskap, för utförande av de uppdrag som föreskrivs för Tullen i utlänningslagen och för tullövervakning och skattekontroll samt för tullbrottsbekämpning, 
14) av ett teleföretag de uppgifter som avses i 10 kap. 6—8 § i tvångsmedelslagen och i 2 kap. 14 § 2 mom. och 3 kap. 4 och 5 § i lagen om brottsbekämpning inom Tullen som Tullen har rätt att få endast under de förutsättningar som föreskrivs i de nämnda lagarna och som behövs för tullbrottsbekämpning, 
15) ur det farkostregister som avses i lagen om farkostregistret (424/2014) och ur Ålands fritidsbåtsregister uppgifter om båtar samt om ägare och innehavare av båtar, som behövs för de uppdrag som Tullen sköter enligt lagen om sjöfartskydd på vissa fartyg och i hamnar som betjänar dem och om tillsyn över skyddet (485/2004), för påförande av påföljdsavgift för transportör enligt 179 § i utlänningslagen, för tullövervakning, skattekontroll, beskattning och indrivning samt för tullbrottsbekämpning, 
16) ur kommunikationsministeriets trafiktillståndsregister de uppgifter som behövs för påförande av påföljdsavgift för transportör enligt 179 § i utlänningslagen och för tullövervakning och skattekontroll samt för tullbrottsbekämpning, 
17) ur det fartygsregister, register över fartyg under byggnad och historikregister som avses i fartygsregisterlagen (512/1993) sådana uppgifter om fartyg samt om ägare och innehavare av fartyg som behövs för de uppdrag som Tullen sköter enligt lagen om sjöfartskydd på vissa fartyg och i hamnar som betjänar dem och om tillsyn över skyddet, för påförande av påföljdsavgift för transportör enligt 179 § i utlänningslagen, för tullövervakning, skattekontroll, beskattning och indrivning samt för tullbrottsbekämpning, 
18) ur det luftfartygsregister som avses i luftfartslagen (864/2014) sådana uppgifter om luftfartyg samt om innehavare och ägare av luftfartyg som behövs för påförande av påföljdsavgift för transportör enligt 179 § i utlänningslagen, för tullövervakning, skattekontroll, beskattning och indrivning samt för tullbrottsbekämpning, 
19) av trafik-, fiske- och miljömyndigheterna samt av polisen, gränsbevakningsväsendet och försvarsmakten uppgifter om fordon och deras position samt om trafik, för tullövervakning och skattekontroll samt för tullbrottsbekämpning, 
20) för lämnande av handräckning nödvändiga uppgifter av den myndighet som har begärt handräckning, 
21) ur regionförvaltningsverkets register för övervakning av penningtvätt de uppgifter om den registrerade jämte identifieringsuppgifter som behövs för tullövervakning och skattekontroll samt för tullbrottsbekämpning. 
Denna lag träder i kraft den 20 . 
26. 
Lag 
om ändring av 12 § i lagen om gräsrotsfinansiering 
I enlighet med riksdagens beslut 
ändras 12 § 1 mom. i lagen om gräsrotsfinansiering (734/2016) som följer: 
12 § 
Kundkontroll 
Bestämmelser om kundkontroll finns i lagen om förhindrande av penningtvätt och av finansiering av terrorism ( / ). 
Denna lag träder i kraft den 20 . 
27. 
Lag 
om ändring av 6 § i lagen om advokater 
I enlighet med riksdagens beslut 
ändras i lagen om advokater (496/1958) 6 § 1 mom., sådant det lyder i lag 697/2004, som följer: 
6 § 
Advokatföreningens styrelse ska se till att advokaterna när de uppträder inför domstol eller någon annan myndighet samt även i sin övriga verksamhet uppfyller sina förpliktelser. Advokatföreningens styrelse ska för regionförvaltningsverket göra framställning om ordningsavgift, offentlig varning och påföljdsavgift enligt 8 kap 10 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism ( / ). En advokat är skyldig att ge styrelsen de uppgifter som behövs för denna tillsyn. En advokat ska även tillåta en person som har förordnats av styrelsen att göra inspektioner i hans eller hennes byrå, om styrelsen finner att det är nödvändigt för tillsynen, och härvid visa de handlingar som ska granskas vid inspektionen. En styrelsemedlem och den som genomför en inspektion får inte obehörigen röja sekretessbelagda uppgifter som de har fått kännedom om i samband med tillsynen. 
Denna lag träder i kraft den 20 . 
Utskottets nya lagförslag
28. 
Lag 
om ändring av 1 § i lagen om verkställighet av böter 
I enlighet med riksdagens beslut 
ändras i lagen om verkställighet av böter (672/2002) 1 § 1 mom. 10 punkten, sådan den lyder i lag 451/2016, och 
fogas till 1 § 1 mom., sådant det lyder delvis ändrat i lagarna 462/2011, 348/2013, 257/2014, 671/2015 och 451/2016, en ny 11 punkt som följer: 
1 § 
Lagens tillämpningsområde 
I den ordning som föreskrivs i denna lag verkställs följande påföljder: 
10) beslut om ekonomiska administrativa sanktionsavgifter eller böter enligt 24 § 2 mom. 1 punkten i lagen om utstationering av arbetstagare (447/2016), 
11) ordningsavgift enligt 8 kap. 1 § i lagen om förhindrande av penningtvätt och av finansiering av terrorism (  /  ) och påföljdsavgift enligt 8 kap. 3 § i samma lag. 
Denna lag träder i kraft den 20 . 
29. 
Lag 
om ändring av 8 kap. 3 § i lagen om värdeandelssystemet och om clearingverksamhet 
I enlighet med riksdagens beslut 
ändras i lagen om värdeandelssystemet och om clearingverksamhet (  /  ) 8 kap 3 § 4 mom. som följer: 
3 § 
Kundkontroll 
Bestämmelser om kundkontroll finns dessutom i lagen om förhindrande av penningtvätt och av finansiering av terrorism (  /  )
Denna lag träder i kraft den 20 . 
Utskottets förslag till uttalande
Riksdagen förutsätter att regeringen i samband med genomförandet av ändringarna i det fjärde penningtvättsdirektivet bedömer om tröskeln för att registrera uppgifter om verkliga förmånstagare ligger på en nivå som, också med beaktande av syftet med dessa uppgifter, säkerställer att bestämmelserna inte lätt kan kringgås. 
Helsingfors 18.5.2017 
I den avgörande behandlingen deltog
ordförande
Juho
Eerola
saf
vice ordförande
Timo V.
Korhonen
cent
medlem
Mika
Kari
sd
medlem
Elsi
Katainen
cent
medlem
Antti
Kurvinen
cent
medlem
Sirpa
Paatero
sd
medlem
Olli-Poika
Parviainen
gröna
medlem
Juha
Pylväs
cent
medlem
Wille
Rydman
saml
medlem
Joona
Räsänen
sd
medlem
Vesa-Matti
Saarakkala
saf
medlem
Matti
Semi
vänst
medlem
Mari-Leena
Talvitie
saml
medlem
Kari
Tolvanen
saml.
Sekreterare var
utskottsråd
Minna-Liisa
Rinne.
RESERVATION
Motivering
Ett av målen med förslaget är att förbättra offentligheten när det gäller uppgifter om de verkliga förmånstagarna. Ekonomiutskottet fäste i sitt utlåtande uppmärksamhet vid att ”det behövs större insyn i företagens uppgifter om ägare och förmånstagare och att förmånstagartröskeln både i EU och nationellt bör formuleras så att den inte kan kringgås så lätt”. Transparens i fråga om företagens och sammanslutningarnas förmånstagare ökar öppenheten, förebygger svart ekonomi och stärker förtroendet mellan företagen. 
Regeringen föreslår att uppgifter om förmånstagare ska samlas in i förmånstagarregistret om de har ett aktieinnehav eller en rösträtt på över 25 procent. Enligt sakkunniga kan förmånstagartröskeln antagligen lätt kringgås, så tröskeln bör sänkas till ett innehav på exempelvis 10 procent, vilket också EU-kommissionen föreslog i juli 2016. Frågan behandlas fortfarande på EU-nivå.  
Enligt Förenta staternas lagstiftning (Foreign Account Tax Compliance Act; FATCA) anses som förmånstagare alla personer som direkt eller indirekt äger minst 10 procent av företaget eller sammanslutningen. Med hänsyn till att finländska aktörer inom bank- och finanssektorn måste följa FATCA:s krav om kundkännedom i fråga om kunder i Förenta staterna vore det för de rapporteringsskyldigas del enklare om det offentliga registret skulle omfatta alla verkliga förmånstagare som överskrider denna gräns. 
Under sakkunnigutfrågningen framkom det också att förmånstagarregistret bör vara tillförlitligt och lätt tillgängligt. Tillgängligheten skulle förbättras om man också kunde göra sökningar i registret på förmånstagarens namn. Vidare skulle det öka tillförlitligheten om det, i det fall att det inte finns uppgifter om den faktiska förmånstagaren, antecknas i registret att förmånstagaren inte är känd, i stället för att någon i företagsledningen antecknas i registret.  
Förslag
Vi föreslår
att riksdagen godkänner lagförslag 2—29 enligt förvaltningsutskottets betänkande och 
att riksdagen godkänner lagförslag 1 enligt förvaltningsutskottets betänkande, men 1 kap. 5 § med följande ändringar:  
5 § 
Verkliga förmånstagare i sammanslutningar 
Med en sammanslutnings verkliga förmånstagare avses en fysisk person som ytterst  
1) direkt eller indirekt äger mer än 10 procent av aktierna i den juridiska personen eller annars en motsvarande andel i den juridiska personen,  
2) direkt eller indirekt utnyttjar mer än 10 procent av rösträtten i den juridiska personen och detta röstetal är baserat på ägande, medlemskap, bolagsordningen, bolagsavtalet eller på motsvarande stadgar, eller som  
3) på annat sätt faktiskt utövar ett bestämmande inflytande i den juridiska personen.  
En indikation på direkt ägande är att den fysiska personen äger mer än 10 procent i den juridiska person som gransknas.  
En indikation på indirekt ägande är att  
1) en juridisk person i vilken en eller flera fysiska personer utövar självständig beslutanderätt äger mer än 10 procent eller innehar mer än 10 procent av rösträtten i den juridiska person som gransknas, eller att  
2) en fysisk eller juridisk person, i vilken en fysisk person utövar självständig beslutanderätt, på grund av ägande, medlemskap, bolagsordningen, bolagsavtalet eller motsvarande stadgar har rätt att utse eller entlediga en majoritet av ledamöterna i styrelsen för eller i ett jämförbart organ i den juridiska person som gransknas.  
Om en verklig förmånstagare inte kan identifieras eller om de förutsättningar som anges i 1 mom. inte uppfylls ska som verklig förmånstagare betraktas styrelsen för eller ansvariga bolagsmän, verkställande direktör eller en person i motsvarande ställning i den juridiska person som gransknas. 
Helsingfors 18.5.2017
Sirpa
Paatero
sd
Mika
Kari
sd
Joona
Räsänen
sd
Matti
Semi
vänst
Olli-Poika
Parviainen
gröna
Senast publicerat 14.6.2019 14:18