Regeringens proposition
RP
45
2018 rd
Regeringens proposition till riksdagen med förslag till lag om ändring av landsvägslagen och till vissa lagar som har samband med den
PROPOSITIONENS HUVUDSAKLIGA INNEHÅLL
I denna proposition föreslås det att landsvägslagen samt vissa andra lagar inom trafik ändras. Propositionen anknyter till regeringspropositionen till riksdagen med förslag till lagstiftning om inrättande av landskap och om en reform av ordnandet av social- och hälsovården. Genom de föreslagna lagarna verkställs överföringen från staten till landskapen av de uppgifter inom trafik som avses i landskapslagen. Närings-, trafik- och miljöcentralerna upphör med sin verksamhet i slutet av 2019 och landskapen tar över vid ingången av 2020. Huvuddelen av närings-, trafik- och miljöcentralernas uppgifter inom ansvarsområdena inom trafiken överförs till landskapen. I de andra lagar som ingår i propositionen genomförs de överföringar av behörigheter som propositionen föranleder, särskilt när det gäller väghållningen, trafiksystemplaneringen och ordnandet av den offentliga persontrafiken. Genom de föreslagna lagarna överförs också vissa uppgifter till Trafikverket och dessutom preciseras Trafiksäkerhetsverkets uppgifter. Ansvaret för att ordna de tjänster och uppgifter som ingår i propositionen överförs till landskapen vid ingången av 2020. Även de föreslagna organisationsändringar inom statsförvaltningen som gäller inrättandet av Statens tillstånds- och tillsynsmyndighet genomförs i början av 2020. 
I fortsättningen ska landskapen sköta uppgifter inom väghållning i högst nio väghållningsområden i enlighet med avtal med staten. Väghållare är fortsättningsvis Trafikverket som även svarar för de uppgifter som hör till ägaren av landsvägsnätet. Finansieringen av de uppgifter som ska skötas av landskapen ordnas genom särskilde finansiering.  
Landsvägslagens rubrik föreslås bli ändrad till lagen om trafiksystem och landsvägar och tillämpningsområdet utvidgas på motsvarande sätt. Det föreslås att lagen ska innehålla nya bestämmelser om trafiksystemplaneringen på riks- och landskapsnivå och bestämmelser om den servicenivå som baserar sig på klassificeringen av landsvägar.  
Formen på beslutsfattandet om klassificeringen av landsvägar förtydligas. Till landskapslagen fogas bestämmelser om servicenivån på resor och transporter samt om nivån på underhållet. Kraven och målen för landsvägar och trafiksystem kompletteras. I lagen tas in nya bestämmelser om beredskap och om ett säkerhetsstyrningssystem för landsvägars väghållning. Trafiksäkerhetsverket blir tillsynsmyndighet. 
Den föreslagna lagen innehåller bestämmelser omsådana projektbedömningar inom planeringen av landsvägar som motsvarar gällande praxis samt om de planeringsgrunder som ska tillämpas vid utrednings- och vägplanering.  
Propositionens syfte är också att öka nyttjandet av den information som gäller landsvägar och trafiksystemet, vilket främjar utvecklandet av nya digitala tjänster och automatiseringen av trafiken.  
Propositionen stöder regeringsprogrammets spetsprojekt för smidigare lagstiftning. Kraven på tillstånd för kortvarig förvaring av trävaror och för postlådor på vägområden luckras upp. 
Lagarna avses träda i kraft den 1 januari 2020. Vissa ändringar av landsvägslagen och banlagen avses dock träda i kraft så snart som möjligt. 
ALLMÄN MOTIVERING
1
Inledning
I denna regeringsproposition anges de uppgifter med anknytning till väghållning och trafiksystemplanering som ska överföras från staten till de nya landskapen och hur uppgiftsöverföringarna ska verkställas. De uppgifter som föreslås bli överförda till landskapen grundar sig på landskapens i 6 § i landskapslagen ( / ) föreskrivna uppgiftsområde, i överensstämmelse med vilket överföringarna genomförs. Enligt 6 § 1 mom. 14 punkten i landskapslagen ska till landskapens uppgifter höra trafiksystemets funktion, trafiksäkerheten, väg- och trafikförhållandena, den regionala väghållningen, samarbetet inom markanvändningen och produktionen av data om verksamhetsmiljön för användning i den nationella trafiksystemplaneringen. 
I propositionen ingår dessutom de uppgiftsöverföringar som gäller i 6 § 1 mom. 15 punkten i landskapslagen avsedda uppgifter i samband med statsunderstöd för mobilitetsstyrning och i 6 § 2 mom. 1 punkten avsedda uppgifter som hänför sig till offentlig persontrafik. Denna uppgiftshelhet gäller den offentliga persontrafiken (väg-, järnvägs- och flygtrafik samt Kvarkentrafiken). 
De största behoven av att ändra landsvägslagen anknyter till de myndigheter som svarar för väghållningen samt utvecklande, byggande och underhåll av landsvägsnätet, fastställande av trafiksystemplaneringen och servicenivån, styrning av väghållningen och planering av landsvägarna. 
2
Nuläge
2.1
Lagstiftning och praxis
Lagstiftning och myndigheter på väghållningens område 
Landsvägslagen (503/2005), som trädde i kraft vid ingången av 2006, innehåller bestämmelser om landsvägar och väghållning. Landsvägarna upprätthålls av staten. Genom landsvägslagen upphävdes lagen om allmänna vägar (243/1954). När landsvägslagen stiftades föreskrevs i den att de allmänna vägarna är landsvägar som har staten som väghållare. Till det samlade vägnätet hör utöver landsvägar även gator och enskilda vägar. För underhållet av gator som fastställs i detaljplaner enligt markanvändnings- och bygglagen svarar kommunen. Längdmässigt utgör de enskilda vägarna den största kategorin av vägtrafikleder. För byggandet och underhållet av dem svarar delägarna i de enskilda vägarna, det vill säga de som använder vägen. 
Fram till slutet av 2009 svarade Vägförvaltningen för landsvägsnätet (cirka 78 000 kilometer). Vägförvaltningens organisation utgjordes av en centralförvaltning, nio vägdistrikt och en enhet för stora projekt. Genom en lag om ändring av landsvägslagen (1242/2009) ändrades lagen till följd av en ämbetsverksreform inom den statliga regionförvaltningen och trafikförvaltningen. I samband med reformen av trafik- och regionförvaltningen överfördes Vägförvaltningens vägdistrikt den 1 januari 2010 till närings-, trafik- och miljöcentralerna (NTM-centralerna), och Banförvaltningscentralen, en del av Sjöfartsverket och Vägförvaltningens centralförvaltning bildade Trafikverket. 
Genom en annan lag om ändring av landsvägslagen (446/2012) utökades lagen med bestämmelser genom vilka Europaparlamentets och rådets direktiv 2008/96/EG om förvaltning av vägars säkerhet sattes i kraft. Genom lagen om ändring av 5 och 42 § i landsvägslagen (328/2013) gjorde man det lättare att på vägområden placera sådana konstruktioner, anläggningar och anordningar som är nödvändiga med tanke på ett fungerande samhälle. Genom den senaste ändringen av landsvägslagen (566/2016) förenhetligades bestämmelser och formuleringar i landsvägslagen och banlagen, och det blev möjligt att i större utsträckning än dittills använda också annan finansiering än budgetfinansiering för att genomföra vägprojekt. Det blev också möjligt för väghållaren att av särskilda skäl delta i annan finansiering än sådan som riktas till landsvägsnätet. Dessutom infördes bland annat ett anmälningsförfarande i fråga om placeringen av el- och telekablar på vägområde samt uppsättandet av reklamaffischer och annonser invid landsvägar. 
Enligt 10 § i landsvägslagen är staten väghållare som svarar för väghållningen och kostnaderna för den samt utövar de rättigheter som har grundats för väghållningen. Trafikverket är ansvarig myndighet i dessa frågor, med uppgift att upprätthålla och utveckla de statsägda landsvägarna. Trafikverket svarar för landsvägsnätet och kostnaderna för det samt utövar de rättigheter som har grundats för väghållningen. Vägnätet ingår i Trafikverkets balansräkning och utgör statlig egendom som Trafikverket förvaltar. Enligt en definition i landsvägslagen omfattar väghållningen planering, byggande och underhåll av landsvägar samt trafikförvaltning. 
Enligt 11 § i lagen är Trafikverket väghållningsmyndighet i särskilt föreskrivna fall och NTM-centralerna i övriga fall. Det finns 15 NTM-centraler och nio av dem sköter trafikuppgifter. På sina verksamhetsområden svarar NTM-centralerna för följande uppgiftshelheter inom väghållning och trafik: trafiksystemplanering (kundbehov, markanvändningssamarbete när det gäller reservering av områden för vägnätet, preliminära utredningar, väg- och trafikförhållanden, trafikstyrning, trafikledning och trafiksäkerhet), programmering av väghållningen (resultatstyrning, ekonomisk styrning och planering, vissa väghållningsplaner), projektplanering och planering av underhåll. Till NTM-centralerna hör dessutom uppgifter med anknytning till upphandling av landsvägsunderhåll och av projektrelaterat byggande i samband med bastrafikledshållning samt uppgifter med anknytning till verksamheten under avtalsperioden (dessa sköts centralt vid fyra NTM-centraler). 
Enligt lagen om Trafikverket svarar Trafikverket för styrningen av verksamheten vid närings-, trafik- och miljöcentralerna inom sitt verksamhetsområde och för samordningen av väghållningen vid nämnda centraler. NTM-centralernas ansvarsområde för trafik och infrastruktur (nedan NTM-centralernas ansvarsområde för trafik) har i egenskap av väghållningsmyndighet skött den operativa väghållningen. När det gäller markanskaffning för vägar och banor har Trafikverket genom ett särskilt beslut gett NTM-centralerna rätt att disponera anslag som är avsedda för bastrafikledshållning och markförvärv. Trafikverket sköter också rikstäckande uppgifter som rör väghållning, såsom styrning av vägtrafiken, trafik- och vägnätsmätningar och anknytande register, upphandling och beställning av stora utvecklingsprojekt samt det rikstäckande planeringsprogrammet för vägprojekt. Det rikstäckande planeringsprogrammet utarbetas i samarbete med NTM-centralerna, men Trafikverket svarar för och beslutar om det. 
Vid Trafikverket sköts numera som riksomfattande väghållningsuppgifter också meddelande av anvisningar om upphandlingsförfaranden, forsknings- och utvecklingsverksamhet samt upprätthållande av tekniska väghållningsanvisningar. 
I landsvägslagen finns det för närvarande inga bestämmelser om tillsyn över väghållningen. Som det nu är har tillsynen skötts utgående från Trafikverkets egna riktlinjer och via skrivningar i entreprenadavtal.  
Inget lagstadgat krav på ett säkerhetsstyrningssystem existerar för närvarande i fråga om väghållningen på landsvägar eller vägtrafiken i stort. Inom övriga trafikformer har säkerhetsstyrningssystem tillämpats redan i flera år. Också för vägtrafikens vidkommande färdigställdes mot slutet av 2012 den internationella standarden ISO/DIS 39001 (Road traffic safety management systems – Requirements with guidance for use), där kraven på ett säkerhetsstyrningssystem för vägtrafiken definieras för att organisationer som växelverkar med vägtrafiken ska kunna minska antalet omkomna och allvarligt skadade i trafikolyckor. 
Trafiksäkerhetsverket har i landsvägslagen ålagts vissa uppgifter med anknytning till landsvägsfärjor och förvaltning av vägtrafiksäkerheten. 
Landsvägsnätets skick samt finansiering och ordnande av väghållning 
Vägnätet i Finland omfattar totalt cirka 454 000 kilometer. Av detta utgör de enskilda vägarna och skogsbilvägarna cirka 350 000 kilometer och kommunernas gatunät 26 000 kilometer. Landsvägarna som Trafikverket svarar för har en total längd på cirka 78 000 kilometer. Riks- och stamvägarna, det vill säga huvudvägarna, omfattar drygt 13 000 kilometer, av vilket 900 kilometer är motorvägar. Merparten av vägarna, 64 900 kilometer, består av regionala vägar och förbindelsevägar. Trafiken på denna del av vägnätet utgör cirka en tredjedel av trafikarbetet. Det finns något över 5 000 kilometer gång- och cykelvägar. Cirka 65 % av vägarna, det vill säga totalt cirka 50 000 kilometer, är belagda. Cirka 41 000 kilometer av vägarna i det lågtrafikerade vägnätet, alltså mer än hälften av hela landsvägsnätet, hör till den lägsta underhållsklassen. 
Kundnöjdhetsenkäter visar att de som använder landsvägsnätet i regel är nöjda med hur resorna och transporterna fungerar. Landsvägsnätets allt sämre skick och den låga finansieringsnivån visar sig emellertid i att kunderna inte är lika nöjda som tidigare med vägarnas skick och vinterunderhåll. 
Det finländska trafiknätets reparationsskuld bedöms vara cirka 2,54 miljarder euro (läget 1/2017). Med reparationsskuld avses det penningbelopp som skulle behövas för att sätta trafiklederna i ett gott skick som tillgodoser dagens behov. Anslagen har varit alltför låga under en längre tid, vilket lett till en växande reparationsskuld och allvarlig försämring av trafiknätets skick. Trafikledernas reparationsskuld, det vill säga dåliga skick, ökar samtidigt kostnaderna såväl för dem som använder trafiklederna som för trafikledshållningen. Av den nuvarande reparationsskulden hänför sig cirka 1,3 miljarder euro till landsvägar, cirka 1,1 miljarder euro till järnvägar och cirka 40 miljoner euro till vattenleder. För upprätthållande (reparationer) av statens trafikleder anslås årligen cirka 360 miljoner euro. Om man behåller samma genomsnittliga årliga nivå på finansieringen av bastrafikledshållningen (965 miljoner euro) som under de senaste regeringsperioderna kommer reparationsskulden att öka med cirka 100 miljoner euro per år. Regeringen har därför satsat stort på finansiering av bastrafikledshållningen för att hejda ökningen av trafikledernas reparationsskuld och rentav minska den. I enlighet med regeringsprogrammet har för 2016–2018 anvisats 600 miljoner euro för att stoppa ökningen av reparationsskulden och få reparationsskulden att minska. Under 2017–2019 överförs dessutom sammanlagt 364 miljoner euro från anslaget för icke specificerade investeringar till bastrafikledshållning och statsunderstöd för enskilda vägar. 
Basväghållningen finansieras i sin helhet med anslag under moment 31.10.20 (Bastrafikledshållning). Finansieringen (utan tilläggsbudgetar och fristående temaprojekt) har varierat mellan 500 och 550 miljoner euro de senaste åren (547 miljoner euro 2017). Väghållningen indelas i dagligt underhåll (215 miljoner euro 2017), upprätthållande (217 miljoner euro 2017), förbättringar (45 miljoner euro 2017) och trafiktjänster (70 miljoner euro 2017). Den finansiering som anvisas för dagligt underhåll (skötsel) fördelas mellan NTM-centralerna enligt utfallet av anbudsförfarandet för skötseln. Vid Trafikverket fördelas den övriga finansieringen på olika väghållningsprodukter med stöd av expertsystem och utifrån registeruppgifter. Genom dagligt underhåll, det vill säga skötsel, säkrar man trafiknätets dagliga framkomlighet och förhindrar förtida skador på vägar och vägdelar. Med upprätthållande avses att skador på vägnätet och vägkonstruktioner orsakade av slitage och åldrande repareras samt att gamla vägkonstruktioner förnyas så att de överensstämmer med nutida krav. Med förbättringar och anknytande planering avses att vägnätets servicenivå förbättras genom små investeringar. Genom finansiering inriktad på trafiktjänster tillhandahålls aktuell trafikstyrning och trafikinformation samt landsvägsfärjetjänster. Enligt en grov uppskattning går 35 % av anslaget för underhåll till det centrala nationella nätet och 65 % till det övriga vägnätet. Cirka 60 % av finansieringen för bastrafikledshållning är knuten till indexbundna avtal som sträcker sig över mer än ett år. 
Enligt huvudregeln är det gratis att använda landsvägarna. Ett undantag från detta utgör bemyndigandet att genom förordning av kommunikationsministeriet utfärda bestämmelser om avgifter för användning av landsvägsfärjor, men för tillfället har ingen förordning om färjeavgifter utfärdats. 
Hur väghållningsfinansieringen ska användas styrs genom statsbudgeten och genom resultatavtal mellan Trafikverket och kommunikationsministeriet. Inom väghållningen prioriteras åtgärder som krävs för den dagliga trafiken och, när det gäller inriktandet av den särskilda finansiering som under 2017–2019 anslagits för att minska reparationsskulden, åtgärder som stoppar ökningen av reparationsskulden och minskar skulden med beaktande av kundernas och i synnerhet näringslivets behov, trafiksäkerheten och de möjligheter som digitaliseringen medför. 
Ansvaret för programmering av underhållet (skötsel och upprätthållande) och för förbättring av vägarna har de nio NTM-centralerna med ett ansvarsområde för trafik. Med programmering avses val av objekt samt tidsplaner knutna till tillgänglig finansiering. 
Riktlinjerna för verksamheten och resultatmålen styr planeringen och genomförandet av trafikledshållningen. I riktlinjerna anges kriterierna för när åtgärder som innebär upprätthållande bör vidtas. För exempelvis nybeläggning av vägar anges kriterier som gäller slitspårens djup, ojämnheter och skador i vägytan. Kriterierna är desto strängare ju mer trafikerad vägen är. 
Riktlinjerna för verksamheten tillämpas enligt tillgänglig finansiering och väghållningsstrategi. En knapp finansiering leder till en längre åtgärdscykel, enklare åtgärder och lägre krav på vägarnas skick. Programmeringen av åtgärderna påverkas av kundernas behov och lokala förhållanden. 
Väghållningen har effektiviserats genom att uppgifterna centraliserats och upphandlingsförfarandet utvecklats. Senare har effektiviseringen fortsatt vid NTM-centralerna, framför allt genom att upphandlingar och funktioner koncentrerats. Ambitionen har varit att trygga tillräckliga resurser så att skötseln av uppgifterna kan hålla en hög standard. När NTM-centralerna inledde sin verksamhet 2010 omfattade väghållningsuppgifterna cirka 520 årsverken, i början av 2016 bara cirka 395 årsverken. Sammanfattningsvis kan det konstateras att omkring hälften (50 %) av uppgifterna och personalen vid NTM-centralernas ansvarsområden för trafik har koncentrerats till antingen en eller flera NTM-centraler. 
Sedan början av 2016 har väghållningen, det vill säga upphandlingen av underhåll och investeringar, skötts centralt på fyra områden: Södra (ansvarig: NTM-centralen i Sydöstra Finland), Västra (ansvarig: NTM-centralen i Egentliga Finland), Östra (ansvarig: NMT-centralen i Mellersta Finland) och Norra (ansvarig: NTM-centralen i Lappland). Personalen inom den centraliserade upphandlingen uppgår till cirka 105 årsverken. På riksnivå har också följande uppgifter centraliserats: väghållningstillstånd (NTM-centralen i Birkaland), trafikens kundservice (NTM-centralen i Birkaland), landsvägsfärje- och förbindelsefartygstrafiken i skärgården (NTM-centralen i Egentliga Finland,), skadeersättningar och fordonsförflyttningar (NTM-centralen i Lappland) och trafiktelematik (NTM-centralen i Sydöstra Finland). Dessa uppgifter omfattar 73 årsverken. 
Det dagliga underhållet av landsvägarna sköts genom 80 områdesentreprenader. Entreprenaderna konkurrensutsätts och sträcker sig i regel över fem år. Enhetligheten i entreprenadernas innehåll styrs med hjälp av riksomfattande riktlinjer för verksamheten och dokumentmallar. Trafikverket tilldelar områdena största delen av finansieringen för dagligt underhåll på basis av priserna i entreprenadavtalen. 
Sedan 2005 har alla arbeten som avser upprätthållande skötts i form av konkurrensutsatta entreprenader. Av beställaren projekterade beläggningsarbeten och broreparationer sköts genom totalentreprenader (med totalentreprenader avses projekt som grundar sig på beställarens projektering). Reparationsentreprenaderna är vanligen ettåriga. Underentreprenadskedjor begränsas numera inte i lag, men begränsningar anges i praktiken i avtalen. För att nämna ett exempel används vid broreparationer ofta underentreprenörer för uppgifter som kräver specialkompetens. Likaså representeras väghållningsmyndigheten numera vid sådana uppgifter i terräng som anknyter till tillståndsförfaranden enligt landsvägslagen till stor del av privata tjänsteleverantörer hos vilka denna tjänst köps. 
För byggande av anslutning av en enskild väg till en landsväg krävs tillstånd av väghållningsmyndigheten. Väghållaren för den enskilda vägen ska sköta underhållet av vägtrummorna vid dessa anslutningar. Väghållaren för den enskilda vägen, det vill säga väglaget eller vägdelägarna tillsammans, har en skyldighet att anlägga anslutningen och hålla den i skick enligt väghållningsmyndighetens anvisningar så att den inte äventyrar trafiken eller medför olägenhet för underhållet av landsvägen. Om en befintlig anslutning till en enskild väg till följd av ändrad eller avsevärt ökad användning orsakar fara för trafiken eller medför olägenhet för underhållet av landsvägen, är den väghållare som svarar för den enskilda vägen skyldig att på egen bekostnad enligt väghållarens anvisningar utföra sådana ändringar i fråga om anslutningen, eller i undantagsfall även i fråga om anslutningsområdet, att den fara eller olägenhet som anslutningen orsakar avlägsnas eller minskas, samt att vid behov ansöka om nytt tillstånd för anslutningen. Hittills har väghållaren för landsvägen reagerat närmast genom anmärkningar när trummor som hör till enskilda vägar fungerar dåligt och medför olägenheter. Dessutom läggs som regel vid iståndsättning av diken längs landsvägar ett trumrör som lämpar sig för en anslutning till en enskild väg i rätt läge som en del av entreprenadarbetet. Till övriga delar föreskrivs det för närvarande om enskilda vägar i lagen om enskilda vägar (358/1962). Regeringen har överlämnat till riksdagen ett förslag till en ny lag om enskilda vägar (RP 147/2017 rd).  
Riksomfattande väghållningsuppgifter 
Vissa väghållningsuppgifter har koncentrerats till en enda NTM-central som följer: 
– landsvägsfärjetrafiken (NTM-centralen i Egentliga Finland) 2 årsverken, 
– merparten av uppgifterna som gäller väghållningstillstånd och kundservicefunktionen (NTM-centralen i Birkaland) 50 årsverken, 
– trafiktelematiken (NTM-centralen i Sydöstra Finland) 9 årsverken, 
– skadeersättningar och förflyttning av fordon (NTM-centralen i Lappland) 9 årsverken,  
– museiverksamhet och traditionsarbete (NTM-centralen i Birkaland) 1 årsverke samt 
– styrning av och stöd för konkurrensutsättningen av områdesentreprenader för vägunderhållet (NTM-centralen i Egentliga Finland) 2 årsverken. 
Uppgifterna som gäller väghållningstillstånd har i huvudsak koncentrerats till NTM-centralen i Birkaland. I landsvägslagen föreskrivs om följande tillstånd som hänför sig till väghållning:  
– arbete på vägområde 
– placering av kablar, ledningar och rör på vägområde 
– placering av andra konstruktioner, anläggningar och anordningar på vägområde (till exempel pumpstation, transformator, rör för vattenförsörjningen) 
– användning av konstruktioner, anläggningar och anordningar på vägområdet för andra ändamål än landsvägsändamål 
– tillstånd för anslutningar 
– tillstånd för landsvägsreklam 
– byggande på en landsvägs skydds- och frisiktsområde 
– försäljning längs landsväg 
– tillstånd till undantag som gäller landsvägar vid tjällossning 
I uppgifterna som gäller väghållningstillstånd ingår också tillstånd för specialtransport, vilka regleras i vägtrafiklagen och i den förordning om användning av fordon på väg (1257/1992) som utfärdats med stöd av den. Också tillstånden och förutsättningarna för trafikanordningar, orienteringstavlor för serviceanläggningar, vägvisning till serviceanläggningar samt tillfälliga trafikarrangemang vid olika evenemang hänförs till väghållningstillstånd och regleras i vägtrafiklagen och med stöd av den. Regeringen överlämnade till riksdagen i november 2017 en proposition som innehöll ett förslag till en ny vägtrafiklag (RP 180/2017 rd). Enligt 191 § i den propositionen ska Trafikverket i fortsättningen bevilja tillstånd för specialtransport.  
Enheten för trafiktelematik vid NTM-centralen i Sydöstra Finland svarar för upprätthållandet av den telematikinfrastruktur för vägtrafik som Trafikverket äger och för datatrafikuppgifter med anknytning till vägsidesutrustning, för styrningen av och den riksomfattande enhetligheten hos utredningsplanering av trafikledningen i samband med investeringsprojekt som NTM-centralerna har ansvaret för och produktion av telematik i anknytning till dessa projekt. Dessutom svarar enheten för att tunnlarna i det allmänna vägnätet ät säkra. 
Trafikens kundservicecentral sköter kontakterna i landsvägs-, ban- och farledsärenden inom Trafikverkets och NTM-centralernas ansvarsområde. Trafikverkets och NTM-centralernas rådgivningsservice som hänför sig till trafikleder har för hela landets del centraliserats till Trafikens kundservicecentral. Kundrådgivarna vid Trafikens kundservicecentral svarar på frågor, hanterar respons och hänvisar kunderna till rätt serviceinstans. 
Trafiksystemplanering, klassificering av vägnätet och servicenivån på resor och transporter 
Trafiksystemet består av trafikleder, person- och godstransporter samt system som styr trafiken. Trafiksystemet omfattar alla trafikformer, färdmedel och färdsätt samt anknytande trafikinformation och trafiktjänster. Trafiksystemet är nära kopplat till andra funktioner i samhället, såsom tryggande av regionernas livskraft och utveckling av region- och samhällsstrukturen. 
Trafiksystemplaneringen fick sin början på 1990-talet och det centrala målet var redan då att samordna trafik och markanvändning. I landskapen och stadsregionerna utarbetades planer som var baserade på frivillighet och hade olika utgångspunkter. På 2000-talet har trafiksystemplaner utarbetats åtminstone en gång i alla landskap, i de största stadsregionerna och även i andra regioner. I anknytning till planerna har det ingåtts intentionsavtal om trafiksystem mellan parterna, vanligen mellan den statliga trafikförvaltningen, landskapen, samkommunerna och kommunerna. I Helsingfors, Åbo, Tammerfors och Uleåborgs stadsregioner har det upprättats intentionsavtal rörande markanvändning, boende och trafik (MBT-avtal). Jämsides med planerna och avtalen har det inrättats grupper för kontinuerlig trafiksystemplanering. Genom dessa grupper stödjer man genomförandet av gemensamt överenskomna åtgärder, samtidigt som omvärldsförändringar kan beaktas på ett smidigt sätt. 
Landskap, samkommuner, kommuner, NTM-centraler och Trafikverket sköter trafiksystemplaneringen tillsammans och målet är ett fungerande och kundorienterat trafiksystem; i planeringsarbetet dras det nytta av olika aktörers metoder att påverka efterfrågan på resor och transporter och hur dessa fungerar. Tillsammans med olika aktörer bedrivs planläggningssamarbete som hänför sig till trafik (till exempel arbete kring strukturmodeller), planeras kollektivtrafik, främjas gång, cykling och trafiksäkerhet, styrs trafik och parkering samt planeras och genomförs knutpunkter för trafiken och investeringar i trafikleder. 
Enligt statsrådets förordning om kommunikationsministeriet (405/2003) är det kommunikationsministeriets uppgift att planera och utveckla trafiksystemet. Trafikverket är ett ämbetsverk på centralnivå inom kommunikationsministeriets förvaltningsområde (lagen om Trafikverket 862/2009) och svarar för upprätthållandet och utvecklandet av servicenivån i trafiken på trafikleder som förvaltas av staten. Trafikverket främjar genom sin verksamhet hela trafiksystemets funktion, säkerheten i trafiken, en balanserad regional utveckling och en hållbar utveckling. Trafikverket har till uppgift att upprätthålla och utveckla trafiksystemet i samarbete med andra aktörer. 
Enligt lagen om utveckling av regionerna och förvaltning av strukturfondsverksamheten (7/2014) svarar landskapsförbunden för den strategiska regionutvecklingen som helhet. Som ett inslag i den uppgiften ska landskapsförbunden i andra regioner än Helsingforsregionen svara för inledandet av planeringsprocessen för landskapets trafiksystemplan, ledningen av det anknytande samarbetet och samordningen av planeringen med den övriga planeringen på landskapsnivå. I Helsingforsregionen svarar samkommunen Helsingforsregionens trafik (HRT) för trafiksystemplanen (lagen om samarbete inom avfallshanteringen och kollektivtrafiken mellan kommunerna i huvudstadsregionen 829/2009). 
Trafikverket och NTM-centralerna deltar i utarbetandet av landskapens och stadsregionernas trafiksystemplaner. Kommunikationsministeriet deltar i de stora stadsregionernas trafiksystemplanering. 
Ämbetsverksreformen inom trafikförvaltningen 2010 förändrade beredningen av trafikärenden och skapade bättre förutsättningar för att genomföra trafiksystemsaspekten på det nationella planet. Olika instansers roller klargjordes och även sakkunskapen inom ban- och vattenledshållning säkerställdes med tanke på trafiksystemplaneringen. De viktigaste kunderna och intressenterna har varit nöjda med reformen och upplever att planeringen förbättrats. Det är likaså nödvändigt att bredda perspektivet genom att öppna för kommunikationsförbindelser och kommunikationstjänster, eftersom digitaliseringen och tjänstefieringen av trafiken öppnar nya möjligheter även för trafiksystemplaneringen. 
Allt sedan 2010-talet har man inom trafiksystemplaneringen tillämpat planering som utgår från servicenivån. Det centrala i planeringsprocessen är att man först fattar beslut om gemensamma mål och sedan planerar lösningar som leder till målen med utgångspunkt i ett brett metodurval (bland annat framtida trafiktjänster, automatisering, förändringar i beteendet). Målet för servicenivåtänket har varit att komma ifrån uppfattningen att utgångspunkten och målet för planeringen är något på förhand fastställt projekt eller en viss teknisk lösning (hastighetsnivå, vägtyp). 
Staten ansvarar för landsvägarna och det är motiverat att kräva att landsvägsnätets servicenivå är tillräckligt enhetlig och tillgodoser behovet i hela landet. Huvudvägarna (riks- och stamvägar) och deras viktigaste avsnitt är föremål för särskilt nationellt intresse. 
Planeringen av landsvägarna och i synnerhet huvudvägarna har i enlighet med riktlinjerna i riksdagens trafikpolitiska redogörelse från 2012 utvecklats utgående från servicenivån. Enligt gängse praxis avses med servicenivå i första hand servicenivån på resor och transporter. Faktorer i sammanhanget är bland annat restiderna, restidernas förutsebarhet, säkerheten och bekvämligheten. Vid planeringen beaktas dessutom samhällets mål när det gäller säkerhet, miljö och ekonomi. Servicenivån som utgångspunkt har inte i någon större utsträckning förändrat de planeringslösningar som leder till olika situationer, men lösningarna är resultatet av en process som framhåller vikten av ett bredare tänk och användarorientering. 
Genom att säkra att landsvägarnas servicenivå är tillräcklig tryggar man transporterna och mobiliteten i landets olika delar, vilket är en förutsättning för boende och näringsliv. Detta ger beredskap och möjligheter för regionernas framtida utveckling. Det är viktigt ur nationellt perspektiv att nu och i framtiden se till att huvudvägarna användas smidigt och tryggt till långväga trafik. Detta ställer krav på både huvudvägens tekniska egenskaper (till exempel anslutningstyperna) och markanvändningen i närområdet samt arrangemang i samband med underhållet (skötsel och upprätthållande) av trafiknätet. När markanvändningen planeras är kravet i de riksomfattande målen för områdesanvändningen kontinuerliga trafikförbindelser i hela landet. Det är dock de regionala instanser som svarar för markanvändningen som bestämmer hur målen ska tillämpas och iakttas. Vid planeringen av huvudvägarna för Trafikverket in det rikstäckande intresset i trafiklösningarna (till exempel riktlinjerna för det centrala huvudvägnätet, anvisningarna för väghållning samt detaljstyrningen på olika planeringsnivåer och i olika planeringsfaser). 
I 4 § i landsvägslagen (503/2005) indelas landsvägarna i riksvägar, stamvägar, regionala vägar och förbindelsevägar beroende på deras betydelse för trafiken. Riksvägarna betjänar långväga trafik som är riksomfattande eller rör sig över landskapsgränserna. Stamvägarna kompletterar nätet av riksvägar och betjänar trafiken inom landskapen. De regionala vägarna betjänar trafiken inom de ekonomiska regionerna och förbinder dem med riks- och stamvägar. De övriga landsvägarna är förbindelsevägar. Kommunikationsministeriet bestämmer vilka landsvägar som är riksvägar och vilka som är stamvägar samt till vilken del de är nationellt viktiga stomvägar. Trafikverket bestämmer vilka landsvägar som är regionala vägar och vilka som är förbindelsevägar. 
Syftet med klassificeringen av landsvägsnätet och anknytande servicenivå är att stödja en långsiktig planering och utveckling av markanvändning, trafiksystem och förbindelsesträckor, trygga en smidig och trygg gods- och persontrafik över långa sträckor och peka på de delar av huvudvägnätet för vars vidkommande det finns ett klart nationellt intresse att trygga utvecklingsförutsättningarna. 
I fråga om servicenivån fästs vikt vid de generella mål som gäller fungerande och trygga resor och transporter samt miljö, ekonomi och smarta system. Dessa omvandlas till kvalitativa egenskaper för landsvägar och väghållning. Vid klassificeringen av huvudvägnätet beaktas bland annat befolkningsmängden i och utvecklingsprognoserna för centrumen, de riksomfattande målen för områdesanvändningen, förbindelsesträckornas roll i transportkedjan i den internationella trafiken och inom person- och godstrafiken, det regionala näringslivets struktur och servicebehov samt knutpunkternas betydelse i trafiksystemet. 
År 2016 gjorde Trafikverket i samarbete med NTM-centralerna en utredning som ledde till att huvudvägnätet indelades i stomförbindelser för den tunga trafiken (cirka 3 500 kilometer) och övriga huvudvägar (cirka 9 900 kilometer). 
När det gäller stomförbindelserna för den tunga trafiken ska det ställas högre krav på servicenivån än i det övriga nätet, och inställningen till behoven av anslutningar inom ny markanvändning kommer att vara striktare. De näst högsta kraven gäller övriga huvudvägar. Att kraven är högre beror på att det inom stomförbindelserna för den tunga trafiken och i det övriga huvudvägnätet i högre grad än i det övriga vägnätet är fråga om person- och godstrafik som rör sig över längre sträckor, det vill säga mer än 100 kilometer, samt yrkesrelaterad mobilitet och transporter för vilka det bör tryggas en god och jämn färdhastighet, goda möjligheter att förutse restiderna, aktuell trafik- och väglagsinformation samt tjänster som möjliggörs tack vare att trafiken automatiseras. I fråga om lösningarna för huvudvägarna är trafiksäkerheten viktig så att man kan garantera restiderna, vilket är viktigt med tanke på nåbarheten. Den nätbaserade klassificeringen och servicenivån leder inte nödvändigtvis till ett behov av åtgärder på landsvägarna. 
Landsvägarnas servicenivå tillhandahålls inom ramen för tillgänglig finansiering och Trafikverkets riktlinjer och verksamhetsanvisningar som styr planeringen och genomförandet av väghållningen samt NTM-centralernas resultatmål. Som exempel kan nämnas att Trafikverkets vinterunderhållsklassificering reglerar vinterunderhållet av vägarna, och upprätthållandeklassificeringen används som hjälpmedel vid valet av upprätthållande åtgärder. När man talar om landsvägarnas tekniska egenskaper, såsom slitspårens djup eller vinterunderhållet, är det fråga om kvalitetsnivån på landsvägen eller väghållningen. 
Planering av landsväg 
De i landsvägslagen angivna planer som byggandet av landsvägar grundar sig på är utredningsplaner och vägplaner. För behovet av planer, planeringsobjekten och utarbetandet av planer svarar för närvarande väghållningsmyndigheten, det vill säga NTM-centralens ansvarsområde för trafik. Programmeringen av planeringen av vägprojekt av nationell betydelse (preliminära utredningar om huvudvägnätet, projektplaneringsobjekt som senare kommer att bli utvecklingsprojekt) sker vid Trafikverket i samarbete med NTM-centralerna utgående från NTM-centralernas framställningar. Trafikverket ska godkänna utredningsplaner och vägplaner. I nuläget godkänns cirka 80 vägplaner och några utredningsplaner per år. Det är dock kommunikationsministeriet som godkänner vägplanen när en landsväg upphör annat än i samband med byggandet av landsväg. Också i vissa andra fall kan planerna föras till kommunikationsministeriet för godkännande.  
Enligt landsvägslagen ska en utredningsplan utarbetas, såvida inte projektets verkningar är ringa eller vägens sträckning och dess verkningar redan i tillräcklig mån har avgjorts i en detaljplan eller i en generalplan med rättsverkningar. En utredningsplan ska innehålla en utredning av behovet av landsvägen samt av de alternativ som granskats, de grundläggande trafiklösningarna och tekniska lösningarna för vägen, vägens ungefärliga sträckning samt en bedömning av verkningarna av vägen och möjligheterna att avlägsna eller lindra menliga verkningar. Utredningsplanen tjänar till ledning vid utarbetandet av en vägplan. Godkännandet av utredningsplanen leder till en relativ bygginskränkning för området. 
Den detaljerade planen för ett vägprojekt är vägplanen. I den ska vägens sträckning och höjdläge samt tvärsektion anges så att vägområdet vid behov kan utmärkas i terrängen. Till vägplanen ska fogas en bedömning av vägens verkningar, och i vägplanen ska de åtgärder anges som behövs för att avlägsna eller minska de menliga verkningar som vägen medför. En vägplan kan även utarbetas enbart för att bestämma ett vägområde, grunda ett biområde eller ange de enskilda vägar som är förenade med en allmän väg samt anslutningarna till denna. En godkänd vägplan berättigar till inlösen av de områden och rättigheter som anges i vägplanen. 
Planeringsgrunderna är det dokument som används för att styra planeringen av vägprojekt. Planeringsgrunderna utarbetas utifrån planeringspraxis. De regleras inte i lag, och om dem fattas det inga överklagbara beslut som motsvarar besluten om godkännande av utredningsplaner och vägplaner. Planeringsgrunderna för ett vägprojekt uttrycker de mål som Trafikverket och/eller NTM-centralen har ställt för projektet och önskade verkningar av betydelse, och de anger därmed också projektets regionala avgränsning, kvalitetsnivå och centrala funktionella och tekniska mål. Planeringsgrunderna är utgångspunkten för de utredningar som görs, planer som utarbetas och olika val som träffas vid planeringen. Med hjälp av planeringsgrunderna vill man ge också de parter som deltar i projektet en bättre förståelse för de verkningar som följer av olika val, såsom godtagbarhet, miljörisker och tekniska risker samt kostnadseffekter och inverkan på tidsplanen. 
Planeringsgrunderna utarbetas första gången i samband med en preliminär utredning om varje projekt eller i början av utredningsplaneringen, och de kompletteras i de följande planeringsfaserna. Landskapets trafiksystemplan ger utgångspunkter för planeringsgrunderna. Ändringar och kompletteringar i planeringsgrunderna görs vanligen vid övergången från en planeringsfas till en annan, men kan också göras under planeringens gång. För att utredningsplaneringen ska fås i gång upprättas planeringsgrunderna utifrån resultaten av den projektspecifika preliminära utredningen, samtidigt som preciseringar görs och resultaten av utredningen vägs in. Planeringsgrunderna för vägplanering kompletteras på grundval av de lösningar som föreslagits i utredningsplanen. Utredningsplanen utmynnar således i de principiella lösningar som ligger till grund för en mer detaljerad projektplanering. 
Vägprojektens effekter beskrivs genom en projektbedömning. Syftet med projektbedömningen är att stödja projektplaneringen och beslutsfattandet om genomförande av projektet. För närvarande finns det inte några bestämmelser om detta i landsvägslagen. Vid utredningsplaneringen används projektbedömning för att stödja valet av åtgärder som ska ingå i projektet och för att jämföra projektalternativens effekter och lönsamhet. Tack vare projektbedömningen blir de val som träffas av den som utarbetar planen mer genomskinliga. Projektbedömningen säkerställer också att de projektalternativ som är effektivast och har störst genomslagskraft avancerar inom planeringen. Den information som projektbedömningen ger vid vägplanering är till hjälp när man jämför effektiviteten och genomslagskraften hos olika projekt, och i sista hand stödjer den det politiska beslutsfattandet vid valet av projekt som ska genomföras. Den myndighet som svarar för utarbetandet av en plan, det vill säga närings-, trafik- och miljöcentralen, svarar för närvarande för att en projektbedömning utarbetas. 
Beträffande projektbedömningen är kvaliteten viktig, med vilket avses att bedömningen ska vara objektiv, öppen för insyn och tillförlitlig. Viktigt är också att projektbedömningarna är jämförbara, vilket förutsätter att de utarbetas på ett enhetligt sätt. I dagens läge försöker man genom anvisningar som Trafikverket meddelar säkerställa att bedömningarna är jämförbara och insynsvänliga. Jämförbarheten och insynsvänligheten säkerställs genom att anvisningarna följs. En projektbedömning ska innehålla en beskrivning av projektets utgångspunkter och verkningar, en bedömning av projektgenomförandet, en plan för uppföljning och utvärdering i efterhand samt en redogörelse för och dokumentation av bedömningen. 
Offentlig persontrafik 
Kollektivtrafiklagen (869/2009) trädde i kraft den 3 december 2009, samtidigt som Europaparlamentets och rådets förordning (EG) nr 1370/2007 av den 23 oktober 2007 om kollektivtrafik på järnväg och väg och om upphävande av rådets förordning (EEG) nr 1191/69 och (EEG) nr 1107/70 (nedan trafikavtalsförordningen). Genom kollektivtrafiklagen ändrades den nationella lagstiftningen så att den kom att motsvara och komplettera trafikavtalsförordningen. Kollektivtrafiklagen innehåller bestämmelser om trafik enligt trafikavtalsförordningen som stöds och om trafik på marknadsvillkor. I trafikavtalsförordningen föreskrivs det om åtgärder och förfaranden som de behöriga myndigheterna ska tillämpa när de tryggar tillräckliga, högklassiga och trygga kollektivtrafiktjänster för sina medborgare.  
I Finland beslutar de myndigheter som är behöriga enligt kollektivtrafiklagen – nio NTM-centraler och 26 kommunala myndigheter – hur kollektivtrafiken ska ordnas inom deras respektive område. Om en myndighet anser att kollektivtrafiktjänster i ett område bör ordnas så att de är tätare, säkrare, av bättre kvalitet eller förmånligare än vad enbart den fria marknaden skulle kunna erbjuda, kan myndigheten bestämma att kollektivtrafiktjänsterna i enlighet med trafikavtalsförordningen ska ordnas genom konkurrensutsättning.  
Kollektivtrafiktjänsterna kan konkurrensutsättas genom ett koncessionsavtal i enlighet med kollektivtrafiklagen och trafikavtalsförordningen eller genom en så kallad bruttomodell i enlighet med upphandlingslagen. Bruttomodellen med sina olika tillämpningsformer används i merparten av städernas lokaltrafik och kommunernas interna trafik, medan ruttbaserade koncessionsavtal används i trafik som NTM-centralerna ordnar. 
Enligt kollektivtrafiklagen är villkoret för att etablera sig i branschen ett kollektivtrafiktillstånd eller gemenskapstillstånd. Bestämmelserna om tillstånd för etablering grundar sig i stor utsträckning på Europeiska unionens lagstiftning. Bedrivande av linjebaserad trafik och anropsstyrd kollektivtrafik på marknadsvillkor kräver dessutom tillstånd för linjebaserad trafik eller tillstånd för anropsstyrd kollektivtrafik. Offentligt stödd trafik enligt trafikavtalsförordningen bedrivs på basis av avtal mellan den behöriga myndigheten och trafikidkaren. 
Antalet kollektivtrafiktillstånd är inte begränsat, utan tillstånd beviljas alla sökande som uppfyller villkoren i lagen. Kollektivtrafiklagen inbegriper en tio år lång övergångsperiod för gamla linjetrafiktillstånd. I samband med att lagen trädde i kraft ändrades linjetrafiktillstånden till avtal för övergångsperioden, vilka stegvis löper ut mellan 2014 och 2019. De första avtalen för övergångsperioden upphörde att gälla i juni 2014.  
Utgångspunkten enligt trafikavtalsförordningen är att myndigheterna inte ska ingripa i konkurrensen mellan företag eller begränsa utbudet. Bedrivandet av trafik på marknadsvillkor kan emellertid begränsas genom så kallade minimivillkor. Detta innebär i praktiken att det ställs villkor för att marknadsbaserad trafik ska få inledas. Syftet med villkoren kan vara att tillgodose myndigheternas och resenärernas behov av information, att säkerställa kvaliteten på och kontinuiteten i den service som erbjuds eller att förbättra säkerheten. 
Att ordna offentlig persontrafik är inte en lagstadgad uppgift utan frivilligt. Om en behörig myndighet dock vill tillhandahålla och ordna kollektivtrafik ska trafikavtalsförordningen och Finlands nationella lagstiftning iakttas. 
Staten stöder ordnandet av trafiktjänster på kollektivtrafikens område med cirka 85 miljoner euro per år via anslag inom kommunikationsministeriets förvaltningsområde. NTM-centralerna finansierar kollektivtrafik med bussar och taxi som bedrivs på landsbygden och kan betraktas som grundläggande service (omkring 34 miljoner euro/år). Dessutom upphandlar de trafik i sitt område genom konkurrensutsatta avtal vars finansiering kommunerna kan delta i. Grunderna för det stöd som NTM-centralerna beviljar anges i statsrådets förordning om statsunderstöd för kollektivtrafik. Genom stödet till kollektivtrafiken kompenseras även prisskyldigheten i anslutning till region-, stads- och arbetsresebiljetter i sådan trafik som bedrivs enligt trafikeringsavtal för övergångsperioden. 
Staten stödjer kollektivtrafiken i Helsingfors-, Tammerfors-, Åbo- och Uleåborgsregionerna med ett anslag på 9,75 miljoner euro under förutsättning att finansieringen höjer kollektivtrafikens servicenivå inom regionerna och därmed ökar användningen av kollektivtrafiken och dess marknadsandel samt förbättrar kollektivtrafikens konkurrenskraft. En förutsättning för statsunderstödet är att den statliga finansieringen binds till utvecklingsåtgärder som avtalats i intentionsavtalet om markanvändning, boende och trafik så att man kan garantera finansieringens effekter i enlighet med målen i programmet. Staten understöder de stora stadsregionerna med högst 50 % av de godtagbara kostnaderna. 
Staten understöder dessutom kollektivtrafiken i medelstora stadsregioner med ett anslag på sammanlagt 8 miljoner euro, förutsatt att stadsregionerna har upprättat ett intentionsavtal om genomförande av ett utvecklingsprogram för kollektivtrafiken och deltar med minst 50 % av de godtagbara kostnaderna. 
NTM-centralen i Södra Österbotten beviljar kollektivtrafiktillstånd och kontrollerar årligen att tillståndshavarna fortfarande uppfyller tillståndsvillkoren. Samma NTM-central har trots sekretessbestämmelserna rätt att ur straffregistret, bötesregistret, fordonstrafikregistret, utsökningsregistret, näringsförbudsregistret och beskattningens datasystem få nödvändiga uppgifter om dem som söker respektive innehar kollektivtrafiktillstånd, trafikansvariga, företagets verkställande direktör och ansvariga bolagsmän. NTM-centralen har dessutom, trots sekretessbestämmelserna, rätt att av polisen, Skatteförvaltningen, Tullen, arbetarskyddsförvaltningen och Trafiksäkerhetsverket få nödvändiga uppgifter om företagskontroller som gäller dem som innehar kollektivtrafiktillstånd och andra uppgifter som är nödvändiga för att bedöma huruvida förutsättningarna för beviljande av kollektivtrafiktillstånd uppfylls. 
Läget förändras den 1 juli 2018, då lagen om transportservice (RP 161/2016 rd; lag 320/2017) träder i kraft och kollektivtrafiklagen upphävs. När det gäller arrangemangen i samband med den offentliga persontrafiken blir den administrativa bördan lättare och smidigheten större i och med förändringen. Också i fortsättningen kan produktionen av persontrafiktjänster styras genom att det fattas beslut om ensamrätter inom ramen för EU:s trafikavtalsförordning. 
Flygtrafik och flygplatser 
Trafikverket kan införa en allmän trafikplikt för köp av flygtrafik för orter till vilka restiden från Helsingfors är längre än tre timmar med tåg. Genom att staten köper flygtrafik på reguljära rutter tryggas sådana förbindelser som främst näringslivet behöver. Även lokala och regionala instanser har deltagit i köp av flygtrafik. Trafikverket och Nyslotts stad har konkurrensutsatt rutten Helsingfors–Nyslott, och avtalet om köp av flygtrafik på reguljära rutter omfattar åren 2018–2020. Trafikverket och Nyslotts stad betalar vardera hälften av kostnaderna, det vill säga cirka 1,1 miljoner (1 095 678,33) euro per år. 
Till följd av ett anslag på 50 000 euro som riksdagen beviljat införde Trafikverket en allmän trafikplikt för Enontekis kommun att upprätta en tillfällig flygförbindelse i reguljär flygtrafik mellan Helsingfors och Enontekis för tiden den 19 februari 2017 – den 23 mars 2017. Som följd av en begäran från Enontekis kommun och eftersom en del av ett treårigt överföringsanslag inte hade utnyttjats införde Trafikverket för tiden den 3 mars 2018 – den 14 april 2018 en motsvarande allmän trafikplikt för att trygga trafiken till och från Enontekis. 
Kommunikationsministeriet har beviljat statsunderstöd för byggande och upprätthållande av vissa flygplatser. Anslaget kan användas för betalning av statsunderstöd till verksamhets- och investeringsutgifter för flygplatser som ligger utanför Finavia Abp:s flygplatsnät. Det årliga anslaget har varit 1 miljon euro. Under olika år har anslaget använts till flygplatserna i Seinäjoki och S:t Michel, och 2016 också till flygplatsen i Villmanstrand. Statsunderstödet har beviljats flygplatser som inte är Finavia Abp:s, i enlighet med EU:s riktlinjer för statligt stöd till flygplatser och flygbolag (EU 2014/C 99/03). 
Mobilitetsstyrning 
Trafikverket har beviljat organisationer och kommuner 900 000 euro/år i understöd för mobilitetsstyrning. Genom det i statsbudgeten anvisade anslaget för mobilitetsstyrning medverkar man till att vid sidan av att öka andelen kollektivtrafik göra också gång- och cykeltrafiken mera attraktiv, särskilt i stadsregionerna. Metoderna är bland annat informationsstyrning, marknadsföring och stöd till att utveckla tjänster. 
2.2
Landskapsreformen
I regeringens proposition RP 15/2017 rd föreslås att det stiftas en landskapslag, en lag om ordnande av social- och hälsovård och en gemensam lag om införande av dessa. I propositionen ingår förslag till lag om landskapsindelning och lag om landskapens finansiering samt förslag till ändring av lagstiftningen om kommunernas finansiering, skattelagstiftningen, lagstiftningen om landskapens och kommunernas personal, vallagstiftningen och vissa lagar som gäller den allmänna förvaltningen samt de ändringar som reformerna förutsätter i den övriga lagstiftningen. 
Enligt lagförslaget är landskapen offentligrättsliga samfund med regionalt självstyre. Det ska inrättas 18 landskap i Fastlandsfinland. Landskapen ska ha landskapsfullmäktige, en landskapsstyrelse och en revisionsnämnd. Landskapen beslutar själva om övriga organ. Den 1 januari 2020 överförs till landskapen de uppgifter som åläggs dem i lag. Till landskapen överförs uppgifter från NTM-centralerna, arbets- och näringsbyråerna, regionförvaltningsverken, landskapsförbunden, andra samkommuner och kommunerna. 
Trafikuppgifter som ingår i den föreslagna landskapslagen 
I 6 § 1 mom. 14 och 15 punkten i förslaget till landskapslag föreskrivs det om sådana uppgifter inom trafiksektorn som överförs till samtliga landskap. I 2 mom. föreslås bestämmelser om utveckling och ordnande av trafiktjänster på landskapsnivå samt om planering och ordnande av offentlig persontrafik och skärgårdstrafiken. Dessa uppgifter avses vara frivilliga för landskapen: landskapen kan åta sig att sköta uppgifterna om de så vill. 
Den uppgift som det föreskrivs om i 1 mom. 14 punkten är den mest omfattande av de uppgifter som överförs till landskapen. Enligt den ska landskapen ha hand om 
– trafiksystemets funktion, 
– trafiksäkerheten, 
– väg- och trafikförhållandena, 
– den regionala väghållningen, 
– samarbetet inom markanvändningen och 
– produktionen av data om verksamhetsmiljön för användning i den nationella trafiksystemplaneringen. 
Trafiksystemplanering  
Det är meningen att landskapen ska svara för trafiksystemets funktion. Trafiksystemet består av trafikleder, person- och godstransporter samt system som styr trafiken. I vid bemärkelse ingår i trafiksystemet också trafikinformation och trafiktjänster, med vilka avses bland annat tjänster som definieras i 1 § i lagen om transportservice (transporttjänster, förmedlingstjänster, trafiktjänster, mobilitetstjänster, kombinationstjänster). Trafiksystemet är nära kopplat till andra funktioner i samhället, såsom utvecklingen av region- och samhällsstrukturen. Till målen för trafikpolitiken och trafiksystemet hör trygg mobilitet och trygga transporter och ett ekologiskt, socialt och ekonomiskt hållbart trafiksystem. För att trafiksystemets funktion och planering ska bli effektivare är det viktigt att sörja för ett brett upplagt samarbete mellan staten, landskapen och kommunerna. Särskilt viktigt är det att sörja för att de olika trafikformerna (väg-, ban-, vatten- och flygtrafik) är kompatibla med datakommunikationen med beaktande av medborgarnas och näringslivets behov. 
I trafiksystemets funktion ingår trafiksystemplanering, behovsutredningar och preliminär planering samt samordning av planeringen med landskapets övriga planering och med kommunernas och statens planering. Verksamheten gäller i princip också trafikstyrning, hastighetsbegränsningar och väghållningstillstånd, men eftersom trafikledsegendomen är statsägd bör det överenskommas separat om dessa uppgifter. I detta ingår även trafiksäkerhetsuppgifter som är förknippade med all verksamhet. Landskapen kan till exempel utarbeta trafiksäkerhetsplaner för det egna området eller förverkliga en plan tillsammans med andra landskap.  
Landskapen föreslås spela en central roll när trafiksystemplanen för respektive landskap utarbetas, i synnerhet när det gäller den samlade vägtrafiken, eftersom väghållningsuppgifterna för landsvägarnas del avses bli ordnade i form av väghållningsområden som landskapen bildar. Trafiksystemplanering ska genomföras i 18 landskap och landskapen kommer att ha en stark samordnande roll. Landskapet ska svara för att planeringsprocessen inleds, en plan utarbetas, de delar som gäller landskapets trafikuppgifter och vägtrafik bereds och anknytande samarbete leds samt för att planeringen i fråga samordnas med den övriga planeringen i landskapet och med såväl den rikstäckande och landskapsöverskridande som den kommunala planeringen. Landskapen kan dessutom sköta uppgifter som anknyter till planering av offentlig persontrafik, enskilda vägar, skärgårdstrafik, mobilitetsstyrning samt köp av flygtrafik och utförs också som ett led i trafiksystemplaneringen.  
Enligt 17 § i lagen om utveckling av regionerna och förvaltning av strukturfondsverksamheten (7/2014) ska landskapsförbunden svara för inledandet av planeringsprocessen för landskapets trafiksystemplan och ledningen av det anknytande samarbetet. Denna uppgift och den trafiksystemplanering som för närvarande utförs vid NTM-centralerna föreslås bli överförda till de nya landskapen. Trafikverket ska delta i trafiksystemplaneringen på landskaps- och riksnivå när det gäller landsvägar, banor och vattenleder. I rollen som ägare av trafikledsnätet deltar Trafikverket i landskapens och kommunernas planläggning och ger utlåtanden. I nuläget ger NTM-centralerna utlåtanden om landsvägsnätet. Det är meningen att också Trafiksäkerhetsverket ska delta i trafiksystemplaneringen på landskaps- och riksnivå, särskilt när det gäller trafiktjänster inom persontrafiken.  
För att säkerställa ett fungerande trafiksystem och med tanke på planeringen är det viktigt att det bedrivs ett brett upplagt samarbete mellan offentliga aktörer, näringsliv, organisationer och andra intressenter. Inom trafiksystemplaneringen bör man beakta alla trafikformer och färdsätt och samordningen av dem samt samordna planeringen med landskapsstrategin och programarbetet i landskapet. Landskapets trafiksystemplan kan också vara en del av landskapsstrategin eller av någon annan strategisk planering. Man strävar efter att säkerställa ett fungerande trafiksystem genom att utarbeta trafiksystemplaner som omfattar ett eller flera landskap samt utredningar om olika teman eller förbindelsesträckor. Landskapen kan till exempel göra upp trafiksäkerhetsplaner för sitt eget område eller genomföra planen tillsammans med andra landskap. 
Den regionala väghållningen 
Enligt motiveringen till landskapslagen försäkrar man sig genom regional väghållning om att den dagliga trafiken fungerar och tryggar att vägkonstruktioner och broar bevaras. Enligt den nuvarande definitionen i landsvägslagen omfattar väghållningen planering, byggande och underhåll av landsvägar samt trafikförvaltning. Dessa uppgifter utförs även i fortsättningen avtalsbaserat (huvudman–agent-avtal), eftersom staten fortsätter att äga hela vägnätet.  
I avtalen kan man komma närmare överens med ett enskilt landskap eller det landskap som svarar för väghållningen om underhållet och upprätthållandet av det regionala vägnätet samt om eventuella områdesentreprenader (till exempel konkurrensutsättning och övervakning av arbetet samt underhåll av den del av riksnätet som finns på landskapets område) och andra väghållningsuppgifter. Det är meningen att landsvägslagen ska innehålla mer detaljerade bestämmelser om detta.  
När det gäller väg- och trafikförhållanden ingår uppföljning av verksamhetsmiljön samt upprätthållande och uppföljning av väg- och trafikinformation i uppgiften. Landskapet ska antingen på egen hand eller i samarbete med andra landskap producera information om trafikmängder och om invånarnas och näringslivets behov för ett nationellt informationssystem. Denna information stödjer uppgörandet av landskapsstrategin och planen för de offentliga finanserna samt beredningen av nödvändiga investeringar och bestämmandet av servicenivån. 
Uppgifter i samband med statsunderstöd 
Enligt 6 § 1 mom. 15 punkten i förslaget till landskapslag ska landskapet sköta uppgifter i samband med statsunderstöd för enskilda vägar och mobilitetsstyrning.  
Vägdelägarna ansvarar för de enskilda vägarnas väghållning. De bestämmer vilken väghållningsnivå de behöver och finansierar den själva. Väglagen är skyldiga att upprätthålla anslutningar från enskilda vägar till landsväg. Staten och kommunerna kan numera bevilja bidrag för olika väghållningsändamål. Statsunderstödsanslag används nu för tiden för att stödja underhåll och förbättring av enskilda vägar. Det är meningen att landskapet ska sköta uppgifter i samband med statsunderstöd för enskilda vägar. För närvarande har ett anslag på cirka 700 000 euro avsatts för statsunderstöd som riktas till enskilda vägar. I dagsläget har cirka 2,3 miljoner euro avsatts för stöd till vajerfärjor och färjelägen längs enskilda vägar. I fortsättningen avses stödet till vajerfärjor och färjelägen längs enskilda vägar bli behandlat som en del av den samlade skärgårdstrafiken. Landskapens finansiering av denna understödsuppgift kan realiseras genom att poängtera glesbebyggelse, skogsbruk och jordbruk. En indelning som genomförs på detta sätt tar större hänsyn till bosättningens och näringslivets behov beträffande enskilda vägar. Det är meningen att närmare bestämmelser om detta ska tas in i lagen om enskilda vägar; en separat regeringsproposition som gäller den överlämnas. Riksdagen håller på att behandla en totalreform av lagen om enskilda vägar (RP 147/2017 rd). 
Syftet med mobilitetsstyrningen är att påverka människors beteende och sätt att färdas genom att främja gång och cykling. Numera anvisas i statsbudgeten årligen ett anslag på 900 000 euro för mobilitetsstyrning, och med anslaget har olika projekt inom kommuner och sammanslutningar redan finansierats. Landskapet kan genomföra mobilitetsstyrningen antingen på egen hand eller i samarbete med andra landskap.  
Offentlig persontrafik 
I 6 § 2 mom. 1 punkten i förslaget till landskapslag föreskrivs om utveckling och ordnande av trafiktjänster på landskapsnivå samt planering och ordnande av offentlig persontrafik för vägtrafikens del, med undantag för verksamhetsområdena för de kommunala och regionala myndigheter som avses i lagen om transportservice och planering och ordnande av trafiken inom dessa områden. Sådana behöriga kommunala myndigheter som ansvarar för offentlig persontrafik är bland annat Hyvinge, Imatra, Kajana, Karleby, Villmanstrand, Rovaniemi och Salo inom sitt respektive område och regionala myndigheter är bland annat samkommunen Helsingforsregionens trafik (HRT), Tavastehus stad, Joensuu stad, Kuopio stad och Lahtis stad. Det finns sammanlagt 14 kommunala och 12 regionala myndigheter av detta slag, som fortsätter med sin verksamhet som förut om inget annat bestäms. 
Hösten 2017 beslutades det att också järnvägstrafiken skulle omfattas av landskapens behörighet. Finansministeriets bemötande med anledning av detta gavs till riksdagens förvaltningsutskott den 8 december 2017. Behörigheten för landskapen att ordna regional tågtrafik kompletterar kommunikationsministeriets nationella behörighet. Vid de framtida konkurrensutsättningarna kommer kommunikationsministeriet att i koncessionsavtalen definiera de nationella förbindelserna, något som i princip till stor del motsvarar dagens tågtrafikutbud. Det är meningen att landskapen om de så önskar ska kunna upphandla inom sitt område till exempel långsammare tågturer som stannar vid fler stationer och som betjänar till exempel landskapets interna arbetsplatstrafik. Dessutom kan landskapen samarbeta om upphandling av trafik som löper mellan landskapen. Samordningen av regional och rikstäckande järnvägstrafik kan ske i samband med att den riksomfattande trafiksystemplan och de trafiksystemplaner på landskapsnivå som anges i lagen om trafiksysten och landsvägar utarbetas.  
Köp av flygtrafik är ett inslag i den offentliga persontrafiken, och uppgiften överförs från staten (Trafikverket) till landskapen, men finansieringen sker i form av särskild finansiering. Den omständigheten att uppgiften att köpa flygtrafik överförs från Trafikverket till landskapen har en marginell personalkonsekvens (0,5 årsverken). 
Meningen är också att uppgifterna i anslutning till statsunderstöd för byggande och upprätthållande av vissa flygplatser ska överföras från staten (kommunikationsministeriet) till landskapen. Landskapen kan utgående från prövning anvisa stöd till sådana flygplatser som inte ingår i Finavia Abp:s flygplatsnät. Överföringen av den statsunderstödsuppgift som hänför sig till flygplatser från ministeriet till landskapen har en marginell personalkonsekvens (0,5 årsverken). 
Enligt den föreslagna landskapslagen omfattar den offentliga persontrafiken vägtrafik, järnvägstrafik, flygtrafik och Kvarkentrafiken. Ansvaret för att ordna offentlig persontrafik beträffande vägtrafik och köptrafiken beträffande båttrafiktjänsterna i Kvarken överförs från NTM-centralerna till landskapen, uppgiften att köpa flygtrafik överförs från Trafikverket till landskapen och uppgifter som gäller statsunderstöd för flygplatser som inte är Finavia Abp:s överförs från kommunikationsministeriet till landskapen. I landskapslagen görs det möjligt för landskapen att ta på sig skötseln av uppgifter som hänför sig till den offentliga persontrafiken: planering, ordnande och eventuella köpta tjänster. Frånsett köpen av flygtrafik, Kvarkentrafiken och uppgifterna i samband med statsunderstöd utgör verksamheten uppgifter med allmän finansiering.  
Om landskapen så önskar kan de helhetsinriktat sköta och ansvara för utvecklingen och ordnandet av landskapets trafiktjänster. I framtiden uppstår det vid sidan av traditionell offentlig persontrafik nya informationsbaserade mobilitetstjänster och digitala sätt att dela och kombinera det nuvarande utbudet på nya sätt som betjänar kunderna bättre. 
Ordnande av skärgårdstrafiken 
Lagen om främjande av skärgårdens utveckling (494/1981) reglerar möjligheterna till försörjning, rörlighet och basservice för den fasta bosättningen i skärgården. Enligt lagens 5 § bör staten ”försöka sörja för att skärgårdens bofasta befolkning till sitt förfogande har en med hänsyn till boendeförhållandena, utkomstbetingelserna och skötseln av nödvändiga angelägenheter erforderlig trafik- och transportservice, som är så smidig som möjligt samt avgiftsfri eller prismässigt skälig”. 
Tidigare svarade Sjöfartsverket för att ordna transporterna, men sedan NTM-centralerna inrättades 2010 har de haft detta ansvar. NTM-centralen i Egentliga Finland konkurrensutsätter och subventionerar centraliserat skärgårdstrafiken i Sibbo och Raseborg, delvis i Ingå och Lovisa samt på Skärgårdens ringväg. Med subventionerad skärgårdstrafik avses sådan regelbunden trafik som en enskild transportör sköter sjövägen med ett sjövärdigt fartyg och som betjänar personer som bor permanent i skärgården på sådana rutter i skärgården eller på rutter mellan skärgården och fastlandet som saknar annan regelbunden trafik eller vägförbindelse.  
Fleråriga avtal om skärgårdens förbindelsefartygstrafik har ingåtts i de olika regionerna. Största delen av de gällande avtalen upphör 2023. 
Enligt 6 § 2 mom. 2 punkten i landskapslagen kan landskapet sköta planering och ordnande av skärgårdstrafiken. Landskapet ska ansvara för planeringen och ordnandet av skärgårdens förbindelsefartygstrafik samt för understödsuppgifter beträffande vajerfärjor och färjplatser längs enskilda vägar. Dessa uppgifter överförs till landskapen från NTM-centralernas ansvarsområde för trafik där uppgiften, när det gäller förbindelsefartygstrafiken, har skötts centraliserat av NTM-centralen i Egentliga Finland. Landskapen kan sköta uppgiften antingen på egen hand eller tillsammans med andra landskap. 
2.3
Den internationella utvecklingen samt lagstiftningen i utlandet
Samhällsstrukturen i Finland ser annorlunda ut än i de flesta andra europeiska länder. Finland är ett glesbebyggt land med stor yta och har därför ett glesare vägnät än många andra länder (0,31 km/km2). Landsvägarna har ändå en stor betydelse för näringslivet och människornas mobilitet, eftersom järnvägs- och flygplatsnätet inte tillgodoser hela landets behov. 
Följande översikter av hur trafikuppgifterna fördelar sig inom statsförvaltningen i de nordiska länderna grundar sig på en bakgrundsutredning som beställts av Trafikverket, ”Liikennetehtävät valtion aluehallinnossa ja maakuntahallinnossa Norjassa, Tanskassa ja Ruotsissa” (Trafikuppgifter i den statliga regionförvaltningen och i landskapsförvaltningen i Norge, Danmark och Sverige). Utredningen har utarbetats av Peter Molin, Ramboll Finland Ab (den 5 februari 2016). 
2.3.1
2.2.1 Sverige
Det land som ligger närmast Finland när det gäller vägförhållandena är Sverige där vägnätet, på samma sätt som i Finland, består av statliga vägar, kommunala vägar och gator samt enskilda vägar, av vilka en del får statsbidrag. I Sverige beviljas statsbidrag dock till betydligt högre belopp än i Finland. I Sverige finns bestämmelserna om landsvägar i väglagen. 
Den statliga vägförvaltningen, Trafikverket, svarar för statens vägnät. I praktiken sträcker sig det statliga vägnätet längre in i städer och kommuner än i Finland, eftersom huvudlederna ofta är statliga vägar också i de större städerna. Trafikverket har inget sektoriellt ansvar för vägtrafiken och verket har formellt avstått också från sin regionala organisation, men det har fortfarande sex regiondirektörer som även officiellt är regionala väghållningsmyndigheter. Trafikverket svarar för de nationella huvudlederna, såsom europavägarna. Dessutom svarar Trafikverket för finansiering, fysisk planering och genomförande av statliga projekt i det lägre vägnätet. Om finansieringen inte räcker till prioriteras projekten i samarbete med länsstyrelsen. Trafikverket har cirka 6 200 anställda. 
Allt sedan 1862 har det i Sverige funnits landskap med fullmäktige som väljs genom direkt folkomröstning. I landet finns det för närvarande 20 landskap, landsting, av vilka åtta (regioner) har utvidgade ansvarsområden. Regionernas utvidgade ansvar har att göra med regionalt hållbar utveckling och tillväxt samt med regionala trafikinfrastrukturplaner, det vill säga utvecklingen av ett regionalt trafiknät. Andra uppgifter som landstingen har är att ansvara för hälso- och sjukvård, lokaltrafik samt planläggning på landskapsnivå.  
Sverige har dessutom 21 länsstyrelser som företräder staten och bevakar statens intressen på regionnivå. Länsstyrelserna följer bland annat upp verkställandet av statliga beslut regionalt och främjar utvecklingen av regionerna. Länsstyrelserna grundar sig på samma lag, ursprungligen 1634 års lag, som låg till grund när Finland inrättade sina tidigare länsstyrelser. Länsstyrelserna har det regionala planeringsansvaret, med andra ord prioriterar de statliga projekt i det lägre vägnätet på sina områden, såsom nämns ovan. 
Sverige har för närvarande 290 kommuner. Mellan 1962 och 1974 minskade antalet kommuner från cirka 1 000 till 278. Efter det har det gjorts några kommundelningar, vilket har lett till det antal kommuner som finns i dag. Kommunerna svarar i huvudsak för sina gator, men huvudgatorna kan vara Trafikverkets ansvar. 
I Sverige pågår ett projekt som kallas Rätt väghållaransvar (RÄV) inom vilket Trafikverket i samarbete med kommuner, landsting och Riksförbundet Enskilda Vägar arbetar för en mer rationell väghållning. För att uppnå totalekonomisk effektivitet och rationellare väghållning har det gemensamma målet för projektet varit att uppnå rätt fördelning av väghållaransvaret mellan staten, kommunerna och dem som ansvarar för enskilda vägar.  
Sverige har utarbetat en nationell plan för långsiktiga satsningar på trafiknätet. Den nuvarande planen har upprättats för 2014–2025 (Nationell plan för transportsystemet). Den fastställs av regeringen och genomförs av Trafikverket. Under perioden satsas totalt 522 miljarder kronor (cirka 56 miljarder euro). Av detta belopp styrs 241 miljarder kronor (cirka 25,7 miljarder euro) till skötsel och upprätthållande av vägar och järnvägar. Återstående 281 miljarder kronor (cirka 30 miljarder euro) riktas till att utveckla infrastrukturen. Förutom med statliga medel finansieras åtgärderna med trängselavgifter och andra avgifter som uppgår till cirka 67 miljarder kronor (cirka 7,2 miljarder euro) och samfinansiering som kommunerna, regionerna och företagen står för (cirka 18 miljarder kronor, det vill säga cirka 1,9 miljarder euro). Landstingen lägger fram egna regionala planer för trafikinfrastrukturen för samma period, 2014–2025. I planerna ingår landstingens planerade investeringar som gäller bland annat landstingens andelar av den regionala kollektivtrafiken och av de gemensamma kostnaderna enligt den nationella planen, åtgärder som vägarna kräver samt behov avseende lederna för gång- och cykeltrafik. Regeringen beslutar om landstingens finansiella ramar.  
Den svenska regeringen beslutar om eventuella avgifter för väganvändning och uttaget av dem inom ramen för lagen om infrastrukturavgifter på väg (2014:52). För närvarande tas avgifter för väganvändning ut på Öresundsbron mellan Sverige och Danmark och för passager över Svinesundsbron mellan Sverige och Norge (Svinesundsförbindelsen). Riksdagen i Sverige beslutar om uttaget av trängselskatt. I dagsläget tas trängselskatt regelmässigt ut bara i Stockholm och Göteborg. 
2.3.2
2.2.2 Norge
Det norska vägnätet består av statliga vägar, fylkesvägar, kommunala vägar och gator samt enskilda vägar. I Norge satsas det totalt sett betydligt mer på trafiklederna än i Finland, bland annat på grund av nivån på det nuvarande vägnätet samt topografin och markförhållandena. I Norge regleras landsvägarna i väglagen, lov om vegar. 
Den statliga vägförvaltningen, Statens vegvesen, svarar för det statliga vägnätet och har det sektoriella ansvaret för vägtrafiken. Statens vegvesen består av centralförvaltningen (Vegdirektoratet) och fem vägdistrikt (regioner). Varje vägdistrikt omfattar flera fylken och svarar för de statliga vägarna inom sitt respektive område samt för fylkesvägarna under ledning av fylkena. Statens vegvesen har totalt 7 332 anställda. När det gäller vägfrågor har byggande och underhåll lagts ut, men av närmare hälften av planeringen av de statliga vägarna görs fortfarande av Statens vegvesens centralförvaltning och vägdistriktens vägavdelningar. I vägdistrikten (regionerna) finns det en särskild vägavdelning för varje fylke, och de största projekten har också en egen projektavdelning. Dessutom har varje vägdistrikt gemensamma resurser, det vill säga en egen centralförvaltning.  
Norge har 19 fylken, medräknat Oslo som är både ett fylke och en kommun. Fylkenas trafik finansieras av staten och genom vägtullar som direkt finansierar trafikprojekt, totalt cirka 8,1 miljarder norska kronor (cirka 860 miljoner euro) om året. Fylkena samlar också in fylkesskatt, men den norska riksdagen stortinget beslutar om skattens storlek och skatten balanseras mellan fylkena genom ramfinansiering. I samband med en förvaltningsreform 2010 överförde staten 17 200 kilometer vägar och 78 färjeförbindelser till fylkena. Fylkenas vägnät växte således med cirka 50 %. Tillsammans med vägarna överfördes också finansieringen till fylkena, och cirka 5,4 miljarder norska kronor (cirka 557 miljoner euro) överfördes till fylkenas ramfinansiering och 1 miljard norska kronor (cirka 105 miljoner euro) till den fria finansieringen. De medel som beviljats för perioden 2010–2014 sjönk i någon mån och 2014 beviljades fylkena därför tilläggsfinansiering för underhåll, eftersom den redan beviljade finansieringen inte hade räckt till för att hålla den överförda reparationsskulden ens på samma nivå som tidigare.  
Fylkena beslutar själva om hur fylkets vägnät ska utvecklas och underhållas. Finansieringen har tydligt inriktats på nyinvesteringar, i viss mån på bekostnad av underhållet. För vägarnas del styrs fylkenas verksamhet av de strategiska planer som fylkena utarbetar och av budgeten. Dessa fungerar som resultatmål för fylkesvägarna. Fylkena beställer den produktion som har med fylkesvägarna att göra hos Statens vegvesens vägdistrikt. Vägcheferna i vägdistrikten svarar i sin tur för att det finns tillgång till nödvändiga resurser för de uppgifter och mål som ålagts av fylkena. Beträffande fylkesvägarna styrs vägdistriktens verksamhet av olika planer, avtal och budgetar. I fråga om väginvesteringarna och underhållet är ansvaret delat så att fylkena bestämmer vad det ska satsas på och vägdistrikten hur satsningarna ska genomföras på det praktiska planet. Reformen 2010 ses i praktiken inte som någon stor sak i Norge, sannolikt på grund av att vägdistrikten till viss del förvaltar fylkesvägarna på samma sätt som tidigare. Det finns dock utmaningar: chefen för vägdistriktet rapporterar till både Statens vegvesen och fylkesförvaltningen. Fylkena i ett vägdistrikt kan även ha olika mål, och även andra uppgifter som hör till fylkena tävlar om finansieringen. 
Norge har totalt 428 kommuner. Alla fylken, förutom Oslo, omfattar 14–24 kommuner. Kommunerna har, liksom i Finland, ansvar för grundläggande utbildning, hälsovård, planläggning och tekniska tjänster, medräknat kommunala vägar och gator. Antalet kommuner är avsevärt större än i Finland och i Norge inleddes 2014 ett program i syfte att minska kommunantalet. Än så länge är de praktiska resultaten av programmet små.  
I Norge har man också grundat ett nytt statligt vägbolag, vegselskap, vars uppgift i huvudsak är att svara för större investeringsprojekt och för underhållet av dessa i det norska TEN-T-nätet. Bolaget finansieras direkt av staten och genom insamling av vägtullar. Bolaget kan också få lån av staten. Dessutom kommer det åter att startas Public Private Partnership-projekt (PPP) i Norge.  
Vägnätet i Norge finansieras både direkt med statliga medel och genom avgifter för vägtullar. I landet finns det för tillfället cirka 210 aktiva vägtullstationer där avgifterna i fråga tas ut. I Norge är vägtullavgifterna till sin natur jämställda med skatter; de samlas i huvudsak in hos privatpersoner utgående från väganvändningen. Som jämförelseobjekt kan till denna del nämnas Frankrike, eftersom det norska systemet med vägtullar påminner starkt om det franska. I Norge är det brukligt att betala vägtullavgifter åtminstone tills kostnaderna för att bygga vägen i fråga har täckts fullt ut. 
2.3.3
2.2.3 Danmark
Det danska vägnätet består av statliga vägar, kommunala vägar och gator samt enskilda vägar. I absoluta tal är vägnätet naturligtvis inte lika stort som i övriga Norden, men sett till tätheten är vägnätet helt klart störst i Norden och i Danmark sker cirka hälften av trafikarbetet på de statliga vägarna. Landsvägarna i Danmark regleras i lagen om offentliga vägar (Lov om offentlige veje). 
Den statliga vägförvaltningen Vejdirektoratet svarar för statens vägnät, i praktiken för motorvägar och andra huvudvägar, internationellt viktiga vägar och vägar som förenar olika delar av landet. Kommunerna svarar för alla andra vägar. Vejdirektoratet har ett uttalat sektoriellt ansvar för vägtrafiken och totalt 820 anställda. I Danmark ansvarar förvaltningen även i övrigt för olika sektorer, förutom Transportstyrelsen som svarar för regleringen av väg-, ban- och flygtrafiken. Danmark har också ett särskilt trafiksäkerhetsverk. En följd av en reform som genomfördes 2007 är också Vejdirektoratets sex regionala vägcenter (vejcenter). Dessa har som uppgift att tillgodose regionala behov, bland annat samarbetet med kommunerna. Vägcentren svarar också för tillsynen över den dagliga skötseln. 
Kommunreformen 2007 förde med sig ett stort antal kommunsammanslagningar och Danmark har för närvarande 98 kommuner i stället för de tidigare 271. Vid reformen övergick ansvaret för största delen (80 %) av vägarna i länen (amten) till kommunerna. Även om kommunerna fick ansvar för betydligt fler vägar och gator är trafikarbetet koncentrerat till det statliga vägnätet. Vid reformen avskaffades samtidigt de 14 amten, och för att ersätta dem inrättades fem regioner som ansvarar för bland annat hälso- och sjukvård, regional utveckling, kollektivtrafik och en del av socialväsendet. Regionerna har ingen roll inom väghållningen. Övergången från tre till två nivåer inom förvaltningen motiverades med ambitionen att förenkla förvaltningen och säkerställa utvecklingen av de nationella huvudförbindelserna. 
Den statliga danska vägfinansieringen sker över statsbudgeten, men till skillnad från situationen i Norge och Sverige har såväl regerings- som oppositionspartierna kommit överens om gemensamma satsningar på trafiknätet. Detta avtal har ingåtts för cirka fem år 
Det är till största delen avgiftsfritt för alla att använda det danska vägnätet. Undantag från regeln utgör passagen över vissa broar, såsom bron över Stora Bält och Öresundsbron, eftersom en bruksavgift tas ut hos dem som passerar dessa broar. De bolag som förvaltar broarna är en del av den större koncernen Sund og Bælt. Koncernen och dess dotterbolag lyder under dansk speciallagstiftning. 
Broavgifterna grundar sig på att det hos dem som använder dessa broar tas ut en avgift varje gång de passerar bron. Avgiften är inte fullständigt fast till sin natur. Det förekommer nämligen att avgifterna sänks till exempel på grund av vissa rabatter eller under kampanjer; då är broavgifterna lägre än normalt. Broavgifternas nivå varierar beroende på om det är fråga om fordon som registrerats för privat bruk eller för ett företags bruk. Dessutom påverkas avgifterna av årstiden, vilken tid på dygnet det är och antalet passager. 
2.4
Bedömning av nuläget
Landsvägslagen 
Utvecklingen i världen och i det finländska samhället utmanar till nya åtgärder. Omvärldsförändringar påverkar planeringen av trafik och trafiksystem. Sådana förändringar är exempelvis omvälvningarna inom mobiliteten, den omständigheten att regionstrukturen differentieras, de växande stadsregionerna och urbaniseringen samt befolkningsförändringar, klimatutmaningar och energifrågor, principerna för hållbar utveckling, digitaliseringen och automatiseringen, de nya trafiktjänsterna samt förändringarna i förvaltningsstrukturerna. Dessa utvecklingstrender har långvariga verkningar för hur pass väl Finland klarar sig. Landsvägsnätet förutsätts tillgodose olika behov i fråga om såväl resor som transporter. Samtidigt har också kraven på trafiksystemets servicenivå ökat. 
Landsvägsunderhållet diskuteras livligt. Ett tema som stiger fram i diskussionerna är kvalitetskontrollen i samband med väghållning och allmänt taget hur finansieringen av bastrafikledshållningen ska fås att räcka till. Också regleringen i landsvägslagen behöver ses över med beaktande av denna diskussion. 
Skrivningarna i landsvägslagen om väghållare, väghållningsmyndighet och skötseln av myndighetsuppgifter även i ett bredare perspektiv behöver ses över på grund av riktlinjerna i landskapsreformen. Enligt regeringen är det också viktigt att trafiknätet är enhetligt och att staten fortsätter att äga landsvägsnätet. Det är nödvändigt att fastställa landskapens roll i den regionala väghållning som gäller landsvägarna samt landsvägsägaren statens och dess trafikförvaltnings roll i relation till landskapen när det gäller skötseln av trafikuppgifterna i landskapslagen. Arbets- och ansvarsfördelningen mellan olika aktörer i den nya situationen måste skrivas in i landsvägslagen. 
Eftersom staten kvarstår som ägare av landsvägsnätet och för att väghållningen ska vara hållbar ur ett nationellt perspektiv är det enda sättet att slå vakt om att vägnätet och servicenivån förblir enhetliga i landets olika delar att uppgifterna sammanförs i form av landskapsövergripande samarbete och att särskild finansiering är tillgänglig. För den regionala väghållningen avsätts så kallad särskild finansiering under kommunikationsministeriets huvudtitel. Det är nödvändigt att i landsvägslagen ta in grundläggande bestämmelser om den särskilda finansieringen och inriktningen av den. 
Under årens gång har produktiviteten inom väghållningen förbättrats genom att man effektiviserat organisationsstrukturen och koncentrerat funktionerna. Senast inleddes i början av 2016 verksamhet med upphandlingsområden som svar på krav som ställts i en samarbetsprocess där NTM-centralerna deltagit. Det är viktigt att slå vakt om nyttan av nuvarande koncentreringar, och därför behöver bestämmelser om sammanförande av uppgifter föras in i landsvägslagen. 
Det är meningen att de regionala väghållningsuppgifterna enligt 6 § 1 mom. 14 punkten i landskapslagen ska utföras avtalsbaserat. Det är möjligt att i avtalen komma närmare överens med landskapen inom väghållningsområdet om väghållningen i alla landskap som området ska sköta. I landsvägslagen behöver det föras in närmare bestämmelser om avtalsförfarandet och innehållet i avtalen samt om den roll som den statliga trafikförvaltningen ska spela i sin egenskap av företrädare för landsvägsnätets ägare i relation till landskapen. 
Merparten av NTM-centralernas personal inom ansvarsområdet för trafik anställs hos landskapen i samband med reformen. Bestämmelser om personalens ställning, behandlingen av ärenden som är anhängiga när lagen träder i kraft, överföringarna av befintliga serviceavtal som gäller väghållning samt andra eventuellt behövliga övergångsbestämmelser bör föras in i den lag där de egentliga substansändringarna görs. 
För närvarande finns inga bestämmelser om innehållet i och tillvägagångssätten vid trafiksystemplanering. Enligt landsvägs- och banlagen ska trafikledslösningarna grunda sig på trafiksystemplanering. Det finns i nuläget inga riktlinjer för det riksomfattande trafiksystemet som kan jämföras med de riksomfattande målen för områdesanvändningen eller med statsrådets regionutvecklingsbeslut. Det är angeläget att grunden för ett fungerande samarbete mellan landskapen och staten består av insynsvänligt beredda rikstäckande och långsiktiga mål och riktlinjer för trafiksystemet; de kan i sin tur bidra till tryggandet av en enhetlig servicenivå för dem som använder trafiksystemet. Riktlinjerna och de medel som avsatts för finansieringen av dem bör uttrycka en nationell vision om trafiksystemets servicenivå och utveckling med tanke på landskap, kommuner, näringsliv och andra aktörer. För tydlighetens skull är det viktigt att trafiksystemplaneringen och aktörernas roller samt, som en ny sak, den riksomfattande trafiksystemplaneringen regleras i lag. 
Med tanke på fastställandet av landsvägarnas servicenivå är det viktigt att föreskriva om klassificeringen av landsvägar så att den tillgodoser kundernas behov och erbjuder användarna enhetliga trafikförhållanden. När servicenivån på resor och transporter bestäms i samband med trafiksystemplanering, planläggning och planering av investeringar har man tillämpat en inofficiell klassificering i nationellt viktiga stomvägar och det övriga huvudvägnätet. Med huvudvägar avses riks- och stamvägar. Det finns goda erfarenheter av både klassificeringen av landsvägar och servicenivåtänket i samband med den, och det är angeläget att få stöd för detta genom lagstiftning. En klassificering av vägnätet och lagbestämmelser om servicenivån bör emellertid inte ensamma vara en grund för prioriteringen av nationella investeringar, utan objektens vikt bör bestämmas utifrån behoven och brister i servicenivån. Ställningen i vägnätet bör vara en viktig planeringsgrund som styr såväl måluppställning som lösnings- och planeringsprinciper. 
Servicenivån i stomnätet av huvudvägar bör vara högre än i det övriga nätet på grund av stomnätets trafikmässiga betydelse. En jämn färdhastighet och möjlighet att förutsäga restiden är viktiga faktorer för dem som rör sig långa sträckor och för den yrkesmässiga trafiken. Särskilt för den tunga trafiken medför inbromsningar och accelerationer till följd av väganslutningar och varierande hastighetsbegränsningar problem. Yrkestrafikanterna bör erbjudas en trygg arbetsmiljö i trafiken samt en jämn och enhetlig nivå på underhållet, vilket gör det möjligt att hålla en jämn och trygg färdhastighet.  
För närvarande fattas besluten om planeringsbehov och planeringsobjekt i samarbete mellan NTM-centralerna och Trafikverket. Det nationella planeringsprogrammet utarbetas i samarbete med NTM-centralerna, men Trafikverket svarar för och beslutar om planeringsprogrammet inom ramen för den finansiering som står till buds. För att säkerställa enhetligheten på nationell nivå och en effektiv inriktning av planeringsfinansieringen är det befogat att också i den nya situationen, när skötseln av väghållningsuppgifter överförs till landskapen, hålla kvar en motsvarande verksamhetsmodell som bygger på samarbete och där Trafikverket ser till att enhetlighet på det nationella planet uppnås. Också i fortsättningen är det viktigt att man använder planeringsgrunder för att styra planeringen av vägprojekt. För tydlighetens skull och för att trygga kontinuiteten i praktiken är det därför lämpligt att behövliga bestämmelser om planeringsgrunder fogas till landsvägslagen. Likaså är det viktigt att föreskriva om projektbedömningen i lag för att den ska vara jämförbar och öppen för insyn i hela landet och på enhetliga grunder. 
I nuläget föreskrivs det i landsvägslagen om vissa krav för utvecklande och underhåll av landsvägsnätet och byggande av landsväg. Det är ändamålsenligt att samla kraven i en enda paragraf. Dessutom är det angeläget att, i syfte att främja digitaliseringsutvecklingen och trafikens automatisering, utfärda bestämmelser om tillgängligheten till information som hänför sig till landsvägar och väghållning samt om landsvägarnas, det övriga trafiknätets och den digitala infrastrukturens kompatibilitet.  
Vägtrafikanterna bör kunna erbjudas aktuell trafikinformation och tjänster som är möjliga tack vare att trafiken automatiseras. Med väglags- och trafikinformation avses bland annat uppgifter om störningar, väglag och väglagsprognoser, trafikflyt och trafikstockningar samt viktbegränsningar på grund av tjällossning. Aktuell trafikinformation förbättrar trafiksäkerheten och möjliggör bland annat bättre förutsebarhet i fråga om res- och transporttider. Automatiseringen av vägtrafiken framskrider snabbt, och i de nya bilar som kommer ut på marknaden finns det allt mer avancerade elektroniska system till stöd för föraren. Det är viktigt att beakta automatiseringsutvecklingen i väghållningen på landsvägarna och i bestämmelser och arrangemang som gäller den. 
Till skillnad från vad som gäller till exempel järnvägssystemet finns det i landsvägslagen för närvarande inte några bestämmelser om tillsyn över väghållningen. Tillsyn utförs i dagens läge i enlighet med Trafikverkets egna riktlinjer för verksamheten och utifrån skrivningar i avtal. Trafikverket har dock inte varit behörigt att till exempel meddela bindande föreskrifter om väghållning. Riksdagens justitieombudsman har ansett att det i ljuset av 7 § 1 mom. och 22 § i grundlagen är viktigt att i lag föreskriva om säkerhetsgarantier och om anknytande övervakning (avgöranden om metrotrafiken och dess trafiksäkerhet Dnr 448/4/11 och 3865/4/12). I sitt utlåtande konstaterar justitieombudsmannen också att det allmänna intresset för regleringen och övervakningen av verksamhet är desto större ju större säkerhetsintresse som sammanhänger med verksamheten. Enligt Trafikverkets vägstatistik färdades i genomsnitt 1 327 bilar per dygn på alla landsvägar 2016. På riksvägarna färdades i genomsnitt 6 202 bilar per dygn. Säkerheten på landsvägarna är alltså föremål för ett mycket stort allmänt intresse. I landsvägslagen finns bestämmelser om allmänna principer för väghållningens säkerhet. Regleringen bör emellertid kompletteras till vissa delar. För att skyddet för de grundläggande fri- och rättigheterna ska realiseras i större utsträckning och trafiksäkerheten ska tryggas är det dessutom viktigt att Trafiksäkerhetsverket tilldelas behörighet att meddela föreskrifter som kompletterar kraven och att det föreskrivs om övervakning av skyldigheterna. 
I underhållet av vägtrummor vid anslutningar till enskilda vägar förekommer ofta brister som visar sig som skador i landsvägen. Underhållet (dräneringen) av anslutningarna är ofta bristfälligt ordnat, vilket har en negativ inverkan på landsvägskonstruktionerna. I samband med reformen behöver man undersöka möjligheterna att åtgärda problemet genom att ändra bestämmelserna om anslutningar till enskilda vägar så, att ansvaret för underhållet av trummorna vid anslutningar till enskilda vägar i fortsättningen åläggs den som sköter landsvägsunderhållet. 
Banlagen 
Till följd av landskapsreformen är det nödvändigt att ändra banlagens skrivningar om väghållare och väghållningsmyndighet. Vidare finns det skäl att i samband med reformerna dra försorg om att de lagar som handlar om statens centrala trafikleder, landsvägslagen och banlagen, är enhetliga till alla ändamålsenliga delar. I anknytning till detta kan det finnas behov av att komplettera till exempel skrivningarna om klassificering av järnvägar, de viktigaste kraven på banhållningen och bestämmande av servicenivån. 
Landskapsreformen och den övriga trafiklagstiftningen 
De uppgifter som NTM-centralernas ansvarsområden för trafik sköter överförs i huvudsak till landskapen, som blir ansvariga för dem och ska sköta dem. Uppgifterna gäller särskilt trafiksystemets funktion, den regionala väghållningen samt ordnande och planering av trafiktjänster. I och med ändringen börjar besluten fattas närmare invånarna och näringarna inom området. Ansvaret för att trafiken fungerar dagligen och för att detta säkerställs övergår från staten till landskapen, men finansieringen av väghållningen förblir särskild finansiering som staten beslutar om. Detta kommer att förutsätta att uppgifterna sammanförs, kompetensen upprätthålls och utvecklas och tillräckliga resurser anvisas för att det ska vara möjligt att klara av uppgifterna framgångsrikt och i överensstämmelse med målen.  
De författningsändringar som landskapsreformen förutsätter genomförs för trafikens del i huvudsak genom de bifogade lagarna i denna proposition. Vad ordnandet av offentlig persontrafik beträffar införlivas ändringarna med lagen om transportservice, medan de ändringar som hänför sig till köp av flygtrafik och finansiering av flygplatser införlivas med luftfartslagen. 
I propositionen ingår dessutom bifogade lagar som med anledning av landskapsreformen behöver ändras vad beträffar de behöriga myndigheterna och deras namn. 
3
Målsättning och de viktigaste förslagen
3.1
Målsättning
Syftet med propositionen är att verkställa landskapsreformen vad gäller uppgiftsområdena i 6 § 1 mom. 14 och 15 punkten och 2 mom. 1 punkten i den föreslagna landskapslagen. Syftet är att genomföra överföringen av dessa uppgifter från NTM-centralernas ansvarsområden för trafik till landskapen och att göra andra ändringar som behövs till följd av förändringarna i aktörsfältet för väghållning och trafik. 
Även om landskapen åläggs väghållningsuppgifter är avsikten inte att i samband med landskapsreformen överföra ägandet av landsvägsnätet till landskapen. Avsikten är att staten kvarstår som ägare av och ansvarig väghållare för landsvägsnätet. För att ägandet ska kvarstå hos staten krävs det att staten har tillräcklig beslutanderätt, att styrningen av landskapen säkerställs och att finansieringen av väghållningen går via staten. I annat fall skulle staten sakna faktiska möjligheter att åta sig ansvaret som ägare av landsvägarna. 
Propositionens syfte är också att säkerställa att landsvägsnätet är enhetligt på riksnivå och att landsvägarnas servicenivå är tillräcklig överallt i Finland. Centrala mål i sammanhanget är också att kvaliteten på väghållningen säkerställs och att kontrollen av den förbättras. Ett av målen för propositionen är att bidra till att trygga en tillräcklig finansiering av väghållningen i den nya modellen för ordnande av väghållningen. 
När väghållningsuppgifterna överförs från NTM-centralerna till de regionförvaltningar som bildas av de nya självstyrda landskapen är det möjligt att de olika regionerna vill välja lösningar som skiljer sig kraftigt från varandra, till exempel när det gäller landsvägsunderhållet. För vägtrafikanterna är det dock problematiskt om landsvägarnas servicenivå varierar från ett landskap till ett annat. Med tanke på förutsebarheten och planeringen av resor och transporter samt vägtrafikanternas förväntningar är det viktigt att landsvägarnas servicenivå är enhetlig i hela landet. 
Väghållningen har blivit mycket effektivare under de senaste åren, och de knappa resurserna för väghållning kommer inte att öka i samband med landskapsreformen. Ett av syftena med propositionen är därför att trygga de framgångar som har uppnåtts genom koncentrering och enhetliga förfaranden och att säkerställa att väghållningen sköts kostnadseffektivt också i fortsättningen. Dessutom är uppgifterna inom väghållningen specialuppgifter som kräver särskild expertis. I den nya situationen är det mycket viktigt att försäkra sig om att sakkunskapen bevaras. Propositionen har som mål att se till att uppgifterna inom väghållningen sköts sakkunnigt också framöver. 
Ett av målen för propositionen är att bidra till att trygga en tillräcklig finansiering av väghållningen i den nya modellen för ordnande av väghållningen.  
I statsrådets principbeslut om en förbättring av vägtrafiksäkerheten förutsätts ett brett urval av instrument, däribland förbättring av vägtrafikens infrastruktur. Enligt de trafiksäkerhetsmål som ställts upp på EU-nivå ska antalet dödsolyckor i samband med vägtrafiken halveras fram till år 2020, i förhållande till 2010 års nivå. Också denna proposition har som syfte att främja säkerheten på landsvägarna och ledningen av den. 
Trafiksystemplanering har bedrivits allt sedan 1990-talet, och 2010 blev den första gången en uppgift för landskapsförbunden. Propositionens syfte är att trafiksystemplanering som omfattar alla trafikformer och färdsätt också i fortsättningen ska utföras som en del av landskapens planeringssystem och att planen ska vara en av utgångspunkterna för den riksomfattande trafiksystemplanen. Planerna och anknytande åtgärder bidrar till att minska utsläppen av växthusgaser från trafiken, förbättra trafiksystemets energieffektivitet och på ett kostnadseffektivt sätt skapa förutsättningar för fungerande och trygga rese- och transportkedjor. 
3.2
Alternativ
De centrala utgångspunkterna vid beredningen av propositionen har varit att genomföra landskapsreformen i överensstämmelse med landskapslagen och att alla lösningar ska bidra till att trygga ett enhetligt rikstäckande landsvägsnät. Av nationell betydelse är framför allt riks- och stamvägar som betjänar den långväga trafiken, och av särskilt intresse är att servicenivån på dessa vägar är enhetlig. I samband med beredningen av propositionen har alternativen valts och bedömts utifrån dessa utgångspunkter. Bedömningen av alternativen i fråga om att organisera de uppgifter som överförs till landskapen har gällt i första hand ägandet av vägnätet, hur finansieringen ska ordnas och de rikstäckande uppgifter som för närvarande sköts av NTM-centralerna. 
I fråga om ägandet har som alternativ bedömts dels möjligheten att staten kvarstår som ägare till hela landsvägsnätet, dels att de regionala vägarna och förbindelsevägarna överförs till landskapen som i så fall äger dem och sköter väghållningen för deras vidkommande medan staten kvarstår som ägare av riks- och stamvägarna och Trafikverket svarar för väghållningen i fråga om dem. Att landskapen blir ägare till hela landsvägsnätet har inte setts som ett alternativ, eftersom riks- och stamvägarna har en särskilt stor betydelse för landsvägsnätets enhetlighet och dessutom betjänar den riksomfattande långväga trafiken. Därför behöver man i alla situationer utgå från ett nationellt perspektiv vid den väghållning och förvaltning som gäller riks- och stamvägarna. 
Bedömningen av alternativen som gäller ägandet har varit nära förknippad också med bedömningen av alternativen i fråga om finansiering av väghållningen. Vid beredningen har det ansetts att en och samma instans ska vara ägare och ha beslutanderätten i finansieringsfrågor. Om ägande och finansiering separeras till exempel så att staten kvarstår som ägare till alla landsvägar men landskapen beviljas allmän finansiering när det gäller regionala vägar och förbindelsevägar blir följden en situation som är ohållbar för ägaren. Det största problemet skulle vara att staten bär ägarens ansvar trots att besluten fattas i landskapen. Ägarens rättigheter och möjligheter att påverka användningen av anslag är då obefintliga. 
Om ägandet överförs till landskapen och allmän finansiering tillämpas när det gäller regionala vägar och förbindelsevägar finns det en risk för att de medel som avsatts för väghållning inte används för väghållning utan för andra behov i landskapen. Med beaktande av landsvägsnätets skick och det faktum att redan nuvarande finansiering är otillräcklig leder detta till att de regionala vägarna och förbindelsevägarna försämras och att reparationsskulden stiger okontrollerat. Också trafiknätets enhetlighet på riksnivå blir i så fall lidande och väghållningen splittras upp på fyra nät (enskilda vägar, gator, landskapens vägnät och riksnätet). Problemet blir då hur man ska samordna olika väghållares vägnät som ligger i ett och samma geografiska område. Men om allmän finansiering används för väghållningen och ägandet av regionala vägar och förbindelsevägar överförs, åläggs landskapen å andra sidan ett större ansvar för väghållningen i denna del av nätet, deras beslutanderätt utökas och den regionala aspekten stärks när det gäller lösningar. Detta alternativ innebär också att ingen detaljerad styrmodell behöver utvecklas för det lägre vägnätet. Det skulle dock vara svårt att samordna styrmodellerna för olika delar av nätet. Allmän finansiering och överföring av ägandet av regionala vägar och förbindelsevägar till landskapen kan dessutom stärka samordningen av markanvändning och trafik på det regionala planet. 
Om staten äger hela landsvägsnätet och finansieringen genomförs som särskild finansiering, kommer finansieringen att tilldelas landskapen via kommunikationsministeriets förvaltningsområde. Användningen av medlen och servicenivån inom trafiken bestäms då genom avtal med landskapen. Den särskilda finansieringens styrka ansågs i första hand vara att man kan uppnå en enhetlig väghållning och servicenivå inom basväghållningen, samtidigt som landskapen ändå kan påverka de regionala investeringarna i och underhållet av landsvägar. Genom särskild finansiering är det möjligt att säkerställa landsvägarnas enhetlighet på riksnivå i hela vägnätet och kunderna kan erbjudas en enhetlig servicenivå i respektive vägnätsklass oberoende av region. Servicenivån och kundinteraktionen med näringsliv och andra intressenter blir då densamma i hela landet, vilket är av vikt framför allt för aktörer med riksomfattande verksamhet. Särskild finansiering och statlig styrning gör det möjligt att inom väghållningen utnyttja marknaden på ett rationellt sätt vid upphandlingar (till exempel en jämn kvalitet på skötsel- och beläggningsentreprenader), vilket skapar stabilitet i verksamheten för företagen inom branschen. Genom statlig styrning och särskild finansiering av väghållningen kan man vidareutveckla verksamheten i enlighet med riksomfattande prioriteringar och mål, så att de åtgärder och verksamhetsmodeller som är effektivast och har den största genomslagskraften tas i bruk. Till svagheterna hos modellen med särskild finansiering hör ett eventuellt tungrott avtalsförfarande och landskapens begränsade möjligheter att påverka de riksomfattande riktlinjerna. Det är en utmaning att skapa tydliga styrmekanismer och mätare för beredning och uppföljning av hur finansieringen av basväghållningen används landskapsvis eller inom landskapens väghållningsområden. 
Vid beredningen av regeringspropositionen har man gett akt på förberedelserna för ett projekt som gällde den företagsekonomiska utvecklingen av trafiknätet. Dessa förberedelser pågick i början av propositionsberedningen och i samband med dem föreslogs en möjlighet att starta ett så kallat trafiknätsbolag. Med tanke på trafiknätsprojektet sågs det som avgörande att staten kvarstår som ägare till landsvägsnätet. Vid beredningen av propositionen har man dessutom beaktat arbetet i en parlamentarisk arbetsgrupp som dryftat finansieringen av trafiknätet för att propositionen inte ska försvåra eventuella reformer som gruppen föreslår. Också i detta arbete ansågs det vara viktigt att staten kvarstår som ägare. 
När det gäller styrningen av landskapen har man närmast sett avtalsarrangemangen i motiveringen till landskapslagen som ett alternativ. Dessutom har man dock bedömt behovet av och ändamålsenligheten hos en annan form av kompletterande styrning. Beträffande sättet att genomföra styrningen har bedömningen gällt hur exakt exempelvis landsvägarnas servicenivå behöver regleras i lag eller föreskrifter, eller om det räcker med enbart avtalsstyrning för att trygga en tillräcklig servicenivå. Å ena sidan har man bedömt den framtida ställningen för Trafikverkets nuvarande anvisningar för väghållning och behovet av att lyfta upp några av de centrala anvisningarna till föreskriftsnivå eller göra dem bindande för landskapen via avtal. Vid beredningen har man å andra sidan konstaterat vikten av olika former av informationsstyrning och försökt bedöma i vilka avseenden landskapens väghållning kan styras via sådan juridiskt icke-bindande styrning och via samarbete. 
I fråga om organiseringen av rikstäckande uppgifter bestod alternativen vid beredningen i att antingen överföra de rikstäckande uppgifterna centralt till Trafikverket eller överföra alla uppgifter till landskapen. 
Resursfrågor talar för att de rikstäckande uppgifterna överförs till Trafikverket. De fördelar som uppnåtts vid NTM-centralerna genom att uppgifterna koncentrerats kan bevaras genom att uppgifterna överförs till Trafikverket. Denna lösning säkrar att personresurserna utnyttjas effektivt, synergifördelar kan uppkomma tack vare Trafikverkets nuvarande uppgifter och det blir möjligt att utnyttja kompetensen vid Trafikverket. Genom att de rikstäckande uppgifterna koncentreras till Trafikverket säkerställs också en effektiv och sakkunnig kundservice i hela landet och en enhetlig skötsel av uppgifterna på riksnivå. En svaghet som vidlåder överföringen av uppgifterna på riksnivå till Trafikverket är framför allt att avståndet växer och försvagar förståelsen för de regionala kundbehoven. Vid vissa uppgifter behövs även regional närvaro och övervakning, till exempel vid syneförrättningar. 
Vid beredningen av propositionen har man också bedömt vilka begrepp som bör användas i lagen i fortsättningen. För närvarande är staten väghållare och Trafikverket ansvarig myndighet i väghållningsfrågor. Väghållningsmyndighet är i huvudsak NTM-centralerna, och Trafikverket är väghållningsmyndighet när det särskilt föreskrivs. Begreppen behöver ändras så att de överensstämmer med den uppgiftsfördelning som överföringen av väghållningsuppgifter till landskapen föranleder. Staten fortsätter att äga landsvägarna och har därför rollen som väghållare och ansvaret för väghållningen. I väghållningsfrågor företräder Trafikverket staten. I fortsättningen kommer landskapen och de samarbetsorgan som de bildar samt Trafikverket att vara myndigheter med ansvar för väghållning. På grund av statens ägarroll kan inte alla de väghållningsuppgifter som i nuläget sköts av NTM-centralerna överföras till landskapen. Även Trafikverket kommer således att ha kvar väghållningsuppgifter, och det i större omfattning än för närvarande. Att använda begreppet väghållningsmyndighet om två olika organisationer skulle medföra problem. När Trafikverket åläggs uppgifter, ansvar och rättigheter blir det tydligare om man använder ett annat uttryck än i bestämmelserna om de organ som ansvarar för väghållningen i landskapen. När Trafikverket är väghållare kan man använda antingen ämbetsverkets namn Trafikverket eller begreppet väghållare. I överensstämmelse med vad som anges ovan är det nödvändigt för landskapen att samarbeta kring skötseln av väghållningsuppgifter. Alternativ som finns att tillgå när man talar om den aktör som har ansvar för väghållningen i landskapen är åtminstone landskapet och väghållningsområdet. Eftersom målet är att landskapen själva ska få bestämma formen för det samarbete som bedrivs vid skötseln av väghållningsuppgifter inom de gränser som landskapslagen möjliggör, och eftersom ingen av samarbetsformerna medför en fristående organisation eller juridisk person är det i sista hand landskapen som ansvarar för skötseln av uppgifterna. Därför är det överskådligast att helt enkelt föreskriva att landskapet ska ha hand om uppgifterna. Exempelvis begreppet väghållningsområde kan inte användas, eftersom det då blir oklart på lagnivå vilken den ansvariga parten är. 
Begreppen för underhåll av vägar skiljer sig från varandra inom den statliga och den kommunala sektorn. Ett resultat av samarbete inom Bygginformationsstiftelsen är en rekommendation om att övergå till att som överbegrepp använda underhåll och som underbegrepp använda skötsel och reparation i stället för de nuvarande begreppen skötsel och upprätthållande som används i statliga sammanhang. Vid beredningen har behovet av att ändra begreppen i samband med denna reform, alternativt bibehålla den gamla praxisen tills vidare, bedömts. Genom lagstiftning är det dock möjligt att styra införandet av nya begrepp. Därför är det motiverat att redan nu införa de nya begreppen. 
För närvarande finns det knappt någon lagstiftning om landskapets och statens trafiksystemplaneringsuppgifter. I den nya situation som uppstår i och med landskapsreformen blev det aktuellt att i samband med beredningen bedöma huruvida det i fortsättningen behöver lagstiftas om uppgifterna och arbetsfördelningen. Lagstiftning sågs som behövlig framför allt med tanke på långtidsperspektivet och en överskådlig arbetsfördelning. Det gällde också att bedöma i vilken lag det vore mest naturligt att placera trafiksystemplaneringen som helhet. Ett alternativ är till exempel lagen om regionutveckling och tillväxttjänster, som bereds av arbets- och näringsministeriet och som kommer att ersätta den nuvarande lagen om utveckling av regionerna och förvaltning av strukturfondsverksamheten, som för närvarande innehåller ett kort omnämnande av landskapsförbundens roll vid trafiksystemplaneringen. Trots att trafiksystemplaneringen har en nära anknytning till den övriga planeringen av områdesanvändningen kan det vara mer ändamålsenligt att ta med regleringen om trafiksystemet i en författning på trafikområdet. Ett annat alternativ skulle kunna vara exempelvis lagen om transportservice, där bestämmelserna om trafikmarknader och trafiktjänster för de olika trafikformerna är samlade. Trafiksystemplaneringen har via sin koppling till områdesanvändningen av hävd haft ett starkt samband med de fysiska trafiklederna. Eftersom det inte finns en enda författning som gäller trafiklederna för alla trafikformer, är det ett alternativ att låta regleringen om trafiksystemplanering ingå i någon av de befintliga trafikledslagarna. Det är också möjligt att stifta en helt ny lag om trafiksystemplanering. Eftersom de väghållningsuppgifter som anges i 6 § 1 mom. 14 punkten i landskapslagen kommer att överföras till landskapen genom landsvägslagen, är landsvägslagen den befintliga trafikledslag som är den naturligaste platsen för regleringen, eftersom det i den är möjligt att sammanhållet föreskriva om landskapens uppgifter inom väghållning och trafiksystemplanering. 
Under beredningen av propositionen har lagen om transportservice (320/2017) delvis satts i kraft redan. Den kommer under de närmaste åren att omdana hela trafiksystemet på ett framträdande sätt genom att den ger dem som använder trafiksystemet tillfälle att utveckla nya slag av högklassiga, förmånliga och effektivt producerade mobilitetstjänster och servicehelheter som motsvarar deras behov. Ambitionen är att genom lagen svara på de utmaningar och möjligheter som nya globala fenomen såsom automatisering, digitalisering och delningsekonomin för med sig och som sätter sin prägel på hela samhället som verksamhetsmiljö. Samma omvärldsförändringar kommer att påverka trafiksystemplaneringen också på andra sätt än beträffande mobilitetstjänster, till exempel genom 3D-utskrivning och lösningar som gäller virtuell verklighet; dessa kan påverka mobilitetsbehoven för både människor och varor. De nya tjänsterna baserar sig på effektivt utnyttjande av information samt på digitalisering, automatisering, nya innovationer och nya slag av affärsverksamhetsmodeller. Skrankorna mellan serviceformer, till exempel mellan mobilitetstjänster och välfärdstjänster, blir lägre, vilket betyder att olika serviceformer integreras och nya servicehelheter bildas. De nya tjänsterna och servicehelheterna i kombination med heltäckande och driftssäkra trafik- och kommunikationsförbindelser möjliggör rese- och transportkedjor som är ännu högklassigare och mer helgjutna från användarnas synpunkt. De nya tjänsterna breddar i stor utsträckning urvalet av metoder för utveckling av trafiksystemet. För trafiksystemplaneringen innebär detta en övergång från ett betraktelsesätt som baseras på trafikleder till användarorienterad planering där nya slag av mobilitetstjänster, information och åtgärder som utvecklar trafik- och kommunikationsförbindelserna utnyttjas och kombineras mångsidigt för att resorna och transporterna ska fungera bättre.  
Antagligen kommer nya slag av mobilitetstjänster och servicehelheter att utvecklas snabbt efter att lagen trätt i kraft, och de kommer att förändra människornas och företagens beteendemönster. Många nya tjänster uppkommer helt och hållet på marknadsvillkor. De verkningar som tjänsterna på marknadsvillkor, vilka ibland kan förändras rentav mycket snabbt, har bör beaktas som ett inslag i offentliga långtidsplaner. Trafiksystemplaneringen bör vara kontinuerlig, engagerande och interaktiv samt smidig så att behovet av och kvalitetsnivån hos de lösningar som ingår i planerna utvärderas när efterfrågan förändras och när nya slag av ersättande eller kompletterande tjänster utvecklas. Verktyg som utgår från information och ny teknik kan och bör utvecklas och utnyttjas bättre än förr inom trafiksystemplaneringen vid uppföljning av användarerfarenheter och användarnöjdhet samt vid uppföljning av planernas aktualitet, utfall och genomslagskraft.  
Medan beredningen av propositionen pågått har en ämbetsverksreform inom kommunikationsministeriets förvaltningsområde börjat beredas. De ändringsbehov och anknytande genomförandealternativ som ämbetsverksreformen föranleder i fråga om lagarna i denna proposition bedöms emellertid i samband med att en proposition om ämbetsverksreformen bereds. Hur de uppgifter som ska skötas av Trafikverket, vilket i denna proposition föreslås vara väghållare, ska förläggas inom den statliga trafik- och kommunikationsförvaltningen kommer att avgöras i samband med ämbetsverksreformen, och de uppgifter som i denna proposition åläggas Trafikverket förläggs till följd av lösningarna i samband med ämbetsverksreformen till antingen Trafikledsverket eller Transport- och kommunikationsverket. 
3.3
De viktigaste förslagen
Genom propositionen genomförs de uppgiftsöverföringar från NTM-centralernas ansvarsområden för trafik till landskapen som anges i 6 § 1 mom. 14 och 15 punkten och 2 mom. 1 punkten i förslaget till landskapslag. Uppgifterna gäller trafiksystemplanering, offentlig persontrafik och väghållning. 
3.3.1
3.3.1 Landsvägslagen
I landsvägslagen görs för det första behövliga ändringar och tillägg som hänför sig till ordnande av väghållningen. Väghållningsuppgifterna fördelar sig i fortsättningen mellan staten och landskapen. Bestämmelser om avtalsbaserad skötsel av väghållningen i samarbete mellan staten och landskapen behövs. I denna helhet gäller det att säkerställa att landsvägsnätet är enhetligt i hela landet.  
För det andra fogas till lagen som en ny helhet bestämmelser om trafiksystemplanering på riks- och landskapsnivå.  
Vidare görs vissa substansändringar som har med väghållningen att göra. De viktigaste av dem gäller klassificering av landsvägar, allmänna krav för väghållning, landsvägarnas servicenivå och underhåll samt tillsyn över väghållningen. Också bestämmelser om ett säkerhetsstyrningssystem för väghållningen och om beredskap föreslås bli fogade till lagen. 
Modell för ordnande av väghållningen 
I lagens 1 kap. föreskrivs om de grundläggande lösningar som krävs på ett allmänt plan i den nya situationen, såsom landskapens och statens roller och ansvar inom väghållningen, särskild finansiering av väghållningen, avtal mellan staten och landskapen, vad som krävs för att landsvägarnas servicenivå ska kunna bestämmas samt allmänna krav för väghållning. Lagen kompletteras med ett nytt kapitel, 1 b, som handlar om ordnande av skötseln av väghållningsuppgifter och om förhållandet mellan staten och landskapet i det avseendet. I kapitlet föreskrivs det mer detaljerat om skötseln av väghållningsuppgifter i landskapen, om avtalen mellan staten och landskapen samt om den särskilda finansieringen av väghållning. Väghållaren föreslås vara Trafikverket, som företräder staten, och begreppet väghållningsmyndighet som används i gällande lag stryks. 
Det gäller för landskapen att samarbeta om skötseln av de väghållningsuppgifter som åläggs dem i den föreslagna lagen. Det sker genom att landskapen bildar högst nio väghållningsområden, vilka organiseras genom någon form av samarbete mellan landskap som det föreskrivs om i 8 kap. i landskapslagen. Med väghållningsområde avses därmed ett område som fastställs genom ett samarbetsavtal mellan landskapen och inom vilket de väghållningsuppgifter som landskapen i området ska ansvara för sköts i enlighet med samarbetsavtalet. 
De samarbetsformer som anges i landskapslagen innebär inte att en fristående juridisk person inrättas. Därför föreskrivs det i den föreslagna lagen att de väghållningsuppgifter som åläggs landskapen, till exempel planeringen av landsvägar enligt 2 kap., ska skötas av landskapet. Det förutsätts ändå att dessa uppgifter utförs i samarbete mellan landskapen inom väghållningsområdena. Inte heller definieras det desto närmare vilken aktör som ska svara för väghållningen inom landskapens väghållningsområden, utan landskapen får komma överens om detta i sina samarbetsavtal. 
Landskapen ska enligt förslaget avtala om väghållningsområdena så att väghållningen är kostnadseffektiv, enhetlig, sakkunnig och långsiktig, den servicenivå som krävs uppnås och kundernas behov beaktas samt de väghållningsområden som bildas är ändamålsenliga. Om samarbetsförhandlingarna inte leder till samförstånd mellan parterna, ska statsrådet på föredragning från kommunikationsministeriet fatta beslut om landskapens samarbete kring skötseln av de regionala väghållningsuppgifterna. 
De uppgifter som i fortsättningen ska skötas av landskapen inom väghållningsområdena är planering av väghållning och finansiering, beredning av planen för väghållning och trafik och avtalen om väghållning, planering av landsvägsprojekt samt upphandlingen i samband med planering, underhåll och byggande av landsvägar samt anknytande tillsyn. I detta samband ska landskapet även ha ett betydande ansvar att säkra den fungerande marknaden som har samband med väghållning. Ur serviceproducentens synvinkel är viktiga synpunkter fram-förallt anskaffningarnas enhetliga innehåll samt anskaffningarnas tidtabell och omfattning. 
Finansieringen av den väghållning som landskapen ansvarar för föreslås bli specificerad enligt landskap baserat på vägnätets och trafikens egenskaper och andra omständigheter för att trygga ett enhetligt landsvägnät i likartat skick. Trafikverket ska tilldela varje landskap finansiering och reservera medel för väghållningsområdet enligt avtalet om väghållning. En del av statsbudgetanslaget för väghållning inom bastrafikledshållningen ska Trafikverket reservera för riksomfattande väghållningsuppgifter, till olika temaprogram och till akuta eller oförutsedda reparationsbehov.  
Inom väghållningsområdet föreslås staten styra den väghållning som är en uppgift för landskapen genom avtal om väghållning, informationsstyrning och eventuella föreskrifter som utfärdas av Trafiksäkerhetsverket och preciserar de allmänna kraven för väghållning. De synpunkter som staten i egenskap av ägare till landsvägsnätet har och de trafikpolitiska riktlinjer som regeringen fastställer i egenskap av utövare av den högsta regeringsmakten kan inkluderas i styrningen av landskapen och i avtalsprocessen via kommunikationsministeriets resultatstyrning av Trafikverket, och även långsiktigt genom den riksomfattande trafiksystemplan som föreslås i 1 a kap. 
Utifrån trafiksystemplanerna ska det under varje fullmäktigeperiod utarbetas en plan för väghållning och trafik för varje landskap. Planen föreslås bli en del av processen kring väghållningsavtalen mellan staten och landskapen. Planen ska vara ett centralt dokument vid Trafikverkets och väghållningsområdets förhandlingar om avtalet om väghållning. Avtalet ska undertecknas av en företrädare för Trafikverket och företrädare för landskapen inom väghållningsområdet. 
I avtalet om väghållning ska parterna avtala om den finansiering som behövs för skötseln av de uppgifter som ankommer på väghållningsområdet och hur den ska fördelas, om målen för väghållningen, om målen för verksamheten och ekonomin och om rapporteringen. Avtalet föreslås innehålla bestämmelser om den finansiering som avsätts för att användas av landskapen inom väghållningsområdet. Om Trafikverket och landskapen inom väghållningsområdet inte kan nå enighet vid avtalsförhandlingarna, ska kommunikationsministeriet, Trafikverket och landskapen inom väghållningsområdet förhandla om saken. Vid behov fattar statsrådet på föredragning från kommunikationsministeriet beslut om de frågor som ska avgöras genom avtalet om väghållning. 
Målet är att anpassa samarbetet i trafik- och väghållningsuppgifter mellan landskapen och staten till andra förhandlingsförfaranden. Dessa är beredningen av planen för de offentliga finanserna samt diskussionerna mellan staten och landskapen om utveckling av regionerna. 
I fortsättningen ska Trafikverket svara för de uppgifter som åligger staten i egenskap av ägare till landsvägsnätet samt för väghållningsuppgifterna på riksnivå. Till uppgifterna på riksnivå hör bland annat de uppgifter av nationell betydelse som för närvarande är koncentrerade till en enda NTM-central. De specialiseringsuppgifter som nu är koncentrerade till en enda NTM-central och tillståndsuppgifterna inom väghållningen behandlas mer detaljerat i avsnitt 2.4 Bedömning av nuläget. 
Förutom de uppgifter som nu är förlagda till en enda NTM-central föreslås det att den uppgiftshelhet som är knuten till statens ägande av trafikleder och gäller anskaffning av markområden för vägar och banor samt förvaltning av fastigheter överförs från NTM-centralerna till Trafikverket. Trafikverket företräder staten, som äger landsvägarna. Landsvägarna tas upp i Trafikverkets balansräkning och Trafikverket förvaltar dem. För närvarande är den anskaffning av mark för trafikledsnätet som sköts av NTM-centralerna för Trafikverkets räkning en fråga om förvaltning av statlig jordegendom och inte väghållning, och den kan således inte överföras till landskapen. 
Beträffande tillståndsuppgifterna inom väghållningen föreslås det att också de tillstånd som för närvarande sköts inom alla de nio NTM-centralerna med ansvarsområden för trafik ska överföras till Trafikverket som en del av de samlade tillståndsuppgifterna. Genom att koncentrera tillståndsuppgifterna till Trafikverket kan man trygga en enhetlig och jämlik behandling av kunderna i hela landet samt en effektiv tillståndsverksamhet med möjlighet till utveckling. I regeringens proposition med förslag till vägtrafiklag och till vissa lagar som hänför sig till den (RP 180/2017 rd) föreslås på motsvarande sätt att beviljandet av tillstånd för specialtransport ska överföras till Trafikverket.  
Exempel på de rikstäckande väghållningsuppgifter som för närvarande sköts vid Trafikverket är styrning av vägtrafiken, trafik- och vägmätningar och anknytande register samt det nationella programmet för planering av vägprojekt. Dessutom föreslås följande rikstäckande uppgifter bli överförda från NTM-centralerna till Trafikverket:  
– tillståndsuppgifter inom väghållningen 
– skadeersättningar och förflyttningar av fordon 
– museiverksamhet och traditionsarbete 
– landsvägsfärjetrafiken 
– styrning av och stöd för konkurrensutsättningen av områdesentreprenader för vägunderhållet 
– anskaffning av markområden för vägar och banor samt förvaltning av fastigheter. 
Lagen föreslås bli kompletterad genom att det föreskrivs att Trafikverket, som i fortsättningen ska sköta exempelvis tillståndsuppgifterna inom väghållningen, ska ha möjlighet att genom avtal delegera till en privat tjänsteleverantör sådana biträdande uppgifter i terräng som anknyter till dessa och till andra uppgifter. 
Regeringens finanspolitiska ministerutskott beslutade den 13 juni 2017 att Trafikverkets trafikstyrningsfunktioner ska bolagiseras. Det är meningen att en proposition om detta ska överlämnas till riksdagen våren 2018. I propositionen föreslås att de trafikstyrningsfunktioner som gäller väg-, sjö- och järnvägstrafiken och som för närvarande sköts vid Trafikverket ska ombildas till ett helt statsägt aktiebolag som inleder sin verksamhet den 1 januari 2019. I fortsättningen köper Trafikverket de trafikstyrningstjänster som behövs inom väghållningen av det trafikstyrningsbolag som avses bli bildat. Av de uppgifter som sköts av enheten för trafiktelematik vid NTM-centralen i Sydöstra Finland hör sakkunniguppgifterna inom trafikledning och telematik till det framtida trafikstyrningsbolagets uppgiftsområde. De telematikrelaterade uppgifterna att utveckla upphandlingarna, upphandlingsprogrammet, utvecklingen av smart trafik, planeringen av verksamhetsmodeller, det internationella samarbetet och medverkan i internationellt samarbete kring utveckling av vägvädersystem och vägvädertjänster samt samordningen av det nationella samarbetet ska enligt propositionen fortsätta att vara statliga uppgifter, och i fortsättningen ska de skötas vid Trafikverket. Likaså ska Trafikverket enligt förslaget ha hand om sakkunniguppgifter på tunnelsäkerhetens område. Vidare är det meningen att Trafikens kundservicecenters nuvarande uppgifter ska ingå i uppgiftsområdet för det trafikstyrningsbolag som föreslås bli bildat. Därför föreslås det att de uppgifter vid NTM-centralernas ansvarsområden för trafik som är relaterade till trafiktelematik samt kundservicecentralen och den personal som sköter uppgifterna överförs till det nya trafikstyrningsbolaget när NTM-centralerna upphör med sin verksamhet vid ingången av 2020.  
Trafiksystemplanering och andra trafikuppgifter 
Det föreslås att lagen kompletteras med ett 1 a kap. som handlar om trafiksystemet och att lagens tillämpningsområde breddas så att det omfattar också trafiksystemplanering på riks- och landskapsnivå som täcker alla trafikformer och färdsätt. Lagens rubrik ändras därför till lagen om trafiksystem och landsvägar. Syftet med lagen är att reglera trafiksystemets innehåll, främja en långsiktig och samarbetsbaserad trafiksystemplanering som är smidig och inte räds experiment och som samordnar nationella och regionala mål och att på så sätt skapa förutsättningar för ett fungerande trafiksystem som kan utvecklas. Lagen avses inte innehålla bestämmelser om trafiksystemplaneringen i kommuner och städer.  
Enligt den föreslagna lagen ska vart och ett av de 18 landskapen ha som trafikuppgift att svara för landskapets trafiksystemplanering och för att den integreras med landskapets övriga planering och med de angränsande landskapens trafiksystemplanering, samt att svara för samarbetet med olika aktörer i trafiksäkerhetsarbetet och i fråga om markanvändningen. Varje landskap ska också besluta om landskapets plan för väghållning och trafik och om godkännandet av avtalet om väghållning. Planen och avtalet kan dock beredas av en aktör som parterna inom väghållningsområdet enats om. Landskapets trafiksystemplan kan också vara en del av landskapsstrategin eller av landskapets övriga strategiska planering.  
I 1 a kap. föreskrivs om trafiksystemplanering. Där definieras trafiksystemplaneringen, målen för den och de instanser som ansvarar för den. Kapitlet innehåller bestämmelser om utarbetande av trafiksystemplaner på riks- och landskapsnivå och om förfarandena vid beredningen. Trafiksystemplaneringen avses vara en kontinuerlig och interaktiv process.  
En parlamentarisk arbetsgrupp som bedömt finansieringen av trafiknätet föreslog i sin slutrapport (den 28 februari 2018) att trafiknätet i fortsättningen ska underhållas och utvecklas utgående från en riksomfattande 12-årig trafiksystemplan som beretts parlamentariskt. Trafiksystemplanen bör enligt arbetsgruppen innefatta bland annat projekt som är av stor betydelse för utvecklandet och underhållet samt utveckling av trafiktjänsterna. Detta motsvarar den föreslagna regleringen om trafiksystemplanering på riksnivå. 
I den riksomfattande trafiksystemplanen kan man ange strategiska mål för hela trafiksystemet på lång sikt och för olika trafikformer samt nivån på finansieringen och modeller för den. Planen föreslås kunna styra samarbetet och förhandlingarna mellan staten och landskapen, påverka definitionen av servicenivån och ge utgångspunkter för landskapens trafiksystemplanering. Den riksomfattande trafiksystemplanen uttrycker en nationell vision för trafiksystemet och dess utveckling som landskapen, näringslivet och medborgarna fritt får använda. Dessutom bidrar planen till att trygga en enhetlig servicenivå för användarna av trafiksystemet i hela landet. 
Den riksomfattande trafiksystemplanen inlemmas i helheten av samlade planer och beslut på riksnivå. Andra dokument av liknande slag är till exempel de riksomfattande målen för områdesanvändningen som grundar sig på markanvändnings- och bygglagen och som miljöministeriet bereder. Ett annat sådant dokument är det regionutvecklingsbeslut som ingår i utkastet till lag om regionutveckling och tillväxttjänster och som avses bli berett under ledning av arbets- och näringsministeriet. Ett tredje dokument är planen för de offentliga finanserna, vilken utarbetas under ledning av finansministeriet. Rikstäckande planer och beslut inom andra förvaltningsområden innehåller också trafikfrågor, men för närvarande finns det inte något instrument som skulle ange riktlinjerna för trafiksystemet som helhet på lång sikt. Det föreslagna dokumentet med rikstäckande riktlinjer står dessutom i växelverkan med regeringsprogrammet och budgeten samt beredningen av dem. I den riksomfattande trafiksystemplanen bör det ingå ett finansierings- och åtgärdsprogram för trafiksystemet där tidsperspektivet är 10–12 år. Planen bör uppdateras under varje regeringsperiod och vid behov till följd av betydande omvärldsförändringar. 
Kommunikationsministeriet ska svara för beredningen av den riksomfattande trafiksystemplanen i samarbete med olika aktörer. Statsrådet kan fatta beslut om plane,n som kan lämnas till riksdagen i form av ett meddelande. Trafikverket ska tillhandahålla den information och tillföra den sakkunskap som behövs för att utarbeta planen samt samarbeta med kunder och intressenter vid beredningen. Också Trafiksäkerhetsverket ska enligt förslaget delta i den riksomfattande trafiksystemplaneringen, särskilt med avseende på trafiktjänsterna inom persontrafiken, och stödja ministeriet med avseende på den strategiska trafiksystemhelheten. Landskapens och stadsregionernas trafiksystemplaner utgör centralt utgångsmaterial för planeringen.  
Landskapet ska svara för att landskapets trafiksystemplan utarbetas och de avsnitt som gäller landskapets trafikuppgifter och vägtrafik bereds. Landskapet ska också svara för att trafiksystemplaneringen i fråga samordnas med annan planering i landskapet och med den rikstäckande, landskapsövergripande och kommunala planeringen. Trafikverket ska delta aktivt i beredningen av landskapens trafiksystemplanering; verkets utgångspunkt är det riksomfattande trafiksystemet och den spårbundna trafiken samt vattentrafiken. Också Trafiksäkerhetsverket ska enligt förslaget delta i trafiksystemplaneringen på landskapsnivå. 
Landskapets trafiksystemplan sträcker sig över flera år och kan vara landskapsövergripande. Den kan också vara en del av landskapsstrategin eller av landskapets övriga strategiska planering. Den riksomfattande trafiksystemplanen och landskapens trafiksystemplaner ska enligt förslaget beredas i bred växelverkan med aktörer som har en anknytning till trafiksystemet. 
Substansändringar som gäller landsvägar och väghållning 
Vid klassificeringen av landsvägar bevaras klassificeringen i riks- och stamvägar samt regionala vägar och förbindelsevägar enligt gällande lag. Dessutom anges i lagen hur det ska bestämmas vad det nationellt viktiga stomnätet omfattar. Behörigheten att klassificera landsvägar och besluta om stomnätet förtydligas och ändras så, att kommunikationsministeriet bemyndigas att genom förordning utfärda bestämmelser om klassificering av landsvägar i riksvägar, stamvägar, regionala vägar och förbindelsevägar och om till vilka delar landsvägarna hör till det nationellt viktiga stomnätet. Kommunikationsministeriet inledde i december 2017 tjänstemannaberedning för fastställande av det nationellt viktiga stomnätet i fråga om lands- och järnvägar.  
De allmänna kraven för landsvägar och väghållning förtydligas. I fortsättningen uppräknas de allmänna kraven för landsvägar överskådligt i en enda bestämmelse, som kompletteras av de nya bestämmelserna om servicenivån på resor och transporter samt om nivån på underhållet. De allmänna kraven för landsvägar och servicenivån på resor och transporter bör ställas i proportion till respektive landsvägs trafikmässiga betydelse. Det är meningen att de allmänna kraven för väghållning ska styra all väghållning, det vill säga planering och byggande av landsvägar, beslutsfattandet om utvecklingsinvesteringar, daglig vägskötsel och landsvägsreparationer samt trafikledning.  
Med avvikelse från gällande lag definieras i förslaget servicenivån på resor och transporter i det nationellt viktiga stomnätet och i fråga om sådana riks- och stamvägar respektive regionala vägar och förbindelsevägar som inte hör till stomnätet. På detta sätt vill man trygga en hög servicenivå i det nationellt viktiga stomnätet, framför allt för den långväga trafiken. Beträffande stomnätet bör man särskilt uppmärksamma en jämn färdhastighet, trafiksäkerhet, goda möjligheter att förutse restiden och aktuell trafikinformation. Dessa särskilda krav utgår från stomnätets roll som en betydelsefull trafikförbindelse för den tunga trafiken, arten och omfattningen av kundernas behov i fråga om stomnätet samt stomnätets betydelse inom trafiksystemet. I fråga om servicenivån på landsvägar som inte hör till stomnätet framhålls vikten av att beakta kundernas behov och trafikledernas trafikmässiga betydelse. Dessutom föreslås närmare bestämmelser om servicenivån kunna bli utfärdade genom förordning av kommunikationsministeriet.  
För att den servicenivå på resor och transporter som förutsätts i lag ska nås i nätet behövs en viss underhållsnivå. Begreppen i samband med underhåll av vägarna justeras i enlighet med rekommendationer som utarbetats inom branschen så, att begreppet upprätthållande ersätts med begreppet reparation. I och med detta inbegriper underhåll i fortsättningen skötsel och reparation. Målet är att man i kommunerna ska gå in för att använda samma begrepp. 
Till lagen fogas bestämmelser om nivån för underhållet av landsvägar som hör till stomnätet, riks- och stamvägar som inte hör till stomnätet respektive regionala vägar och förbindelsevägar som inte hör till stomnätet. De föreskrivna nivåkraven ska i fortsättningen beaktas när beslut om den statliga finansieringen av väghållningen fattas och när landskapen sköter sina väghållningsuppgifter. Den finansiering som är tillgänglig för väghållning påverkar såväl uppnåendet av servicenivån på resor och transporter som nivån på underhållet. Den parlamentariska arbetsgrupp som bedömt finansieringen av trafiknätet föreslog i sin slutrapport (den 28 februari 2018) en nivåhöjning på lång sikt för finansiering av bastrafikledshållningen som är åtminstone 300 miljoner euro. Denna föreslagna finansieringsnivå motsvarar den finansieringsnivå som under den innevarande regeringsperioden har riktats till bastrafikledshållning, när också tilläggsfinansieringsprogrammen beaktas. Enligt den parlamentariska arbetsgruppen bör åtgärderna för att minska reparationsskulden främst styras till det centrala trafikledsnätet, där reparationsskuld uppkommer snabbast. Reparationsskulden på lågtrafikerade trafikleder bör enligt slutrapporten minskas så att näringslivets behov prioriteras, utan att medborgarnas mobilitetsbehov glöms bort. Skrivningen är i linje med de paragrafer i denna proposition som handlar om nivån på underhållet och det har bedömts att den föreslagna nivåhöjningen av anslaget gör det möjligt att fullgöra de skyldigheter beträffande landsvägsunderhållet som anges i landsvägslagen. 
Målet är att den dagliga skötseln ska stödja en trygg färdsel på landsvägarna och att reparationsskulden inte ska öka i vare sig stomnätet eller på andra riks- och stamvägar och att den ska förbli under kontroll också på de regionala vägarna och förbindelsevägarna. Genom förordning av kommunikationsministeriet får det utfärdas bestämmelser om nivån på underhållet och om mer detaljerade underhållsklasser.  
I samband med reformen fogas till lagen också nya krav som gäller tillsynen. Lagbestämmelser om Trafikverkets (väghållarens) och landskapens egenkontroll föreslås. Dessutom åläggs landskapen att se till att tillräckliga bestämmelser om tillsyn tas in i entreprenadavtalen. Med detta avses bestämmelser om både tillsyn som landskapet utför i egenskap av beställare och serviceproducentens egenkontroll. Egenkontrollen avses innefatta bland annat åtgärder som bygger på uppföljning och iakttagelser samt offentlig rapportering av dem.  
Trafiksäkerhetsverket föreslås ytterligare bli ålagt en ny tillsynsuppgift som gäller dels uppfyllandet av de allmänna kraven för väghållning, dels utfallet i fråga om servicenivån och nivån på underhållet samt förändringar och brister som upptäcks i sammanhanget. Denna tillsyn inriktas på den uppnådda servicenivån och de myndigheter som svarar för väghållningen, det vill säga Trafikverket och landskapen. Vid behov är det möjligt att ge en anmärkning eller ålägga den som handlar i strid med lagen eller bestämmelser att avhjälpa sitt fel eller sin försummelse. Förpliktelsen får förenas med vite eller hot om avbrytande av verksamheten eller med hot om att åtgärderna vidtas på den försumliges bekostnad. 
I lagen tas det in bestämmelser om Trafikverkets säkerhetsstyrningssystem för väghållningen, vilket omfattar alla riks- och stamvägar samt de livligt trafikerade regionala vägarna. Säkerhetsstyrningssystemet är ett systematiskt sätt att styra uppnåendet av trafiksäkerhetsmålen när det gäller funktioner som anknyter till väghållningen, och det bidrar till att främja säkerheten på livligt trafikerade trafikleder. Samtidigt breddas Trafiksäkerhetsverkets tillsynsroll i samband med främjande av säkerheten på landsvägarna, så att den omfattar inte bara TEN-T-vägnätet utan alla riks- och stamvägar samt de livligt trafikerade regionala vägarna. Genom tillsynen är det möjligt att konkret påverka landsvägsinfrastrukturens säkerhetsnivå på det nationella planet och på så sätt bidra till att EU:s trafiksäkerhetsmål och målen i statsrådets principbeslut om en förbättring av vägtrafiksäkerheten nås. I propositionen ingår dessutom ett förslag till en bestämmelse om skyldighet att förbereda sig för störningar, och i den ingår ett bemyndigande för Trafiksäkerhetsverket att utfärda föreskrifter om beredskapen. Trafiksäkerhetsverkets tillsynsroll utsträcks så att den gäller inte bara säkerhetsstyrningssystemet utan också beredskapen samt uppfyllandet av de allmänna kraven för väghållning och kraven för servicenivån och nivån på underhållet. 
I lagens 2 kap. föreskrivs att landskapen inom väghållningsområdet ska ansvara för utarbetandet av utredningsplaner och vägplaner, men att väghållaren ska kunna åta sig att svara för utarbetandet av utrednings- eller vägplaner som gäller viktiga projekt. Överenskommelser om planeringsobjekten ingås som ett led i avtalet om väghållning, utgående från bland annat de planeringsbehov som identifierats i samband med landskapets trafiksystemplanering. I lagen ska med avvikelse från gällande lag föreskrivas om projektbedömningar, om planeringsgrunder för utrednings- och vägplanering samt om fastställande och iakttagande av dem. Landskapen inom ett väghållningsområde ska enligt förslaget göra en projektbedömning av sådana utrednings- och vägplaner som gäller viktiga vägprojekt. Innan utarbetandet av en utrednings- eller vägplan inleds kan det utarbetas planeringsgrunder för det vägprojekt som ska planeras. Väghållaren beslutar om utarbetandet av planeringsgrunderna, och landskapen inom väghållningsområdet svarar för deras beredning.  
I propositionen ingår även andra enskilda ändringsförslag, såsom förslaget att slopa kravet på tillstånd för att placera postlådor vid landsvägen; avsikten är att lagstiftningen ska överensstämma med postlagen och motsvara praxis. Det föreslås också att tillståndsplikten i fråga om förvaring och lastning av trävara på förbindelsevägars och regionala vägars vägområden ska slopas under vissa förutsättningar. Dessutom föreslås det att underhållet av vägtrummor vid anslutningar från enskilda vägar till landsvägar ska överföras till den som underhåller landsvägen, i praktiken väghållningsområdet.  
I propositionen har man också velat beakta främjandet av utvecklingen av automatisering och digitala tjänster, särskilt genom att komplettera lagen med skrivningar om skyldigheten att producera och uppdatera information.  
3.3.2
3.3.2 Banlagen
I banlagen görs motsvarande ändringar som i landsvägslagen när det gäller klassificeringsbeslut. Därmed utfärdas i fortsättningen bestämmelser också om stomnätet för järnvägar genom förordning av kommunikationsministeriet. Också banlagens allmänna krav på banhållningen förtydligas och kompletteras. Dessutom görs de ändringar i banlagen som behövs till följd av landskapsreformen. 
3.3.3
3.3.3 Offentlig persontrafik, flygtrafik, flygplatser och mobilitetsstyrning samt andra ändringsförslag som hänför sig till landskapsreformen
I överensstämmelse med de uppgiftsområden som anges i 6 § i förslaget till landskapslag hör till de alla 18 landskapens trafikuppgifter också att vara behörig myndighet i frågor som gäller offentlig persontrafik och därmed svara för planering och ordnande av den offentliga persontrafiken i landskapet i samarbete med kommunerna och städerna i landskapet. Uppgiften är emellertid frivillig för landskapen. Städerna kommer även i fortsättningen att vara behöriga myndigheter. Varje landskap ska också besluta om understöd för förbättring av enskilda vägar och främja mobilitetsstyrningen samt planera och ordna skärgårdstrafiken i de landskap som tillhandahåller sådan trafik och som i landskapsstrategin har åtagit sig att sköta uppgiften. Uppgifter som gäller offentlig persontrafik regleras i lagen om transportservice (320/2017), bidrag för enskilda vägar i lagen om enskilda vägar (RP 147/2017 rd) och ordnande av skärgårdstrafik i lagen om främjande av skärgårdens utveckling (494/1981, ändringar föreslås i RP 14/2018 rd). 
Uppgifterna i samband med ordnande av offentlig persontrafik överförs från NTM-centralerna till landskapen, uppgifterna i samband med köp av flygtrafik överförs från Trafikverket till landskapen och uppgifterna i samband med statsunderstöd för flygplatser överförs från kommunikationsministeriet till landskapen. Den offentliga persontrafiken omfattar väg-, järnvägs- och flygtrafik samt Kvarkentrafik.  
På grund av landskapsreformen ändras lagen om sättande i kraft av de bestämmelser som hör till området för lagstiftningen i fördraget med Ryssland om utarrendering av den del av Saima kanal som tillhör Ryssland och av det därtill hörande området till republiken Finland samt om fartygstrafiken genom Saima kanal och om tillämpning av fördraget (104/2011), och landskapet Södra Karelen föreslås bli medlem i kommissionen för Saima kanal. Vidare görs i den lagen en teknisk ändring som gäller myndighetsnamn (Tullen). Landskapen och Statens tillstånds- och tillsynsmyndighet föreslås i vissa lagar (till exempel lagen om tjänster inom elektronisk kommunikation, sjölagen, miljöskyddslagen för sjöfarten, lagen om transport av farliga ämnen och sjötrafiklagen) få rättigheter som hänför sig till utlåtanden, hörande och erhållande av information eller bli skyldiga att lämna ut information. Dessa ändringar är främst tekniska. 
3.3.4
3.3.4 Sammanfattning av de uppgifter som överförs
Det uppskattas att denna proposition samt propositionerna om ändring av lagen om enskilda vägar och lagen om främjande av skärgårdens utveckling medför att det till landskapen överförs 325 årsverken från NTM-centralernas ansvarsområden för trafik, 83 årsverken till Trafikverket (här ingår 69 årsverken som överförs från NTM-centralerna och avser uppgifter som centraliserats på riksnivå samt 14 årsverken som överförs från närings-, trafik- och miljöcentralernas samt arbets- och näringsbyråernas utvecklings- och förvaltningscenter, det vill säga KEHA-centren, och som gäller stödfunktioner för dessa uppgifter) och högst 19 årsverken till det trafikstyrningsbolag som föreslås bli bildat (läget den 1 februari 2017). 
Vid landskapsreformen delas finansieringen av trafikuppgifter upp i allmän finansiering och särskild finansiering. Särskild finansiering från staten förekommer för det första i situationer där staten fortsätter att ansvara för en uppgift och landskapet handlar med stöd av ett uppdragsavtal. Den viktigaste uppgiften av detta slag är den regionala väghållningen. Andra uppgiftshelheter för vilka särskild finansiering kommer att beviljas är statsunderstöd för vajerfärjor och frigående färjor som hör till enskilda vägar, skärgårdstrafik och köp av flygtrafik. Allmän finansiering föreslås ligga till grund för följande: utvecklande och ordnande av trafiktjänster i landskapet, köp och utvecklande av offentlig persontrafik, understöd för mobilitetsstyrning, byggande och upprätthållande av vissa flygplatser samt statsunderstöd för enskilda vägar.  
Planerna och avtalen i det styrsystem mellan staten och landskapen som följer av den föreslagna lagen om trafiksystem och landsvägar samt anknytande övriga beslut och program på statsrådsnivå är följande: 
Den nya regleringen i landsvägslagen om krav för väghållning, servicenivå och nivå på underhållet samt om trafiksystemplanering föreslås träda i kraft så snart som möjligt. Med tanke på säkerställandet och övervakningen av kvaliteten på landsvägarna behöver de förbättringar som lagen för med sig åstadkommas så snabbt som möjligt. Det skulle också vara bra att kunna börja bereda trafiksystemplaner så snart som möjligt. Vad landskapen beträffar skulle temporära beredningsorgan i landskapen kunna börja bereda landskapens trafiksystemplaner i god tid. Också i banlagen finns det ny reglering om allmänna krav som behöver träda i kraft så snart som möjligt. Dessutom föreslås de förtydligande ändringar som görs i vardera lagen och gäller beslut om klassificering och stomnätet träda i kraft så snart som möjligt. De substansändringar som ingår i denna proposition och gäller landsvägar, väghållning och trafiksystemplanering föreslås träda i kraft så snart som möjligt. De till landskapsreformen anknytande uppgifts- och personalöverföringarna avses ske den 1 januari 2020. Det kommer att föreskrivas om överföringarna i en fristående införandelag. 
4
Propositionens konsekvenser
Utgångspunkter för konsekvensbedömningen 
Genom propositionen genomförs överföringen av de i 6 § 1 mom. 14 punkten i landskapslagen avsedda uppgifterna från staten till landskapen. Genom propositionen överförs också vissa uppgifter till Trafikverket från närings-, trafik- och miljöcentralerna som upphör med sin verksamhet i samband med landskapsreformen. I propositionen föreslås det att lagens rubrik landsvägslagen ändras till lagen om trafiksystem och landsvägar, och tillämpningsområdet föreslås bli utvidgat på motsvarande sätt. Enligt förslaget ska det till lagen fogas nya bestämmelser om trafiksystemplanering på riks- och landskapsnivå. I propositionen ingår också förslag till av landskapsreformen föranledd ny reglering om ordnande av väghållningen på landsvägar i form av samarbete mellan landskapen och staten, om anknytande styrnings- och avtalsarrangemang samt andra arrangemang och om servicenivån på landsvägar. 
Reformen innebär en väsentlig förändring av väghållningen jämfört med nuläget och nya utgångspunkter till följd av de behörigheter inom väghållningen som tilldelas landskapen. Till principerna i landskapsreformen hör respekt för landskapens självstyrelse och självständiga beslutanderätt, och det föreslås att landskapen i fortsättningen ska svara för den regionala väghållningen. Finska staten, som företräds av Trafikverket, kommer dock att äga landsvägarna och även styra väghållningen i landskapen och finansieringen av den. För att säkerställa ett enhetligt vägnät med en likartad servicenivå i hela landet och på grund av att staten kvarstår som ägare av vägnätet förutsätts i propositionen en styrmodell som kan trygga vägnätets och servicenivåns enhetlighet. Trafikförbindelserna upphör inte vid landskapens eller rikets gränser, och medborgarnas och näringslivets mobilitetsbehov förutsätter fungerande kommunikationer. Att trygga ett enhetligt trafiknät och dess fortbestånd när det gäller de trafikuppgifter som överförs till landskapen är ett nödvändigt mål som behöver säkerställas, även om det begränsar landskapens självstyrelse och den självständiga beslutanderättens omfattning i samband med frågor om väghållning och den särskilda finansieringen av den. 
Propositionen har betydande konsekvenser för myndigheternas inbördes relationer och roller, eftersom NTM-centralerna upphör med sin verksamhet och Trafikverket får uppgiften att styra landskapen. Dessutom överförs väghållningsuppgifterna vid NTM-centralernas ansvarsområden för trafik och den personal som skött dem i huvudsak till landskapen. En del av uppgifterna vid NTM-centralernas ansvarsområden för trafik överförs dock till Trafikverket. 
4.1
Ekonomiska konsekvenser
Till följd av landskapsreformen övergår ansvaret för väghållningen till landskapen på det sätt som föreskrivs närmare i den föreslagna lagen. I samband med landskapsreformen tas finansieringen av väghållningen upp som särskild finansiering under ett budgetmoment inom kommunikationsministeriets förvaltningsområde, vilket bidrar till en enhetlig servicenivå på väghållningen i hela landet och främjar förvaltningen av statens trafikledsegendom. Landskapen kan inte använda allmän finansiering för väghållning. 
Enligt den plan för de offentliga finanserna 2018–2021 som statsrådet godkände den 28 april 2017 är anslaget för bastrafikledshållning 940 miljoner euro år 2020. Anslaget innefattar inte finansiering av programmet för reparationsskulden, som är i linje med regeringens strategiska mål. Finansieringen av basväghållning kommer att minska från nuvarande 540 miljoner euro till 505 miljoner euro. 
När man från detta belopp drar av finansieringen av landsvägsfärjetrafik, finansieringen av Trafikverkets väghållningsfunktioner och den centraliserade finansiering som avsätts för stora reparationsprojekt återstår cirka 410 miljoner euro att fördela mellan landskapen. Nästan hälften av finansieringen väntas åtgå till dagligt landsvägsunderhåll, cirka 44 % till reparationer och återstoden till regionala investeringar och investeringsplanering. Finansieringen är njugg och leder till att vägnätets skick försämras, och det är i praktiken inte möjligt att finansiera landskapens små trafikinvesteringar i annat än ringa utsträckning. I små landskap är finansieringen totalt sett inte stor, vilket leder till mindre flexibilitet när väghållningen programmeras. 
För att den 2,5 miljarder euro stora reparationsskuld som hänför sig till trafiklederna ska minska har det under innevarande regeringsperiod beviljats 600 miljoner euro i tilläggsfinansiering 2016–2018. Åren 2017–2019 överförs dessutom sammanlagt 364 miljoner från anslaget för icke specificerade investeringar till bastrafikledshållning och statsbidrag för enskilda vägar.  
Genom 2016 års finansiering av programmet för reparationsskulden hindrades reparationsskulden från att stiga, och på livligt trafikerade vägar har reparationsskulden också minskat en aning, vilket märkts framför allt i beläggningarnas skick. Beläggningsprogrammet växte med 20 % och de inbesparade körkostnaderna till följd av beläggningarnas bättre skick är 8–13 miljoner euro redan det första året. Finansieringen av programmet för reparationsskulden används också till strukturella iståndsättningar av vägar och vägkonstruktioner samt till tjockare beläggningar som håller vägen i skick längre. Den innevarande regeringsperiodens treåriga satsning på att avhjälpa reparationsskulden tar sig på lång sikt uttryck i att vägarna i dåligt skick minskar med 2 000 kilometer (-30 %). De konsekvenser för användarna som broreparationer har konkretiseras främst i färre viktbegränsningar, vilka leder till kortare och effektivare transporter.  
I förslaget definieras med avvikelse från gällande lag en servicenivå inom det nationellt viktiga stomnätet, för de riks- och stamvägar som inte hör till stomnätet och för övriga landsvägar. På detta sätt vill man trygga en enhetlig och hög servicenivå på de nationellt viktiga stomvägarna, framför allt för den långväga trafiken. I synnerhet stomnätet spelar en viktig roll som vägförbindelse för den tunga trafiken, vilket är anledningen till att ändringen syftar till goda möjligheter att förutse restiden, jämn färdhastighet och trafiksäkerhet. För att den servicenivå på resor och transporter som förutsätts i lagen ska uppnås i vägnätet förutsätts en viss nivå när det gäller underhållet, det vill säga den dagliga skötseln av landsvägarna och reparationerna av dem. Lagen kompletteras med bestämmelser om nivån på landsvägsunderhållet i stomnätet, på sådana riks- och stamvägar som inte hör till stomnätet och på regionala vägar och förbindelsevägar som inte hör till stomnätet. De nivåkrav som anges i lagförslaget ska i fortsättningen beaktas när beslut fattas om den statliga finansieringen av väghållningen och vid landskapens skötsel av väghållningsuppgifter. Målet är att den dagliga skötseln ska stödja trygg färdsel på landsvägarna och att reparationsskulden i stomnätet och på de andra stam- och huvudvägarna inte ska växa samt att den ska förbli under kontroll också på de regionala vägarna och förbindelsevägarna.  
Från och med 2020 är grundnivån för finansiering av bastrafikledshållning cirka 940 miljoner euro om året. I den har man inte beaktat den tilläggsfinansiering som ingår i programmet för reparationsskulden. Enligt en uppskattning förutsätter den servicenivå som beskrivs i propositionen tilläggsfinansiering till ett belopp av allra minst cirka 200 miljoner euro utöver grundnivån för att reparationsskulden ska minska, prisuppgången ska kompenseras och förvaltningen av trafikledsegendomen ska utvecklas. För att det ska vara möjligt att beakta också de växande behov som hör ihop med vinterunderhållet och med större dimensioner och massor behövs en tilläggsfinansiering som är avsevärt större. Väghållningens andel av detta väntas vara omkring 60–70 %. För landsvägarnas del kräver uppnåendet av den nivå på underhållet som anges i 33 § i landsvägslagen att den finansieringsnivå för bastrafikledshållning som tillämpats under denna regeringsperiod bibehålls och att åtgärderna inriktas på väghållning på motsvarande sätt som under innevarande regeringsperiod. 
Av detta bör merparten, sammanlagt cirka 180 miljoner euro, inriktas på att kompensera minskningen av reparationsskulden, medan sammanlagt cirka 20 miljoner euro styrs till att utveckla trafikledsförvaltningen och trafikledshållningen. Detta inbegriper dock ännu inte vare sig den önskade höjning av vinterunderhållet som följer av bland annat klimatförändringen och som utgör cirka 20 miljoner euro, eller nödvändiga lokala små investeringar genom vilka man ser till bland annat att nya landsvägar inte behöver byggas. Till små investeringar behövs 30–50 miljoner euro om året mer än i nuläget, för att de lokala behov som näringslivet och andra kunder har ska tillgodoses.  
När finansieringen och de personella resurserna till följd av landskapsreformen och ändringarna av landsvägslagen fördelas på fler aktörer än vad som nu är fallet finns det en risk för att kostnaderna per enhet stiger på lång sikt. Det är en utmaning att göra en ingående konsekvensbedömning, men saken kan speglas mot de tidigare uppnådda fördelar som centraliseringen av det dagliga underhållet har gett. Genom att väghållningsfunktionerna centraliserats har man allt sedan början av årtusendet uppnått besparingar på cirka 20–25 % (huvudsakligen utgifter för personal), och kostnadseffekterna av en decentralisering kan därför förväntas ligga på ungefär den nivån. Ur ett konsekvensperspektiv är det angeläget att landskapen i enlighet med propositionen ingår avtal om skötsel av de på dem ankommande väghållningsuppgifterna i samarbete inom högst nio väghållningsområden, vilket i sin tur begränsar de totala kostnadseffekter som eventuellt följer av en decentralisering. 
Enligt propositionen ska finansieringen av de väghållningsuppgifter som åläggs landskapen (bastrafikledshållning på landsvägar) fördelas enligt landskap baserat på vägnäts- och trafikegenskaper samt andra omständigheter så, att ett enhetligt landsvägsnät i likvärdigt skick kan garanteras. I egenskap av väghållare ska Trafikverket tilldela varje landskap finansiering utifrån avtalet om väghållning. Avtalet bygger på nationella riktlinjer, landskapens planer för väghållning och trafik samt budgeten. Dessutom ska Trafikverket avsätta en del av budgetmedlen för väghållning inom bastrafikledshållningen för rikstäckande uppgifter inom bastrafikledshållningen, temaprogram och akuta eller oförutsedda reparationsbehov. I praktiken kommer finansieringsandelarna för vissa landskap att vara mycket begränsade, vilket kan försvåra väghållningsplaneringen och i synnerhet genomförandet av större underhållsobjekt, såsom stora broar. Allmänt taget möjliggör inte små budgetar någon smidig väghållning, och därför kan det hända att landskapens väghållningsfinansiering tar slut mitt under året. Till följd av det som sägs ovan behöver för Trafikverket lämnas kvar en betydande finansieringsandel som inte delas ut genast och som bidrar till att man inom väghållningen uppnår en flexibilitet och reaktionsförmåga som är av stor vikt för förvaltning av vägnätsegendomen. 
Enligt näringslivet och företagen är ett fungerande trafiksystem mycket viktigt för företagsverksamheten i synnerhet i Finland med dess långa avstånd som medför högre transportkostnader än i Mellaneuropa. Landsvägsnätet ger företagen chansen till smidiga och trygga transporter till skäliga kostnader. I propositionen ingår nya bestämmelser om trafiksystemet och trafiksystemplaneringen. Dessa har som syfte att främja ett långsiktigt och hållbart utvecklande av trafiksystem som beaktar nuvarande och framtida trafikbehov och verksamhetsförutsättningar för näringslivet. I den riksomfattande trafiksystemplanen, som utarbetas i samråd med olika aktörer, ska det ingå också ett finansierings- och åtgärdsprogram för trafiksystemet på 10–12 års sikt. Med tanke på näringslivets investeringar bidrar den långsiktiga planering som föreslås i propositionen till att näringslivets investeringar och verksamhet kan planeras utifrån mer långsiktiga planer och långtidsinformation. När landskapen utarbetar trafiksystemplaner på landskapsnivå baserade på den riksomfattande trafiksystemplanen beaktas i förfarandet och växelverkan (15 d §) också sådana regionala verksamhetsutövare vars bransch kan ha en väsentlig anknytning till trafiksystemet. Vid behov kan man för beredningen av planen på landskapsnivå även tillsätta en samarbetsgrupp där det också kan ingå företrädare för näringslivet. 
Ur serviceproducenternas synvinkel kan överföringen av väghållningsansvaret till landskapen medföra förändringar i företagens verksamhetsmiljö jämfört med nuläget. För närvarande genomförs det dagliga underhållet av landsvägarna genom 80 områdesentreprenader som konkurrensutsätts och i regel sträcker sig över fem år. Enhetligheten i entreprenadinnehållet styrs genom riksomfattande riktlinjer och dokumentmallar. Trafikverket tilldelar områdena största delen av finansieringen för det dagliga underhållet på basis av priserna i entreprenadavtalen. Sedan början av 2016 har genomförandet av väghållningen, det vill säga upphandlingen av underhåll och investeringar, skötts centralt på fyra områden på det sätt som nämns i kapitel 2.4 Bedömning av nuläget. I fortsättningen kommer det att vara landskapens uppgift att upphandla väghållningen, vilket kan ha följder också för serviceproducenterna. Till exempel skötselentreprenaderna, deras omfattning och skötselområdena kan komma att förändras, vilket kan påverka också företagen i branschen i fråga. Det är emellertid besvärligt att göra en ingående bedömning av propositionens inverkan på hur marknaden fungerar inom sektorerna infrabyggande och underhåll, eftersom landskapens samarbetsmodell till exempel när det gäller antalet väghållningsområden enligt landskapslagen och denna proposition är något som landskapen har rätt att besluta om, dock med förbehållet att antalet väghållningsområden får vara högst nio. I verkställandet av landskapsreformen ska man fästa uppmärksamhet vid att säkra en fungerande marknad samt att förbereda sig med tillräckliga åtgärder för att hindra marknadsstörningar. 
Till följd av ändrade behörigheter och uppgifter förutspås det att näringslivet i någon mån kommer att drabbas av administrativa kostnader som föranleds av bland annat att behörigheten att bevilja tillstånd överförs till Trafikverket och eventuella nya system och processer som gäller tillstånd tas i bruk. 
Ett av syftena med propositionen är också att främja utvecklandet av nya tjänster, något som i sin tur kan ha en positiv inverkan på näringslivet. På längre sikt kan tryggandet av förutsättningarna för att nya tjänster uppkommer bedömas ha även mer omfattande konsekvenser för samhällsekonomin, förutsatt att de nya tjänsterna tillhandahålls på marknadsvillkor också för landsvägsnätets och väghållningens del. I dagens läge ökar ständigt informationens betydelse för trafiksystemet och utvecklingen av det, och informationen utgör allt oftare det råmaterial som möjliggör nya trafiktjänster och är en förutsättning för uppkomsten av dem. Automatiseringen av vägtrafiken växer snabbt, och i de nya fordon som kommer ut på marknaden finns allt mer avancerade system som stöder föraren. Avsikten är också att främja en utveckling som är positiv med tanke på ekonomin och sysselsättningseffekten och som möjliggör uppkomsten av nya tjänster som baseras till exempel på trafikinformation (passagerarinformation, information om vägnäten, väder- och väglagsinformation samt register över alla trafikformer och färdmedel). 
I propositionen föreslås det att underhållet av vägtrummor vid anslutningar till enskilda vägar överförs till den som ansvarar för underhållet av landsvägen, i praktiken till väghållningsområdet. Enligt en uppskattning är antalet trummor vid sådana anslutningar cirka 500 000. Redan nu ingår underhåll av anslutningarna till enskilda vägar i områdesentreprenaderna i någon mån. Det uppskattade antalet anslutningar till enskilda vägar som är i omedelbart behov av åtgärder varierar mellan 50 000 och 100 000. Kostnaderna för att förnya en trumma uppskattas till cirka 600–1 000 euro. Enligt en uppskattning som gjorts med stöd av projektet Pehko höjer vägtrummorna vid anslutningarna reparationsskulden med 10–20 miljoner euro per år. De mest kritiska objekten kan repareras inom 2–3 år, och kostnaderna beräknas uppgå till 30–40 miljoner euro. Det som man är överens om i uppskattningarna är att det behövs en permanent tilläggsfinansiering på drygt 10 miljoner euro per år för att förnya vägtrummorna vid anslutningarna till enskilda vägar, om man vill att underhållet av trummorna ska ge livscykelfördelar. Enligt Trafikverkets beräkningar skulle detta belopp räcka till för att förnya över 10 000 trummor per år. När det gäller värdet av vägegendomen skulle detta betala sig mångfaldigt, eftersom livscykelfördelarna blir desto större ju mer pengar som satsas i början. Det är befogat att årligen avsätta cirka 2 miljoner euro extra för utloppsdiken och dikningar av objekten i fråga. Arbetena till totalpris och granskningarna väntas uppgå till cirka en miljon euro per år. Fördelaktigast är det att konkurrensutsätta dem inom områdesentreprenader. Även om lagändringen medför kostnader för staten är nyttan på längre sikt avsevärd, eftersom ökningen av reparationsskulden kan bromsas upp och landsvägarnas livscykeleffektivitet förbättras genom att man förhindrar vägskador som beror på bristfällig dränering. Förändringen kan genomföras kostnadseffektivt genom konkurrensutsättning av områdesentreprenader. 
Propositionen har inte några direkta och omedelbara ekonomiska konsekvenser för hushåll och enskilda personer. Det har inte heller kunnat konstateras att den kommunala ekonomin skulle påverkas, åtminstone inte i någon större utsträckning. De ekonomiska konsekvenserna för den offentliga förvaltningen har framför allt att göra med frågor som gäller personalresurser. Dessa beskrivs närmare i avsnittet om myndigheternas uppgifter och arbetsmetoder. 
Enligt propositionen avses med väghållning planering, byggande, underhåll och trafikförvaltning av landsvägar samt produktion och uppdatering av informationen kring dessa uppgifter. Vid väghållningen i fråga om landsvägar gäller det att främja möjligheterna att utnyttja information och digitalisering samt trafikens automatisering och förutsättningarna för utvecklande av trafiktjänster. Heltäckande information och behövliga förbindelser för överföring av den samt byggande av sådana förbindelser är en viktig förutsättning för att digitala trafiktjänster ska utvecklas och för annan digitalisering samt för automatisering. Det är möjligt att inbegripa produktionen av information och därmed också informationssystemkrav i avtalen om väghållning genom vilka väghållaren, det vill säga Trafikverket, och landskapen kommer överens om hur väghållningen ska ordnas. För att produktionen och uppdateringen av information ska integreras som en helhet i väghållningen och för att informationssystemen ska bli kompatibla förutsätts det att den offentliga förvaltningen har fungerande informationssystem, något som kan medföra kostnader för Trafikverket och landskapen. Den reglering om information som ingår i propositionen är proaktiv och möjliggörande, och därför går det inte att exakt uppskatta det allmännas kostnader för informationssystem som är nödvändiga med tanke på information som kommer att vara viktig i framtiden och insamling av den. 
Från företagens och näringslivets synpunkt kan information som produceras i samband med väghållningen och uppdatering av den främja möjligheterna att utnyttja information och digitalisering också när det gäller utveckling på marknadsvillkor av både trafiktjänster och automatisering.  
Konsekvenser för samhällsekonomin  
I ett land som Finland, som ligger långt från de internationella marknaderna och där avstånden är stora, är trafikinfrastrukturen av särskilt stor betydelse. Vägnätet i Finland är förhållandevis heltäckande (se avsnitt 2.1 Landsvägsnätets skick samt finansiering och ordnande av väghållning). I relation till befolkningen och bruttonationalprodukten är trafikinfrastrukturen i Finland tämligen omfattande jämfört med övriga EU-länder, men mindre än exempelvis i Sverige (Verkningarna av infrastrukturen och placeringen av den offentliga sektorns funktioner på regionnivå, Statsrådets kanslis publikationsserie 31/2009). 
Vid bedömningen av propositionens samlade konsekvenser för sysselsättning, investeringar, konsumtion, produktion, import och export samt för prisnivån kan man ägna uppmärksamhet åt hur näringslivets verksamhetsförutsättningar tryggas i propositionen. Propositionens bestämmelser om klassificering av landsvägar (4 §), servicenivå baserad på vägklasser (13 a §) och trafiksystemplanering (1 a kap.) kan på lång sikt ha positiva följder för exempelvis investeringar samt för verksamhetsförutsättningar som påverkar import och export. Trafiksystemplaneringen i propositionen är långsiktig planering som inbegriper ett finansierings- och åtgärdsprogram där tidsperspektivet är 10–12 år. Detta gör det möjligt att bättre än nu förutse trafiksystemets utveckling, vilket kan ha mer vidsträckta positiva samhällsekonomiska konsekvenser också med tanke på investeringarna. Vid klassificeringen av vägar är utgångspunkten vägarnas trafikmässiga betydelse, och enligt propositionen beslutar kommunikationsministeriet om vilka delar av riks- och stamvägarna som exempelvis ska höra till det nationellt viktiga stomnätet. På landsvägarna i stomnätet är servicenivån högre än i det övriga vägnätet, vilket innebär bland annat en jämn färdhastighet och goda möjligheter att förutse restiderna. I stomnätet ska aktuell trafikinformation även stödja restidernas förutsebarhet. På lång sikt möjliggör de ändringar som föreslås i propositionen att till exempel servicenivån i stomnätet kan tryggas och utvecklas, vilket kan ha positiva konsekvenser också för samhällsekonomin. Visserligen finns det givetvis företag vars verksamhet är beroende av det lägre vägnätet, och åtgärderna för underhållet av detta nät på kort sikt kan genom landskapens väghållningsroll även effektiviseras och inriktas mer effektivt, framför allt med tanke på näringslivet. 
Propositionens finansierings- och styrmodell för väghållning samt väghållarens (Trafikverkets) behörighet när det gäller betydande vägprojekt säkerställer också att väghållningen utvecklas och genomförs enhetligt och på ett sätt som bäst stödjer samhällsekonomin som helhet. Propositionen har inte konstaterats ha några konsekvenser som främjar produktiviteten inom den offentliga sektorn. 
4.2
Konsekvenser för myndigheterna
Inbördes relationer 
Enligt gällande lydelse i 10 § i landsvägslagen är väghållaren staten, som svarar för väghållningen och kostnaderna för den samt utövar de rättigheter som har grundats för väghållningen. Trafikverket är ansvarig myndighet i dessa frågor, med uppgift att upprätthålla och utveckla de statsägda landsvägarna. Enligt propositionen svarar Trafikverket för landsvägsnätet och kostnaderna för det samt utövar de rättigheter som har grundats för väghållningen. Vägnätet tas upp i Trafikverkets balansräkning och är statlig egendom som förvaltas av verket. Enligt gällande lydelse i 11 § i landsvägslagen är Trafikverket väghållningsmyndighet i de fall som föreskrivs särskilt och NTM-centralen i övrigt. Det finns 15 NTM-centraler och nio av dem sköter trafikuppgifter. 
Trafikverket ska i fortsättningen svara för de uppgifter som åligger staten som ägare av landsvägsnätet och för väghållningsuppgifterna på riksnivå. Till uppgifterna på riksnivå hör bland annat de uppgifter av nationell betydelse som för närvarande är koncentrerade till en enda NTM-central. De specialiseringsuppgifter som nu är koncentrerade till en enda NTM-central och tillståndsuppgifterna inom väghållningen anges mer detaljerat i avsnitt 2.4 Bedömning av nuläget. Förutom de uppgifter som nu är förlagda till en enda NTM-central föreslås det att den uppgiftshelhet som är knuten till statens ägande av trafikleder och gäller anskaffning av markområden för vägar och banor samt förvaltning av fastigheter överförs från NTM-centralerna till Trafikverket. Beträffande tillståndsuppgifterna inom väghållningen föreslås det att också de tillstånd som för närvarande sköts av alla de nio NTM-centralerna med ansvarsområden för trafik ska överföras till Trafikverket som en del av de samlade tillståndsuppgifterna. Genom att koncentrera tillståndsuppgifterna till Trafikverket kan man trygga ett enhetligt och jämlikt bemötande av kunderna i hela landet samt en effektiv tillståndsverksamhet med möjlighet till utveckling. Framför allt i anknytning till tillstånden för väghållning pågår också åtgärder som lättar upp administrationen i samband med normavvecklingen. Åtgärderna har som syfte att främja bland annat utnyttjandet av digitalisering vid behandlingen av tillståndsärenden inom väghållningen. Genom att koncentrera dessa ärenden till Trafikverket kan man bidra till att tillståndsverksamheten utvecklas enhetligt och till att Trafikverkets befintliga resurser utnyttjas effektivt. Tillståndsuppgifterna har dock en mycket nära anknytning också till landskapens uppgifter, särskilt till planeringen av markanvändning och trafikleder. Därför förutsätts god växelverkan och informationsförmedling mellan landskapen och väghållaren, som är tillståndsmyndighet, när tillståndsärendena kopplas loss från sitt tidigare regionala sammanhang. När tillståndsärenden behandlas kan Trafikverket behöva exempelvis information om regionala förhållanden eller om andra omständigheter som är av betydelse för tillståndsprövningen. Den behöriga myndighetens förutsättningar att sköta dessa uppgifter har beaktats i propositionen genom att en bestämmelse om rätten att få information (15 p §) fogats till lagen. 
De trafikuppgifter som har koncentrerats på riksnivå och anknytande stödfunktioner föreslås bli överförda från NTM-centralerna och från närings-, trafik- och miljöcentralernas samt arbets- och näringsbyråernas utvecklings- och förvaltningscenter, det vill säga KEHA-centren, till Trafikverket och till det trafikstyrningsbolag som avses bli bildat. De uppgifter som överförs uppskattas motsvara cirka 100 årsverken. Till Trafikverket överförs dessutom informationssystemen för de uppgifter som har koncentrerats på riksnivå samt upprätthållandet och utvecklingen av dem. Detta innebär en sammanlagd anslagsöverföring på cirka 3,7 miljoner euro från NTM-centralernas omkostnader till Trafikverkets omkostnader. Här har utgifterna för de informationssystem som överförs (cirka 1,5 miljoner euro) och inkomsterna av tillstånd (cirka 4 miljoner euro) beaktats.  
Förhållandet mellan staten och landskapen och det landskapsövergripande samarbetet regleras i 1 b kap. Med tanke på en kostnadseffektiv och enhetlig, sakkunnig och långsiktig skötsel av väghållningen i det vägnät som staten kvarstår som ägare av ska landskapen ingå avtal om skötseln av den regionala väghållningen i samarbete på högst nio väghållningsområden på det sätt som i 8 kap. i landskapslagen föreskrivs om landskapens samarbetsformer. Genom att avtalet om samarbete mellan landskapen ersätts med ett beslut av statsrådet tryggar man i sista hand att de mål som avses bli uppnådda genom bildandet av väghållningsområden (och som anges i 15 f §) säkerställs inom väghållningen. Det sätt på vilket väghållningen ordnas har också konsekvenser för medborgarna och näringslivet, och därför bör man fästa vikt också vid pendlingsregionerna när det landskapsövergripande samarbetet organiseras. 
I propositionen grundar sig styrningen av väghållningen på att Trafikverket styr landskapens väghållning och användning av väghållningsfinansiering med stöd av avtal om väghållning samt genom informationsstyrning. Landskapens organisatoriska ställning utanför statsförvaltningen medför dock förändringar i styrmodellen för väghållning jämfört med nuvarande situation. I praktiken är säkerställandet av en enhetlig väghållning och servicenivån mer beroende än i dag av hur styrmodellen och samarbetet mellan staten och landskapen verkligen fungerar. Landsvägarnas servicenivå har att göra med vägnätens enhetlighet, täckning och omfattning, och exempelvis på riksväg 4 mellan Helsingfors och Uleåborg behövs det med tanke på de tunga transporterna en viss servicenivå, även om vägtypen kan variera. 
När det gäller innehållet i styrmodellen är det med avseende på landskapens självstyrelse viktigt att man gör en ingående bedömning av vilka frågor som behöver regleras genom förordning eller föreskrifter och vilka omständigheter som med beaktande av syftena för denna lag kan hanteras med hjälp av informationsstyrning. Till följd av reformen finns det i vilket fall som helst ett större behov än nu av att stödja sig på en styrning av väghållningen som baseras på normer, anvisningar och informationsstyrning i stället för på informellt samarbete. Den nuvarande modellen är sådan att Trafikverket har etablerat en förtroendebaserad metod och modell för planering av landsvägar tillsammans med NTM-centralernas ansvarsområden för trafik och olika intressenter. På grund av de ändringar i uppgifter och roller som reformen medför är det möjligt att man i början av reformen får se även ökad reglering (normstyrning av väghållningen) och mer byråkrati. Efter att landskapen har inlett sin verksamhet blir det möjligt att bedöma hur landskapen och väghållningsområdena fungerar. Då kommer man att kunna bilda sig en klarare uppfattning om vilken omfattning som är lämplig när det gäller styråtgärder, till exempel föreskrifter. 
Genom propositionen främjas också samarbetet mellan myndigheterna i vägplaneringsprocessen. Enligt förslaget tas det i landsvägslagen in en bestämmelse om förhandsöverläggning (27 a §); denna ska stärka samarbetet och informationsutbytet mellan landskapet som är ansvarig myndighet för utarbetande av planen och andra myndigheter samt främja ett smidigt planeringsförlopp. Syftet med förhandsöverläggningen är att främja hanteringen av de utrednings- och utvärderingsförfaranden som krävs för planen och ett smidigare informationsutbyte och samarbete mellan den som utarbetar planen och den som godkänner den samt andra myndigheter, samt att förbättra kvaliteten på planen och framställningen om godkännande av den. I synnerhet väghållarens möjlighet att medan planen utarbetas ordna förhandsöverläggning med väghållningsområdet och vid behov också med andra centrala myndigheter, såsom Statens tillstånds- och tillsynsmyndighet, bidrar till högklassig planering i samråd med myndigheter som har olika uppgifter och intressen. Man kan således bedöma att myndighetssamarbetet som främjas genom propositionen även har konsekvenser för antalet besvärsprocesser som myndigheterna driver mot varandra, när man vid planeringen tillämpar de nya bestämmelserna i landsvägslagen om växelverkan och förhandsöverläggning baserat på samarbete. 
Uppgifter och arbetsmetoder  
Propositionen har konsekvenser för myndigheternas uppgifter och arbetsmetoder, när NTM-centralerna upphör med sin verksamhet och Trafikverket i fortsättningen är den instans som styr landskapen. NTM-centralernas ansvarsområden för trafik har i nuläget företrätt den statliga parten och varit statens röst i dialogen med landskap, kommuner och andra aktörer. Till följd av reformen kommer denna roll att försvinna helt och hållet, vilket har konsekvenser också för Trafikverkets resursbehov. Även i fortsättningen är det nödvändigt att kunna föra en dialog och bevaka statens intressen, till exempel vid planläggning, i relation till landskap, kommuner och andra aktörer. 
Att ägandet av vägnätet skiljs åt från den praktiska verksamheten innebär också att nya arbetsmetoder och arbetsmodeller behöver införas. För att kunna ta över nya uppgifter och genomdriva förändringar krävs det ofrånkomligen en del myndighetsresurser, vilket i början av reformen kan ha följder för effektiviteten i myndigheternas verksamhet. De anställda vid NTM-centralernas ansvarsområden för trafik som överförs till landskapen kommer efter att reformen trätt i kraft att ha en alldeles ny ställning jämfört med den tidigare, då de var företrädare för staten. Därför bör myndigheterna fästa vikt också vid att personalen får tillräcklig introduktion, utbildning och information om förändringarna. 
Trafikverket föreslås styra landskapens väghållning och användning av väghållningsfinansiering genom avtal om väghållning och informationsstyrning. Den väghållning som sköts på väghållningsområdet kommer staten att styra genom avtal om väghållning samt anvisningar och annan informationsstyrning. Till följd av reformen är det möjligt att normgivningen (eventuella föreskrifter som Trafiksäkerhetsverket utfärdar med stöd av 13 § och förordningar av kommunikationsministeriet som utfärdas med stöd av 13 a och 33 §) åtminstone i någon mån ersätter det informella urval av styrinstrument som ingår i den nuvarande modellen.  
Dessutom överförs väghållningsuppgifterna vid NTM-centralernas ansvarsområden för trafik och den personal som skött dem i huvudsak till landskapen. I fortsättningen svarar Trafikverket för de uppgifter som åligger ägaren till landsvägsnätet och för väghållningsuppgifterna på riksnivå. Därmed överförs en del av uppgifterna vid NTM-centralernas ansvarsområden för trafik till Trafikverket. I avsnittet 3.3 De viktigaste förslagen anges på s. xx–xy de riksomfattande väghållningsuppgifter som i fortsättningen ska skötas av Trafikverket. 
Enligt propositionen överförs största delen av väghållningsuppgifterna till landskapen. Vart och ett av de 18 landskapen ska svara för landskapets trafiksystemplanering, och de uppgifter som gäller väghållningen på landsvägar ordnas på landskapens väghållningsområden. 
Vad beträffar de uppgifter som överförs till Trafikverket ökas Trafikverkets arbetsbörda och uppgifter, men förutsättningarna för verksamheten bibehålls i och med att den personal som skött uppgifterna inom NTM-centralernas ansvarsområden för trafik överförs till Trafikverket. Eventuella nya resursbehov har identifierats och anknyter till att Trafikverket ända från planläggningsstadiet behöver kunna styra alla omständigheter som påverkar servicenivån i huvudvägnätet. 
Ur kundernas synvinkel kan centraliseringen av ovannämnda uppgifter i viss mån också skapa klarhet i situationen jämfört med nuläget, även om största delen av exempelvis tillståndsuppgifterna inom väghållningen redan sköts centraliserat. Med hjälp av den metod som anges i propositionen kan man så effektivt som möjligt främja en modern, holistisk och användar- och kundvänlig verksamhet i väghållningsuppgifterna. En centraliserad tillståndsbehörighet ökar medborgarnas jämlikhet, eftersom såväl grunderna för tillstånden som tillståndsprövningen kommer att vara enhetliga i hela landet. 
Vad arbetsmetoderna och uppgifterna beträffar kan förändringen också ha indirekta verkningar när det gäller att främja och uppnå de resultatmål som kommunikationsministeriet ställer upp för Trafikverket, eftersom läget efter reformen är att 18 separata landskap ska styras i stället för de nuvarande resultatstyrda NTM-centralernas ansvarsområden för trafik. Det tilltagande politiska beslutsfattandet kan åtminstone i teorin leda också till ineffektivitet och rentav till att åtgärder fördröjs. Genom politiska beslut kan det vara möjligt att styra bort finansiering från områden där den skulle behövas för att bevara trafikledsegendomen. Ur risksynvinkel kan detta leda exempelvis till att reparationsskulden ökar. 
Den föreslagna bestämmelse som möjliggör köp av uppgifter i terräng hos andra än myndigheter har konsekvenser för myndigheternas arbetsmetoder. Lagen föreslås bli kompletterad genom att det föreskrivs att Trafikverket, som i fortsättningen sköter till exempel tillståndsuppgifter inom väghållningen, genom avtal kan överföra till en privat tjänsteleverantör sådana biträdande uppgifter i terräng som anknyter till dessa uppgifter och till andra uppgifter som verket ska sköta. Myndighetsuppgifterna inom väghållningen har systematiskt koncentrerats, och det är redan praxis att man försökt säkerställa kännedomen om regionala förhållanden i praktiken i form av köpta tjänster när det gäller terrängarbeten som är operativa och tekniska. Denna praxis utgår från att de nämnda uppgifterna i terräng kan anses vara biträdande arbeten av tekniskt slag som inte innefattar utövning av offentlig makt. Det är inte heller fullkomligt klart att uppgiften genomgående är en offentlig förvaltningsuppgift. Enligt en mycket extensiv tolkning av begreppet offentlig förvaltningsuppgift är det emellertid befogat att komplettera landsvägslagen så, att det i lag föreskrivs om köp av uppgifter i terräng hos andra än myndigheter. Ur resurssynvinkel är uppgifterna i terräng något som är av betydelse för trafikförvaltningen, om de bör produceras enbart som tjänsteuppdrag. Ändringen har inte konstaterats ha några konsekvenser för myndigheternas resursbehov, eftersom dessa uppgifter i terräng som är tekniska och av biträdande slag har köpts i samband med väghållningsentreprenader.  
Det föreslås att trafiksäkerhetsverket ska få nya uppgifter gällande övervakningen av väghållning samt uppgifter som har samband med säkerhetsstyrningssystemet. Uppmärksamhet ska fästas i resurserna som uppgifterna kräver genom att till exempel dra nytta av järnvägarnas säkerhetsstyrningssystem och modellerna som används för övervakning. 
Konsekvenser för organisation och personal  
De främsta konsekvenserna för organisationen och personalresurserna hänför sig till de trafikuppgifter vid NTM-centralerna som kommer att överföras till landskapen, Trafikverkets nya styrroll i förhållande till landskapen och de uppgifter som i propositionen åläggs ministeriet. 
För närvarande finns det nio NTM-centraler med ansvarsområden för trafik. 
Sedan början av 2016 har genomförandet av väghållningen, det vill säga upphandlingen av underhåll och investeringar, skötts centralt på fyra områden: Södra (ansvarig: NTM-centralen i Sydöstra Finland), Västra (ansvarig: NTM-centralen i Egentliga Finland), Östra (ansvarig: NMT-centralen i Mellersta Finland) och Norra (ansvarig: NTM-centralen i Lappland). Personalen inom den centraliserade upphandlingen uppgår till cirka 105 årsverken. På riksnivå har också följande uppgifter centraliserats: väghållningstillstånd (NTM-centralen i Birkaland), trafikens kundservice (NTM-centralen i Birkaland), landsvägsfärje- och förbindelsefartygstrafiken i skärgården (NTM-centralen i Egentliga Finland), skadeersättningar och fordonsförflyttningar (NTM-centralen i Lappland) och trafiktelematik (NTM-centralen i Sydöstra Finland). Dessa uppgifter omfattar 73 årsverken. 
Väghållningen har effektiviserats starkt, och för att skapa en enhetlig servicenivå inom väghållningen och uppnå effektivare upphandlingar slogs redan vägdistrikten samman i stor utsträckning. Senare har effektiviseringen fortsatt vid NTM-centralerna, i första hand genom centralisering av upphandlingarna och funktionerna i syfte att trygga tillräckliga resurser för en högklassig skötsel av uppgifterna. När NTM-centralerna inledde sin verksamhet 2010 omfattade väghållningsuppgifterna cirka 520 årsverken, men i början av 2016 uppgick antalet årsverken till bara cirka 395. Sammanfattningsvis kan det konstateras att omkring hälften (50 %) av personalen och uppgifterna vid NTM-centralernas ansvarsområden för trafik har koncentrerats till antingen en eller flera NTM-centraler. 
En risk som landskapsreformen konstaterats medföra är framför allt att de nuvarande personalresurserna fördelas på flera landskap, vilket kan tänkas leda till att inte alla landskap kommer att ha tillräcklig sakkunskap i alla frågor som är viktiga för väghållningen, om de inte samarbetar över landskapsgränserna. Utan samarbete mellan landskapen skulle personalen behöva utökas med uppskattningsvis 40–50 % för skötseln av nuvarande uppgifter inom trafikförvaltningen (för närvarande produceras väghållningen beroende på uppgiftshelhet vid nio eller fyra enheter eller vid en enda enhet). Till helt nya ”väghållningsorter” skulle det behövas upp till 150–200 personer, och det är i praktiken inte möjligt att skaffa kompetens i den omfattningen. Ur statens synvinkel är det viktigt att man i samband med reformen säkrar det effektivaste sättet att framgångsrikt sköta statlig egendom och samtidigt bibehåller och utvecklar kompetensen så att befintliga och framtida synergifördelar utnyttjas. 
Också den omständigheten att centraliseringen av väghållningsupphandlingarna frångås kan, åtminstone innan verksamheten i landskapen har stabiliserats, i någon mån höja kostnaderna, eftersom en mer decentraliserad upphandling som sköts med en yrkeskompetens som är tunnare än nu kan leda till exempelvis fler besvär och på så sätt fördröja arbetena. Det är möjligt att kostnaderna per enhet stiger, men detta kan i sin tur påverkas genom styrning, exempelvis styrning av upphandlingsförfarandena. 
Det är i synnerhet till följd av behovet av särskild kompetens och knappheten på personalresurser som landskapen behöver samarbeta inom väghållningsuppgifter i och med landskapsreformen. I propositionen har man försökt beakta de risker som nämns ovan genom att ange att maximiantalet väghållningsområden är nio och dessutom genom att överföra uppgiftshelheter som inbegriper landskapsöverskridande intressen till Trafikverket (till exempel tillståndsärenden inom väghållningen). I propositionen har ambitionen också varit att beakta kompetens och resurser, eftersom en decentralisering av behörigheten mellan landskap, landskapens väghållningsområden och väghållaren kan leda till problemet att man inom såväl stats- som landskapsförvaltningen behöver ett visst antal experter med likartad kompetens, och experterna kan inte stå i tjänsteförhållande till både statsförvaltningen och landskapen. 
Genom ändringarna i lagens 2 kap., vilket gäller planering av landsväg, blir landsvägsplaneringen som regel en uppgift för landskapens väghållningsområden. Väghållaren kan dock av särskilda skäl ta ansvar för att utredningsplanen eller vägplanen utarbetas. Ett särskilt skäl kan vara exempelvis projektets stora betydelse. Som viktiga vägprojekt betraktas åtminstone de projekt som nämns särskilt i statsbudgeten. Till denna del överförs personalen vid NTM-centralernas ansvarsområden för trafik till landskapen, och därför kommer Trafikverket att behöva fylla ett resursbehov inom planeringen. 
Konsekvenser för resurserna kan uppkomma också genom att det inte är absolut säkert att det i början av landskapsreformen är möjligt att tillhandahålla alla stödresurser som Trafikverket med stöd av nuvarande styr- och verksamhetsmodell nu producerar för NTM-centralernas ansvarsområden för trafik. 
Ansvaret för ordnande av offentlig persontrafik och för dess servicenivå (inklusive köpta tjänster) övergår från NTM-centralerna till landskapen, som kan ordna saken på det sätt som de anser vara bäst. Landskapen ska bedöma huruvida den offentliga persontrafiken kan ordnas på marknadsvillkor eller offentligt stöd behövs. När servicenivån bedöms är det nödvändigt att beakta trafikförbindelserna mellan olika kommuner och landskap. Genomförandet av verksamheten förutsätter nära samarbete av både regional och landskapsöverskridande art. När lagen om transportservice träder i kraft den 1 juli 2018 blir det möjligt för landskapen att kombinera transporter friare än för tillfället. Stödet till de medelstora och stora städernas kollektivtrafik fortbestår. Att planera och ordna tjänsterna kräver kompetens och tillräckliga resurser när uppgifterna överförs från nio NTM-centraler till de 18 landskapen. Verksamheten avses omfatta väg-, järnvägs- och flygtrafik samt, som en specialfråga, Kvarkentrafiken. Verksamheten hör till de uppgifter till vilka allmän finansiering används, bortsett från uppgifter i samband med statsunderstöd och köp av flygtrafik samt Kvarkentrafiken.  
4.3
Konsekvenser för personalen
Lagförslagets samlade konsekvenser för personalen 
Enligt den föreslagna lagen ska vart och ett av de 18 landskapen svara för styrningen av landskapets trafiksystemplanering, integreringen av den med landskapets övriga planering och samarbetet mellan olika aktörer i trafiksäkerhetsarbetet. Varje landskap ska också besluta om landskapets plan för väghållning och trafik och om godkännandet av avtalet om väghållning. Beredningen av planen och avtalet kan dock göras inom väghållningsområdet av en aktör som landskapen enats om. 
I överensstämmelse med de uppgiftsområden som anges i 6 § i landskapslagen kan landskapet ha hand om ordnande och planering av trafiktjänster, offentlig persontrafik och skärgårdstrafiken. Uppgiften är frivillig, men om landskapet åtar sig att svara för dessa helheter kan de kommunala och regionala myndigheterna vara behöriga myndigheter också i fortsättningen. Varje landskap ska också besluta om bidrag för förbättring av enskilda vägar, främja mobilitetsstyrningen samt planera och ordna skärgårdstrafiken i de landskap som tillhandahåller sådan trafik och som i landskapsstrategin åtagit sig att sköta uppgiften. Uppgifter som gäller offentlig persontrafik regleras i lagen om transportservice (320/2017), bidrag för enskilda vägar regleras i lagen om enskilda vägar (358/1962) och ordnandet av skärgårdstrafik regleras i lagen om främjande av skärgårdens utveckling (494/1981). 
Den personal vid NTM-centralerna som skött väghållningsuppgifter flyttas enligt uppgiftsfördelningen här ovan till landskapen och Trafikverket. 
I tabellen nedan anges de uppskattade konsekvenser för personalen som följer av att uppgifter överförs från NTM-centralernas ansvarsområden för trafik och från närings-, trafik- och miljöcentralernas samt arbets- och näringsbyråernas utvecklings- och förvaltningscenter, det vill säga KEHA-centren, enligt de lagar som ingår i denna proposition och enligt andra författningar inom kommunikationsministeriets förvaltningsområde som tangerar landskapsreformen (lagen om enskilda vägar, lagen om transportservice, lagen om främjande av skärgårdens utveckling). Vid den fortsatta beredningen fastställer man mer exakt antalet årsverken som överförs; då beaktas det hur kompetensen och verksamhetsresurserna samt uppgifterna och personalen fördelas mellan landskapen, trafikstyrningsbolaget och Trafikverket enligt bestämmelserna om överföringar. Det är meningen att överföringarna ska ske den 1 januari 2020.  
Uppgift (ansvar) 
Årsverken 1.2.2017 
Anordnare 2020 
Expertuppgifter inom trafiken (alla NTM-centraler) av vilka  
– Kollektivtrafikuppgifter 30 årsverken 
– Bidrag för enskilda vägar 6 årsverken 
– Styrning av trafiksystemarbetet 6 årsverken 
120 
Landskapen 
Landskapen 
Landskapen 
Planering av väghållning och förvaltning av trafikledsegendom (alla NTM-centraler) 
– Anskaffning av mark för vägar och banor samt förvaltning av fastigheter 
– Planering av väghållning 
118 
13 
105 
Trafikverket 
Landskapen 
Upphandling av underhåll och byggande av landsvägar samt verksamheten under avtalsperioden 
– Styrning av och stöd för konkurrensutsättning av områdesentreprenader för vägskötsel (NTM-centralen i Egentliga Finland) 
– Övriga 
100 
98 
Trafikverket 
Landskapen 
Landsvägsfärjetrafik (förlängning av väg) 
Trafikverket 
Förbindelsefartygstrafik i skärgården 
Landskapen 
Trafiktelematik (NTM-centralen i Sydöstra Finland) 
Expertuppgifter inom vägtunnelsäkerhet 
Utveckling av upphandlingar, tjänster och smart trafik samt nationellt och internationellt samarbete 
Expertuppgifter inom trafikledning och telematik 
Trafikverket 
Trafikverket 
Trafikstyrningsbolaget 
Tillståndsuppgifter inom väghållningen (NTM-centralen i Birkaland) 
40 
Trafikverket 
Kundservicefunktionen (NTM-centralen i Birkaland) 
12 
Trafikstyrningsbolaget 
Skadeersättningar och fordonsförflyttningar (NTM-centralen i Lappland) 
Trafikverket 
Museiverksamhet och traditionsarbete (NTM-centralen i Birkaland) 
Trafikverket 
KEHA/ Ekonomiförvaltningsuppgifter som betjänar väghållningen 
Trafikverket 
KEHA/ Utbetalningsuppgifter inom markanskaffning som hänför sig till väghållning 
Trafikverket 
KEHA/ Upprätthållande och utvecklande av informationssystem som stöder tillståndsservicen inom väghållningen 
Trafikverket 
KEHA/ Dokumentförvaltningsuppgifter inom väghållningen som är relaterade till de uppgifter som överförs (bland annat tillståndsservice) 
Trafikverket 
Sammanlagt 
Hos landskapen: 325 årsverken 
Vid Trafikverket: 83 årsverken 
Inom trafikstyrningsbolaget: 19 årsverken 
427 
 
Ställningen för den personal som överförs till landskapen  
God personalpolitik ska iakttas vid reformen. En lyckad förändringsledning förutsätter öppenhet och att personalen ges möjlighet att medverka i genomförandet av reformen. När reformen genomförs ska det dras försorg om personalens tillgång till information och möjligheter att påverka. 
Enligt propositionen ska överföringen av personal till landskapen och sammanslutningar som hör till landskapskoncernen eller där landskapet har bestämmande inflytande betraktas som överlåtelse av rörelse i samband med landskapsreformen. I fråga om den personal som övergår från landskapsförbunden ska bestämmelserna om överlåtelse av rörelse i arbetsavtalslagen och lagen om kommunala tjänsteinnehavare och i fråga om den personal som övergår från staten bestämmelserna om överlåtelse av rörelse i statstjänstemannalagen och arbetsavtalslagen tillämpas på alla förändringar som innebär byte av arbetsgivare i samband med reformen, oberoende av om de kännetecken för överlåtelse av rörelse som föreskrivs i de nämnda lagarna föreligger eller inte. Om personen först anställs hos ett landskap och sedan förflyttas till en sammanslutning som hör till en landskapskoncern eller som kontrolleras av landskap, ska bestämmelserna om överlåtelse av rörelse i lagen om införande iakttas vid personalförflyttningar som görs före utgången av 2021. Vid personalförflyttningar efter detta ska de gällande lagarnas bestämmelser om överlåtelse av rörelse iakttas. 
En person anställs hos landskapet eller hos en sammanslutning som hör till landskapskoncernen eller där landskapet har bestämmande inflytande, om de uppgifter som överförs dit utgör minst hälften av personens faktiska arbetsuppgifter. 
De anställda övergår som så kallade gamla anställda och behåller de rättigheter och skyldigheter som de har i arbetsavtals- eller tjänsteförhållandet vid tidpunkten för överföringen. Den nya arbetsgivaren är skyldig att fram till utgången av avtalsperioden följa bestämmelserna i det arbets- eller tjänstekollektivavtal som gäller vid tidpunkten för överlåtelsen och som var bindande för den tidigare arbetsgivaren. Efter att avtalsperioden har löpt ut övergår man till att tillämpa ett nytt arbets- eller tjänstekollektivavtal som är bindande för arbetsgivaren. 
Överlåtelse av rörelse är inte i sig en grund för att ändra villkoren i ett anställningsförhållande. Personalens uppgifter kan ändra när de uppgifter som överförs kombineras på ett nytt sätt till en helhet. De förändrade uppgifterna kan också få konsekvenser för lönen. 
De som är anställda på viss tid övergår vid överlåtelsen av rörelse till att vara anställda hos den nya arbetsgivaren under den tid anställningsförhållandet för viss tid varar. En stor del av anställningarna för viss tid upphör förmodligen vid utgången av 2019. 
Anställda som har tagit familjeledigt från sin anställning hos den tidigare arbetsgivaren ska hos den nya arbetsgivaren ha rätt att återvända i första hand till sitt tidigare arbete. 
Om en person överförs till en anställning hos ett sådant servicecenterbolag som producerar ekonomi- och personalförvaltningstjänster för landskapen och som inte hör till en landskapskoncern eller i vilket landskapen inte har bestämmanderätt, ska de allmänna bestämmelserna om överlåtelse av rörelse tillämpas i den situationen. 
Det har föreslagits att tillämpningsområdet för lagstiftningen om kommunala anställningsförhållanden ska utvidgas till att gälla även landskapets personal, så statligt anställda börjar omfattas av den nya lagstiftningen om anställningsförhållanden. En del av de statsanställda kommer att anställas i arbetsavtalsförhållanden och att omfattas av lagstiftningen om arbetsavtalsförhållanden. Om överföringen sker till en sammanslutning som ingår i en landskapskoncern eller som kontrolleras av landskap, eller till ett annat servicecenterbolag som producerar tjänster för landskapen och faller utanför dessa definitioner, blir tjänstemannen anställd i arbetsavtalsförhållande. 
Det har föreslagits att landskapens intressebevakning för arbetsgivare ska ordnas så att Kommun- och landskapsarbetsgivarna KT är arbetsgivarnas intressebevakare. Till Kommun- och landskapsarbetsgivarna KT:s uppgifter hör att samråda och avtala på sina medlemssamfunds vägnar om villkoren för personalens anställningsförhållanden samt att samråda och avtala om avtal och rekommendationer på centralorganisationsnivå. 
Utgångspunkten är att bara de som är anställda i tjänsteförhållande har rätt att utöva offentlig makt. Detta kan dock frångås genom bestämmelser om att uppgiften anförtros någon annan än en myndighet under de förutsättningar som anges i 124 § i grundlagen. Uppgifter som innebär betydande utövning av offentlig makt får bara anförtros myndigheter. Som betydande utövning av offentlig makt betraktas till exempel på självständig prövning baserad rätt att använda maktmedel eller att på något annat konkret sätt ingripa i en enskild persons grundläggande fri- och rättigheter. Uppgifter som innebär betydande utövning av offentlig makt eller uppgifter som inte kan anförtros någon annan än en myndighet sköts av landskapet. Således kommer utgångspunkten att vara att den personal som är anställd i tjänsteförhållande och sköter uppgifter som innebär utövning av offentlig makt anställs hos landskapen. 
Tilläggspensionerna för den personal som från landskapsförbunden och staten övergår till landskapen samt sammanslutningar som hör till en landskapskoncern eller som kontrolleras av landskap ska säkerställas genom bestämmelser som utfärdas separat. Om en person övergår från staten till anställning hos ett sådant servicecenterbolag som producerar ekonomi- och personalförvaltningstjänster för landskapet och som inte hör till en landskapskoncern eller kontrolleras av landskap, ska personens rätt till tilläggspension tryggas genom avtal. 
När personalen har övergått i anställning hos landskapen vid ingången av 2020 ska varje landskap fastställa sin personal- och lönepolitik inom de gränser som lagstiftningen och arbets- och tjänstekollektivavtalen anger. Kostnadseffekten av löneharmoniseringen bestäms enligt hur de uppgiftsbaserade lönenivåerna fastställs i landskapen och enligt tidtabellen för harmonisering av anställningsvillkoren och lönerna. 
Ställningen för den personal som övergår till Trafikverket  
God personalpolitik ska iakttas vid reformen. En lyckad förändringsledning förutsätter öppenhet och att personalen ges möjlighet att medverka i genomförandet av reformen. När reformen genomförs ska det dras försorg om personalens tillgång till information och möjligheter att påverka. 
Vid personöverföringar mellan statliga ämbetsverk tillämpas principerna i 5 a–c § i statstjänstemannalagen. Huvudregeln är då att tjänsterna och de tjänstemän som utnämnts till tjänsterna överförs till samma ämbetsverk som uppgifterna överförs till. Tjänstemän som utnämnts till ett anställningsförhållande för viss tid övergår till anställning hos den nya arbetsgivaren för den tid anställningsförhållandet för vis tid varar. 
När det gäller den personal som överförs till Trafikverket kommer uppgifternas svårighetsgrad och de individuella arbetsprestationerna att bedömas och lönerna att bestämmas enligt Trafikverkets lönesystem. 
Ställningen för den personal som övergår till trafikstyrningsbolaget 
God personalpolitik ska iakttas vid reformen. En lyckad förändringsledning förutsätter öppenhet och att personalen ges möjlighet att medverka i genomförandet av reformen. När reformen genomförs ska det dras försorg om personalens tillgång till information och möjligheter att påverka. 
Avsikten är att till det aktiebolag (nedan bolaget) som avses bli bildat genom den föreslagna lagen om ombildning av Trafikverkets trafikstyrnings- och trafikledningstjänster till aktiebolag (RP /2018 rd) överföra de sakkunniguppgifter inom trafikledning och trafiktelematik samt trafikens kundservicefunktion som har skötts vid NTM-centralerna. Tjänsterna för dem som sköter dessa uppgifter dras in och på dem baserade tjänsteförhållanden och tjänsteförhållanden för viss tid upphör utan uppsägning. Trafikverkets personal i tjänsteförhållande inom trafikstyrnings- och trafikledningstjänster anställs i arbetsavtalsförhållande hos bolaget. För indragningen av tjänster och avslutandet av tjänsteförhållanden krävs inte tjänstemännens samtycke. Personal i tjänste- och arbetsavtalsförhållande för viss tid anställs eller överflyttas till bolaget för motsvarande tid i arbetsavtalsförhållande för viss tid. 
I fråga om arbetstagare och anställningsvillkor tillämpas vad som föreskrivs i lag eller föreskrivs eller bestäms med stöd av lag och vad som avtalas i kollektivavtal och arbetsavtal som är bindande för bolaget.  
Efter bolagiseringen omfattas personalen av den privata sektorns arbetspensionssystem i stället för av pensionslagen för den offentliga sektorn (81/2016). Principen ska vara att det nya pensionsskyddet för anställda som flyttar över från NTM-centralerna till bolaget ska motsvara det nuvarande intjänade pensionsskydd som en person anställd av staten har i förhållande till sin pensionsålder, storleken av statens grundpension och tilläggspensionstillväxten. Personalens kommande pensionstillväxt är densamma i såväl det statliga som det privata pensionssystemet. För att bibehålla pensionsskyddet enligt ovan ska det nya bolaget teckna en separat tilläggspensionsförsäkring. Engångskostnaden för tilläggspensionsskyddet uppskattas till cirka 80 000 euro. 
I övrigt bedöms de konsekvenser som hänför sig till bolagiseringen av trafikstyrningen och trafikledningen i regeringens proposition med förslag till lag om ombildning av Trafikverkets trafikstyrnings- och trafikledningstjänster till aktiebolag och till vissa lagar som har samband med den (det är meningen att propositionen ska överlämnas våren 2018 / (RP /2018 rd). 
Samarbete  
Vid beredningen av landskapsreformen ska lagen om samarbete mellan kommunala arbetsgivare och arbetstagare (449/2007) och lagen om samarbete inom statens ämbetsverk och inrättningar (1233/2013) iakttas. De arrangemang som genomförs efter det att landskapen inrättats behandlas i samarbete enligt den föreslagna lagen om samarbete mellan arbetsgivare och arbetstagare i kommuner och landskap. 
De arrangemang som landskapsreformen förutsätter bereds i samarbete med representanter för den personal som är föremål för ändringar. När man beaktar reformens omfattning och vikten av att säkerställa kontinuiteten i fråga om skötseln av de uppgifter som överförs och servicekapaciteten, är det viktigt med tanke på att reformen ska bli lyckad att samarbetsförhandlingarna inleds i tid och att beredningen är öppen för insyn. Beredningen förutsätter en avsevärd arbetsinsats av personalrepresentanterna. I de samarbetslagar som nämns ovan föreskrivs det om arbetsgivarens skyldighet att bevilja personalrepresentanter befrielse från arbetet. 
Samarbetsförhandlingarna ska inledas i god tid innan det fattas sådana beslut om överföring av uppgifter som har betydande konsekvenser för personalen. Ett stegvis genomförande av förändringen kan leda till flera samarbetsförhandlingar vid statliga ämbetsverk som gäller uppgiftsöverföringar. 
I övrigt hänvisas det till den bedömning av konsekvenserna för personalen som ingår i regeringens proposition med förslag till lagstiftning om verkställigheten av landskapsreformen och om omorganisering av statens tillstånds-, styrnings- och tillsynsuppgifter (RP 14/2018 rd).  
4.4
Konsekvenser för jämställdheten mellan könen
I reformen ska bestämmelserna i lagen om jämställdhet mellan kvinnor och män (609/1986) iakttas. 
Landskapen och de andra nya arbetsgivarna är bundna av förbudet i lagen om jämställdhet mellan kvinnor och män att tillämpa lönevillkor eller andra anställningsvillkor så att en eller flera arbetstagare på grund av sitt kön försätts i en mindre fördelaktig ställning än en eller flera andra arbetstagare som är anställda hos arbetsgivaren i samma eller likvärdigt arbete. Genom en lönekartläggning som avses i 6 a § i jämställdhetslagen ska det utredas att det inte förekommer ogrundade löneskillnader mellan kvinnor och män som är anställda av samma arbetsgivare och som utför arbete som är att betrakta som lika eller likvärdigt.  
Enligt uppgifter från 2016 var cirka 59 % av de anställda vid NTM-centralerna och KEHA-centren kvinnor.  
De övriga ändringar som föreslås i lagarna har inte konstaterats ha några konsekvenser för jämställdheten. 
4.5
Konsekvenser för miljön
Propositionen har inte konstaterats ha några direkta konsekvenser för miljön. Det kan dock konstateras att den långsiktiga trafiksystemplanering som ingår i propositionen beaktar också framtida trafikbehov och miljöaspekter. Trafiksystemplaneringen är en samlad bedömning, och om den fungerar bra kan den förmodas ha positiva konsekvenser också för miljön. På lång sikt kan reformen följaktligen ha en positiv inverkan också på människors hälsa och livsmiljö och en dämpande effekt på klimatförändringen. 
Regleringen om nivån på landsvägsunderhållet och om landsvägarnas servicenivå kan ha positiva konsekvenser för miljön. Kortare körtider och jämnare färdhastighet ger lägre bränsleförbrukning. Färre viktbegränsningar, till exempel på broar som är viktiga för näringslivet, möjliggör för sin del kostnadseffektivare transporter när tunga transporter inte behöver ta omvägar på grund av viktbegränsningar. 
I det föreslagna 2 kap. föreskrivs om projektbedömning som inriktar sig på såväl den naturliga som den byggda miljön. Lagstadgad projektbedömning förbättrar kvaliteten på bedömningen och förenhetligar rutinerna, vilket gör att projektens miljökonsekvenser blir mer jämförbara i detta avseende. 
Med stöd av bestämmelserna om planeringsgrunder i 2 kap. är det möjligt att som underlag för den fortsatta planeringen ange exempelvis ett alternativ som specifikt granskats i samband med bedömningen av miljökonsekvenserna. Då är det också möjligt att via planeringsgrunderna i propositionen (15 r §) påverka även eventuella miljökonsekvenser, till exempel vidta åtgärder för att förhindra en viss placering av en väg och motverka de negativa konsekvenserna av placeringen. 
Propositionen har inte konstaterats medföra konsekvenser för användningen av naturresurser och energi. Framöver kommer man att påverka förhållandena mellan olika trafikformer särskilt vid trafiksystemplaneringen, som också tar upp mobilitetsbehoven på ett allmänt plan. Det är således möjligt att genom trafiksystemarbetet såväl påverka som styra användningen av olika mobilitetsformer, vilket på lång sikt kan ha konsekvenser också för stävjandet av trafikutsläpp och för människors hälsa och livsmiljö. 
4.6
Övriga samhälleliga konsekvenser
Landsvägarna har en stor betydelse för näringslivet och människors mobilitet, eftersom järnvägs- och flygplatsnätet inte tillgodoser hela landets behov. Vägtrafiksystemet har en central ställning med tanke på konsekvenserna för regionutvecklingen och utvecklingen av regionerna. Trafiksystemplanering och långsiktig utveckling av vägnätet skapar förutsättningar för boende och näringsverksamhet i landets olika delar, samtidigt som de bidrar till uppkomsten av en hållbar och balanserad regionstruktur. Genom väghållning bör man kunna främja regionernas egna utvecklingsstrategier och de regionala särdragen med hänsyn till landskapsövergripande behov och statens intressen som ägare till trafikledsegendomen. Genom ändringen av landsvägslagen överförs ansvaret för väghållningsuppgifterna till landskapen, och i enlighet med styr- och finansieringsmodellen ska finansieringen av väghållningen specificeras enligt landskap baserat på vägnätets egenskaper och andra omständigheter. Styr- och finansieringsmodellen har syftet att säkerställa ett enhetligt landsvägsnät med vägar i likvärdigt skick. Å andra sidan kan landskapens roll inom väghållningen samt den regionala sakkunskapen och det regionala beslutsfattandet också förbättra särskilt underhållet av och nivån på det lägre vägnätet, om man i landskapen och på väghållningsområdena klarar av att bättre än nu inrikta åtgärderna efter behov och utifrån regional sakkunskap. Man kan också förmoda att strävan efter kortsiktiga fördelar kommer att bli mer flexibel än i dag, även om fokus med tanke på förvaltningen av vägnätsegendomen huvudsakligen bör ligga på långtidsgranskning och på att inrikta finansieringen av väghållningen på det sätt som är mest lämpligt ur den aspekten. 
Ur regionutvecklingsperspektiv bidrar vägprojekt i centrumområden och utvecklingen av förbindelseleder som fungerar som genomfartsleder för den långväga trafiken totalt sett mer effektivt till att göra glesbygden tillgänglig än sådana projekt som genomförs i själva glesbygden, eftersom glesbygdsprojekten påverkar ett geografiskt område som är betydligt snävare med tanke på tillgängligheten. Välfungerande trafikförbindelser mellan ett kärnområde och övriga områden (till exempel landsvägarnas stomnät) kan dock påskynda den regionala koncentrationen av ekonomisk aktivitet till kärnområdet, om det finns goda trafikförbindelser från kärnområdet till alla delar av landet men förbindelserna mellan områdena inte fungerar eller deras servicenivå inte är tillräcklig. För att uppnå en jämn utveckling bör man kunna förbättra tillgängligheten också mellan olika områden och regioncentra, till exempel genom att förbättra förbindelselederna mellan sådana knutpunkter för trafiken som är centrala för den regionala tillgängligheten. Aspekter av detta slag bör enligt propositionen beaktas vid långsiktig trafiksystemplanering. 
Allmänt taget kan man göra bedömningen att ändringarna i propositionen inte bör ha några större konsekvenser ur regionutvecklingsperspektiv, om man iakttar den finansierings- och styrmodell som ingår i propositionen. Men om Trafikverkets möjligheter att styra och påverka försvagas jämfört med nuläget är det i praktiken inte möjligt att garantera sådana jämlika regionutvecklingsmöjligheter som en enhetlig väghållning förväntas bidra till och som främjas genom väghållningsåtgärder. Det är också naturligt att varje landskap försöker stärka livskraften och bland annat förutsättningarna för näringslivsverksamhet i sitt område. Detta kan även ha konsekvenser för regionutvecklingen och etableringen av funktioner på längre sikt. 
Det enhetliga bestämmande av servicenivån och de krav för kvalitetsnivån som ingår i propositionen kommer att främja ett så jämlikt bemötande som möjligt av medborgarna och näringslivet i olika delar av landet. Landsvägsnätets skick har vidsträckta samhälleliga konsekvenser för både kunderna och väghållaren, det vill säga staten. 
Ett trafiknät i dåligt skick ökar de logistiska kostnaderna i form av ökande körtider och körkostnader. Reparationsskulden för trafiklederna förlänger res- och transporttiderna och försvagar deras förutsebarhet och exakthet. Viktbegränsningarna minskar effektiviteten hos näringslivets transporter när det blir nödvändigt att ty sig till omvägar. De som använder trafiknätet gör av med mer bränsle. Ett vägnät i dåligt skick ökar olägenheterna i form av vibrationer och buller. Dessutom minskar det väganvändarnas körkomfort, och kostnaderna för fordonsreparationer stiger. Om trafiknätet är i dåligt skick påverkas också trafiksäkerheten, och utsläppsmängden påverkas i någon mån. 
För väghållaren, alltså staten, innebär en ökning av reparationsskulden att de akuta, plötsliga, reparationsbehoven stiger. De framtida kostnaderna för vägreparationer stiger desto mer ju längre reparationsskulden tillåts stiga. Vinterunderhållet av vägarna försvåras och fördyras när vägarnas skick försvagas och nivån på vinterunderhållet sjunker. Också kraven på ersättning för skador växer, och kundernas ökade missnöje kan leda till lösningar som är ineffektiva på kort sikt. 
Reglering om nivån på underhållet väntas främja det jämlika bemötandet av medborgare och företag i olika delar av landet, eftersom vägar som till sin betydelse och sina trafikmängder är på samma nivå bör erbjuda en enhetlig nivå på underhållet. Att utfärda bestämmelser om underhållet leder också till förutsebar information om vilken kvalitetsnivå det gäller att tillhandahålla på respektive väg. Väntevärdet är att konsekvenserna för vägarnas skick är positiva. 
Landskapens regionala intressen och beslutsfattandets politiska dimension kan utan Trafikverkets möjlighet att påverka och styra inrikta åtgärderna och finansieringen av dem så, att regionutvecklingsaspekten inte betraktas på ett oavhängigt sätt i processen. Lokalt kan utvecklingen också påverkas av att landsvägshållningen i högre grad är landskapens ansvar; följden kan vara ett mångsidigare metodurval vid lösningen av eventuella problem som föranleds av vägnätet och bemötandet av utmaningar. I praktiken kan det innebära till exempel en mer återhållsam attityd till att bygga i och utveckla glesbygdsområden, eftersom den samlade granskningen också inbegriper kostnaderna för landsvägsunderhåll. Det kan vara så att landskapen har ett allt större intresse av att rikta anslagen för väghållning till de delar av nätet där åtgärderna har en så stor inverkan som möjligt på livskraften och framgångsfaktorerna i landskapet. 
Behörighetsfördelningen när det gäller planering av landsvägar har inte konstaterats ha några konsekvenser för medborgarnas ställning. Medborgarnas lika möjligheter att delta samt växelverkan vid planeringen av landsvägar tryggas genom lag. Förfarandet för växelverkan är detsamma oberoende av om det är landskapet eller Trafikverket som svarar för ett projekt. 
Vad säkerheten och beredskapen beträffar ingår i propositionen ett förslag till en bestämmelse om skyldighet att vidta förberedelser för störningar och undantagsförhållanden; där ingår bemyndiganden för Trafiksäkerhetsverket att övervaka att skyldigheten fullgörs och att utfärda föreskrifter om saken. Beredskapsbestämmelsen bidrar till att säkerställa att den nationella enhetlighet som är väsentlig för beredskapen uppnås trots förändringarna i aktörsfältet på väghållningens område. Regleringen om beredskap minskar också de potentiella risker som i anknytning till beredskapen kan uppkomma vid väghållningsrelaterade förändringar där landskapen blir ansvariga för vissa väghållningsuppgifter enligt landskapslagen. Bestämmelsen förpliktar väghållaren att i samarbete med landskapen inom väghållningsområdet förbereda sig för störningar i de normala förhållandena och för undantagsförhållanden, så skyldigheten har konsekvenser också för Trafikverkets och landskapens resurs- och kompetensbehov. För Trafiksäkerhetsverket föreslås ett bemyndigande att övervaka beredskapen, och verket bemyndigas också att utfärda närmare föreskrifter om den beredskapsplanering som krävs av väghållaren och landskapen.  
Genom den föreslagna ändringen av sjötrafiklagen (463/1996) görs det möjligt för kommunen att ta ut en avgift för tillstånd som söks för återkommande eller permanent anordnande av tävlingar eller övningar med motordrivna farkoster eller för anordnande av ett enskilt evenemang, om evenemanget förväntas orsaka betydande olägenheter för miljön. 
Propositionen har inte konstaterats ha några konsekvenser för de grundläggande fri- och rättigheterna enligt 2 kap. i grundlagen, för rätten till jämlikhet och icke-diskriminering eller konsekvenser för barn, och inte heller några könsrelaterade konsekvenser. Inte heller har det konstaterats några konsekvenser för sysselsättningen, men på längre sikt kan landskapens roll stärka näringslivets verksamhetsförutsättningar och följaktligen också sysselsättningen i landskapen. 
Konsekvenser för landsvägsnätet och trafiksystemet som helhet 
Förutsatt att den finansierings- och styrmodell för väghållning som presenteras i propositionen fungerar i praktiken, kommer de reformer som följer av propositionen i sig åtminstone inte att försvaga trafikledsnätets skick. 
Målet för den trafiksystemplanering som ingår i propositionen är att främja ett långsiktigt samarbete mellan staten, landskapen och kommunerna i syfte att skapa ett fungerande och hållbart trafiksystem. Enligt propositionen ska i utredningsplanerna för landsvägar läggas fram en redogörelse för hur man i planen har beaktat målen i den riksomfattande trafiksystemplanen och i trafiksystemplanen på landskapsnivå. Att trafiksystemplanen beaktas vid den mer detaljerade planeringen ökar således förutsättningarna för att de riksomfattande målen och landskapens mål uppnås, vilket utifrån ett bredare synsätt har samhälleliga konsekvenser. 
De föreslagna bestämmelserna i 2 kap. om planering och byggande av landsväg har inte som sitt huvudsakliga syfte att skapa nya skyldigheter eller förfaranden, utan målet är att man genom att lagstadga ser till att nuvarande goda och ändamålsenliga praxis iakttas i samband med landskapsreformen. För närvarande iakttas förfarandena med stöd av Trafikverkets anvisningar som inte är rättsligt bindande. 
5
Beredningen av propositionen
Propositionen har beretts vid kommunikationsministeriet i samarbete med Trafikverket. Vid beredningen har man också samarbetat med de nuvarande NTM-centralernas ansvarsområden för trafik och med landskapsförbunden. I april 2017 ombads landskapsförbunden, ministerierna, ämbetsverk inom kommunikationsministeriets förvaltningsområde och vissa organisationer att som stöd för beredningen kommentera bedömningspromemorian om reformbehoven. 
5.1
Remissyttranden och hur de har beaktats
Yttranden om utkastet till regeringens proposition med förslag till ändring av landsvägslagen kunde ges in mellan den 5 juli och den 4 september 2017. Omkring 90 yttranden gavs in före den 21 september 2017. Som helhet togs propositionen emot positivt, men ett flertal detaljer föreslogs bli preciserade eller ändrade på något annat sätt.  
Den föreslagna modellen för ordnande av väghållningen ansågs till övervägande del vara bra. Det ansågs att rollerna och ansvarsförhållandena behövde förtydligas. Landskapsförbunden var bekymrade för de framtida landskapens faktiska rörelsefrihet och inbördes jämlikhet. Bland annat företrädare för näringslivet var bekymrade för att kostnaderna för väghållningen kanske stiger och för att väghållningens nivå och verksamhetsmetoder eventuellt kommer att skilja sig åt i de olika landskapen. Det önskades tydligare bestämmelser om finansieringen, och likaså en tydligare koppling mellan exempelvis de processer som hör ihop med planen för respektive avtalet om väghållning å ena sidan och andra landskapsprocesser å andra sidan. Ett orosmoment som var gemensamt för remissinstanserna gällde tryggandet av att landskapens resurser och kompetens räcker till. Vid den fortsatta beredningen var ambitionen att förtydliga modellen för ordnande av väghållningen och regleringen om aktörernas ansvar. Motiveringarna kompletterades för att modellen för det framtida ordnandet av väghållningen och de föreslagna bestämmelsernas betydelse för olika aktörer skulle framgå tydligare.  
Inställningen till den föreslagna samlade trafiksystemplaneringshelheten och till utfärdandet av bestämmelser om den på lagnivå var positiv. Det ansågs vara behövligt och viktigt att införa en långsiktig riksomfattande trafiksystemplan. Det önskades att mer uppmärksamhet skulle ägnas åt kommunernas roll och att också andra aktörers roller skulle förtydligas ytterligare. En finslipning av planeringsprocesserna ansågs vara behövlig. Vid den fortsatta beredningen ägnades kopplingarna mellan trafiksystemplaneringen och den övriga områdes- och markanvändningsplaneringen uppmärksamhet och förtydligades. Dessutom utökades den föreslagna regleringens smidighet genom att den gjordes koncisare, sammanfördes och förenhetligades. Utkastet förtydligades också genom att det betonades att trafiksystemplaneringen är interaktiv och genom att också kommunernas roll i trafiksystemplaneringen behandlades mer ingående i motiveringen. Beträffande trafiksystemplaneringen, och också i övrigt, har det i propositionen gjorts ansträngningar för att beakta även de krav och möjligheter som följer av att trafiken blir allt mer tjänstefierad och av att digitaliseringen och automatiseringen utvecklas.  
De förslag som handlade om landsvägarnas servicenivå och det nationellt viktiga stomnätet ansågs vara mycket välkomna och behövliga. I yttrandena ansågs det emellertid att det ännu återstår att precisera bland annat vilka faktorer som inverkar på servicenivån. Vid den fortsatta beredningen gjordes försök att precisera målen för den servicenivå som ska gälla landsvägar och att tydligare ange vilka faktorer som är centrala för servicenivån. Vidare omorganiserades kraven för utvecklande, underhåll och byggande av landsvägar, vilka fanns i 13 § i det tidigare utkastet och finns i 3 och 13 § i gällande lag, vid den fortsatta beredningen för att det tydligare skulle framgå att de är allmänna krav för väghållning. De påverkar för sin del den servicenivå som förutsätts när det gäller landsvägar. Som en faktor som inverkar på uppnåendet av servicenivån fogades till lagförslaget vid den fortsatta behandlingen också bestämmelser om egenkontroll och myndighetstillsyn.  
Frågan om huruvida det ska bli avgiftsbelagt att använda landsvägar togs upp i ett stort antal yttranden. Bestämmelsen i fråga hade föreslagits bli ändrad bara med avseende på de behöriga myndigheterna. Exempelvis vissa landskapsförbund, städer och stadsregioner, miljöministeriet och Kommunförbundet ansåg att det finns behov av att skapa förutsättningar för att införa avgifter. En del av de andra remissinstanserna motsatte sig häftigt tanken på avgifter. Vid den fortsatta beredningen gick man in för att i denna proposition inte föreslå några ändringar som är relaterade till avgiftsbeläggande. Med avseende på 81 § i grundlagen utgör dessutom exempelvis vinjettavgifter för den tunga trafiken och trängselavgifter skatter, och sådana ska det föreskrivas om i skattelagar. 
Det ansågs finnas behov av att precisera konsekvensbedömningen särskilt avseende konsekvenserna för personalen och det behov av tilläggsresurser som förändringen medför. Fram steg likaså bedömningen av informationssystemens kostnadseffekter, miljökonsekvenserna, konsekvenserna i fråga om trafiksäkerheten och konsekvenserna för jämställdheten mellan könen samt behovet av att komplettera dem. Konsekvensbedömningen kompletterades i den utsträckning det var möjligt.  
Vidare lyftes i yttrandena fram bland annat regleringen om kostnader och ansvar i samband med flyttning av ledningar och kablar som placerats på landsvägsområde. Vid den fortsatta beredningen utreddes placeringen av ledningar och andra konstruktioner, anläggningar och anordningar på vägområde och därtill hörande frågor genom att en juridisk utredning med anknytning till saken beställdes. Meningen är dock att beredningen ska fortgå i form av en helhet som är fristående från denna proposition. Till följd av ett förslag från Trafikverket och skogsindustrin angående lastning av trävaror skisserades det vid den fortsatta beredningen upp ett förslag om att under vissa förutsättningar befria förvaringen och lastningen av trävara på förbindelsevägar och regionala vägar från tillståndskravet i 42 §.  
I yttrandena togs också andra enskilda frågor upp. För att nämna ett exempel understöddes tanken att överföra ansvaret för att underhålla trummor vid anslutningar till enskilda vägar till den väghållare som ansvarar för landsvägarna. I bland annat yttrandet från Trafikverket önskades det att man vid den fortsatta beredningen skulle bedöma huruvida det i landsvägslagen bör föreskrivas särskilt om beredskapsskyldighet, och vid den fortsatta beredningen utarbetades ett förslag till en bestämmelse om beredskapsskyldighet. Bestämmelsen innehåller ett bemyndigande för Trafiksäkerhetsverket att övervaka fullgörandet av beredskapsskyldigheten och att utfärda närmare föreskrifter om saken. 
Vidare strävades det efter att komplettera propositionsutkastet särskilt genom skrivningar om skyldigheterna att producera information. Vid den fortsatta beredningen kompletterades utkastet, förutom när det gäller de ovannämnda helheterna, genom att bestämmelsen om klassificering av landsvägar ändrades så att beslutsfattandet om klassificering av landsvägar och om fastställande av stomnätet förtydligades. Vid den fortsatta beredningen föreslogs det också att lagen ska uppta en bestämmelse som innebär att Trafikverket med stöd av avtal kan överföra till en privat tjänsteleverantör skötseln av sådana biträdande uppgifter i terräng som hör till verket och anknyter till en tillståndsuppgift eller någon annan uppgift som verket ska sköta. Ytterligare fogades till propositionen förslag till bestämmelser om beredskap, Trafikverkets säkerhetsstyrningssystem för väghållningen och tillsyn.  
Vid den fortsatta beredningen gick man dessutom in för att i propositionen lyfta in alla lagar inom kommunikationsministeriets förvaltningsområde som behöver ändras till följd av att landskapsreformen verkställs. Propositionen utökades därför med förslag till ändring av också följande lagar: banlagen (110/2007), lagen om flyttning av fordon (828/2008), luftfartslagen (864/2014), lagen om transportservice (320/2017), sjölagen (674/1994), miljöskyddslagen för sjöfarten (1672/2009), lagen om sättande i kraft av de bestämmelser som hör till området för lagstiftningen i fördraget med Ryssland om utarrendering av den del av Saima kanal som tillhör Ryssland och av det därtill hörande området till republiken Finland samt om fartygstrafiken genom Saima kanal och om tillämpning av fördraget (104/2011), lagen om tjänster inom elektronisk kommunikation (917/2014), lagen om säkerhetsutredning av olyckor och vissa andra händelser (525/2011), sjötrafiklagen (463/1996) och lagen om transport av farliga ämnen (719/1994). Yttranden om ändringarna av dessa lagar kunde lämnas in våren 2017, som ett inslag i landskapslagspaketets andra skede. Efter den remissbehandlingen gjordes vissa kompletterande ändringar i banlagen, lagen om flyttning av fordon och den lag som gäller utarrendering av Saima kanal. De flesta kommentarerna under remissbehandlingen anknöt till skärgårdstrafiken (lagen om främjande av skärgårdens utveckling 494/1981). Lagförslaget om saken jämte ändringar införlivades med landskapslagspaketets andra skede, eftersom ärendet sorterar under jord- och skogsbruksministeriet även om det i lagen finns också sådant som hör till kommunikationsministeriets respektive miljöministeriets ansvarsområde. De andra kommentarer som gavs under remissbehandlingen hänförde sig till ordnandet av offentlig persontrafik, trafiksystemplaneringen, utvecklingen av regionerna samt tydliggörandet av samarbetet och uppgiftsfördelningen mellan staten, landskapen, kommunerna och samkommunerna.  
Eftersom det till propositionen hade gjorts vissa tillägg som är viktiga till sitt innehåll och eftersom den laghelhet som ändras genom denna proposition hade utökats betydligt, sändes utkastet på nytt på remiss. Yttranden kunde lämnas in mellan den 21 februari och den 9 mars 2018. Omkring 80 yttranden kom in. Remissinstanserna ställde sig i huvudsak positiva till propositionen och understödde ändringarna. 
I yttrandena var inställningen till den riksomfattande trafiksystemplaneringen mycket positiv. När det gällde trafiksystemplaneringen på landskapsnivå betonade flera av yttrandena kommunernas och städernas roll i trafiksystemplaneringen och viljan att delta och bli hörd samt förde fram önskemål om ett förtydligande av den styreffekt som landskapets trafiksystemplan har. Dessutom framhölls förhållandet mellan trafiksystemplaneringen och markanvändningsplaneringen, MBT-avtalen och planen för de offentliga finanserna. Vid den fortsatta beredningen har det gjorts försök att tydiggöra regleringen om trafiksystemplanering. I synnerhet har man preciserat dels förhållandet mellan den riksomfattande trafiksystemplaneringen och annan nationell planering, dels växelverkan mellan landskapens och stadsregionernas trafiksystemplaner. I lagförslaget har det skrivits in ytterligare möjligheter för kommunerna att påverka utarbetandet av landskapens väg- och utredningsplan samt plan för väghållning och trafik.  
Frågan om huruvida finansieringen och resurserna kommer att räcka till togs upp i flera yttranden. Den parlamentariska arbetsgruppens rekommendationer beträffande den riksomfattande trafiksystemplanen och höjning av finansieringsnivån ansågs vara nödvändiga. I en del yttranden av landskapsförbunden ansågs det att den statliga särskilda finansieringen och den statliga styrningen av väghållningen eventuellt kommer att leda till att landskapens beslutanderätt blir bara nominell. I vissa yttranden ansågs det vara önskvärt att använda allmän finansiering till väghållning, att andra parter deltar i kostnaderna och att särskild finansiering används exempelvis till trafiksystemplanering. Vid den fortsatta beredningen har man strävat efter att beakta yttrandena genom att precisera i synnerhet regleringen om allmänna krav för väghållning, servicenivån och nivån på underhållet. En del yttranden handlade om sådant som det föreslås bli föreskrivet om i regeringens proposition med förslag till lagstiftning om inrättande av landskap och om en reform av ordnandet av social- och hälsovården. Också motiveringarna har såvitt möjligt kompletterats, bland annat när det gäller konsekvensbedömningen. 
I nästan alla yttranden förhöll man sig positiv till fastställandet av de allmänna kraven för väghållning, servicenivån, nivån på underhållet och stomnätet. Motstridiga uppfattningar framfördes dock när det gällde sättet att fastställa stomnätet. I vissa yttranden önskades det att stomnätet skulle bestå av det prioriterade allra centralaste nätet. I andra yttranden önskades det däremot att stomnätet skulle sträcka sig till varje landskap och förena viktiga aktörer såsom hamnar, flygplatser och gränsövergångsställen. Oro för vad som kan komma att hända med skicket hos det vägnät som inte ryms in i stomnätet fördes fram i många yttranden. Mer tekniska specifikationer av de olika nivåerna önskades också. Vidare togs stadstrafiken och den tvärgående trafiken upp, särskilt vad beträffar banorna samt gång- och cykelvägarna. Vid den fortsatta beredningen har definitionerna av de allmänna kraven för stomnätet och andra landsvägar, servicenivån och nivån på underhållet preciserats. I en förordning om stomnätet som håller på att beredas kommer det att föreskrivas närmare vilka lands- och järnvägar som hör till stomnätet. Genom förordning är det också möjligt att utfärda närmare bestämmelser om de tekniska specifikationer som ska gälla för olika nivåer. Motiveringarna har preciserats också för banlagens vidkommande. 
Remissinstanserna var ytterst positivt inställda till den föreslagna modellen för ordnande av väghållningen och till regleringen om tillsyn och ett säkerhetsledningssystem. I yttrandena ansågs det emellertid att det ännu återstår att precisera ansvarsfördelningen mellan olika aktörer och att bedöma resursernas tillräcklighet. I en del yttranden kommenterades dessutom tidpunkten för personöverföringar och överföringen från kommunerna till landskapen av den uppgift som gäller växelverkan och kungörelse. Vid den fortsatta beredningen har roll- och ansvarsfördelningen mellan aktörerna preciserats i den mån det varit möjligt. Propositionen har preciserats särskilt genom att det i motiveringen har angetts tydligare vilka uppgifter som är landskapens och som ska utföras på väghållningsområdet enligt överenskommelse och vilka uppgifter som är Trafikverkets. 
I yttrandena steg också andra enskilda frågor fram. Motsatta uppfattningar om tanken på avgifter för att använda landsvägarna fördes fram. Dessutom undrades det över ansvaret i eventuella olyckssituationer där nivån på väghållningen inte motsvarar de lagstadgade kraven. Likaså togs i vissa yttranden upp bland annat regleringen om kostnaderna och ansvaret för flyttning av ledningar och kablar som placerats på ett landsvägsområde, regleringen om att lastning av trävara inte längre ska vara tillståndspliktig och regleringen om uppgifter i terräng. Vid den fortsatta beredningen har man gått in för att i denna proposition inte föreslå några ändringar som hänför sig till avgiftsfriheten. Vid den fortsatta beredningen har man försökt precisera det resonemang kring eventuella ansvarsfrågor som ingår i motiveringen. Beredningen i fråga om placering av ledningar och andra konstruktioner, anläggningar och anordningar fortgår som en helhet som är fristående från denna proposition. Motiveringarna i fråga om virkeslastning och uppgifter i terräng preciseras. 
I yttrandena kommenterades i mycket begränsad utsträckning de trafikuppgifter som anknyter till landskapsreformen och överföringen av dem till landskapen. Orsaken är antagligen att dessa lagförslag ingick i landskapslagspaketets andra skede och att ändringar gjordes redan efter den remissbehandlingen. Vid det fortsatta arbetet med denna proposition har de ändringsförslag som gällde lagförslagens innehåll beaktats; särskilt har lagen om flyttning av fordon kompletterats. 
När propositionen färdigställdes utökades den med vissa bifogade lagar för att hänvisningar till landsvägslagen som finns någon annanstans i lagstiftningen ska ändras till hänvisningar till lagen om trafiksystem och landsvägar. 
6
Samband med andra propositioner
Propositionen hänför sig till den proposition med förslag till lagstiftning om inrättande av landskap och om en reform av ordnandet av social- och hälsovården samt till lämnande av underrättelse enligt artikel 12 och 13 i Europeiska stadgan om lokal självstyrelse (RP 15/2017 rd) som överlämnades till riksdagen den 2 mars 2017. Genom propositionen genomförs överföringar av uppgifter och personal enligt 6 § 1 mom. 14 och 15 punkten och 2 mom. 1 punkten i landskapslagen från staten till landskapen. 
Propositionen hänför sig delvis också till propositionen om komplettering av regeringens proposition (RP 15/2017 rd) med förslag till lagstiftning om inrättande av landskap och om en reform av ordnandet av social- och hälsovården samt till lämnande av underrättelse enligt artikel 12 och 13 i Europeiska stadgan om lokal självstyrelse i fråga om de bestämmelser som gäller finansieringen av landskapen och vissa andra bestämmelser (RP 57/2017 rd). Den nämnda propositionen, som överlämnades till riksdagen den 18 maj 2017, hänför sig till landskapens finansiering och inverkar delvis på genomförandet av denna proposition. 
Den första delen av lagen om transportservice stadfästes den 24 maj 2017. Lagen träder i huvudsak i kraft den 1 juli 2018, medan de bestämmelser som gäller främjande av nya e-tjänster redan trädde i kraft den 1 januari 2018. En proposition som handlar om den andra delen av nämnda lag överlämnades till riksdagen den 19 oktober 2017 (RP 145/2017 rd). Det är meningen att den sista delen ska beredas och överlämnas till riksdagen senast hösten 2018.  
Regeringen har överlämnat till riksdagen en proposition med förslag till lag om enskilda vägar och till vissa lagar som har samband med den (RP 147/2017 rd). Gemensamt för lagen om enskilda vägar och landsvägslagen är särskilt att det i dem föreskrivs om anslutningar och anknytande rättigheter och skyldigheter. Regeringen har överlämnat till riksdagen också en proposition med förslag till ny vägtrafiklag och till vissa lagar som hänför sig till den (RP 180/2017 rd). Bestämmelserna i vägtrafiklagen handlar om exempelvis placeringen vid vägar av anordningar som används för att reglera trafiken, vilket är av betydelse för arbetsfördelningen mellan myndigheterna i den föreslagna lagen. 
Propositionen hänför sig också till regeringens proposition med förslag till lagstiftning om verkställigheten av landskapsreformen och om omorganisering av statens tillstånds-, styrnings- och tillsynsuppgifter. Nämnda proposition (RP 14/2018 rd) överlämnades till riksdagen i mars 2018. 
Vid arbets- och näringsministeriet bereds en proposition om regionutveckling och tillväxttjänster. Tidigare har regleringen om regionutveckling haft en koppling särskilt till trafiksystemplaneringen. I den nya lag som nu bereds föreslås det emellertid inte några bestämmelser om trafiksystemplanering. Sambandet mellan trafiksystemplaneringen å ena sidan och regionutvecklingen och regleringen om den å andra sidan kommer emellertid att förbli nära. Det är meningen att propositionen ska överlämnas till riksdagen i april 2018. 
Justitieministeriet bereder ett förslag till en ny lag om rättegång i förvaltningsärenden. Avsikten är att genom den nya lagen upphäva gällande förvaltningsprocesslag (586/1996). Det är meningen att propositionen ska överlämnas till riksdagen under vårsessionen 2018. 
Justitieministeriet bereder en proposition där det föreslås att lagen om offentliga kungörelser upphävs såsom föråldrad och att en allmän bestämmelse om offentlig kungörelse tas in i förvaltningslagen. I denna proposition föreslås sådana ändringar i bestämmelserna om kungörelse i landsvägslagen, banlagen och lagen om flyttning av fordon som hänför sig till de ändringar som föreslås i nämnda proposition. Det är meningen att propositionen ska överlämnas till riksdagen senast hösten 2018. 
Propositionen hänför sig till regeringens proposition med förslag till lag om ombildning av Trafikverkets trafiklednings- och trafikstyrningstjänster till aktiebolag och till vissa lagar som har samband med den. Propositionen har beretts vid kommunikationsministeriet och det är meningen att den ska överlämnas till riksdagen i april 2018. 
Vid kommunikationsministeriet bereds en proposition om ändring av miljöskyddslagen för sjöfarten. Ändringen är teknisk och anknyter till en ändring av en konvention som antagits inom Internationella sjöfartsorganisationen (IMO). Genom propositionen ändras vissa bestämmelser i lagens 1 och 7 kap., och en ny bestämmelse fogas till 7 kap. Det är meningen att propositionen ska överlämnas till riksdagen i april 2018. 
Ändringen av landsvägslagen och dess rubrik, vilken i sin nya form lyder lagen om trafiksystem och landsvägar, gör att hänvisningar i andra lagar behöver ändras. Till den del hänvisningsändringarna inte påverkar verkställandet av landskapsreformen eller riksdagens möjlighet att bilda sig en helhetsuppfattning om reformen föreslås det att dessa ändringar införlivas med regeringspropositionen om ämbetsverksreformen inom trafik- och kommunikationsförvaltningen.  
DETALJMOTIVERING
1
Lagförslag
1.1
Lag om trafiksystem och landsvägar
Enligt förslaget ska landsvägslagens rubrik ändras till lagen om trafiksystem och landsvägar. Ändringen beror på de nya bestämmelser om trafiksystem och trafiksystemplanering som fogas till lagen. Lagen avses således inte längre bara innehålla bestämmelser om landsvägar och väghållning plus tillhörande rättigheter och skyldigheter. I stället utvidgas tillämpningsområdet för bestämmelserna om trafiksystem till att gälla alla trafikformer och färdsätt. 
1 kap.Allmänna bestämmelser 
1 §. Lagens syfte. Paragrafen innehåller bestämmelser om lagens syfte. Tillägg av ett nytt 1 mom. föreslås. Det avses innehålla bestämmelser om lagens syfte i fråga om trafiksystemet och trafiksystemplaneringen. 
Nuvarande 1 mom. blir då 2 mom. och till momentet fogas syftet att säkerställa enhetligheten i fråga om landsvägsnätet och servicenivån i hela landet. Avsikten är att därmed understryka det nödvändiga i att sörja för ett enhetligt landsvägsnät och att den servicenivå som anges i lag uppnås på olika håll i landet, trots att det i fortsättningen är landskapen som ska stå för väghållningen. Dessutom kompletteras 2 mom. med preciseringen att landsvägarna är statsägda. 
2 §. Tillämpningsområde. Paragrafen innehåller bestämmelser om lagens tillämpningsområde. Den föreslås få ett nytt 1 mom., som gäller trafiksystemet. Enligt momentet föreskriver lagen om trafiksystemplaneringen på riks- och landskapsnivå. Lagen ska omfatta alla trafikformer och färdsätt. Regelverket om trafiksystemet samt trafiksystemplaneringen i landskapen och på riksnivå anknyter till den övriga planeringen i landskapen och till den riksomfattande planeringen, planeringen av markanvändningen och regionutvecklingen. Det är ändamålsenligt att reglera arbetsfördelningen mellan staten och landskapen inom trafiksystemplaneringen genom lag. Staten företräds som väghållare av Trafikverket. Det lämpar sig väl att de berörda bestämmelserna finns i anknytning till bestämmelserna om landsvägar, där det i fortsättningen också kommer att finnas bestämmelser om relationen mellan stat och landskap i fråga om vägtrafik. 
Nuvarande 1 mom. föreslås bli 2 mom. och dessutom kompletteras momentet med ett omnämnande av landsvägarnas servicenivå, som regleras närmare i nya 13 a §. För det andra föreslås att momentet kompletteras med ett omnämnande av arbetsfördelningen i samband med organiseringen av väghållningen, varmed avses arbetsfördelningen mellan väghållaren och landskapen i fråga om väghållningen. Momentet kompletteras ytterligare med ett omnämnande av avtal, styrning och andra arrangemang med koppling till hur väghållningen ordnas. Bestämmelser om detta förslås bland annat i det nya 1 b kap. som föreslås i denna proposition. Dessutom ska momentet ändras så att lagen också innehåller bestämmelser om de rättigheter och skyldigheter som staten, landskapen och andra myndigheter har, dvs. inte bara om väghållarens rättigheter och skyldigheter. 
I lagen föreslås inte bestämmelser om trafiksystemplanering i kommuner och städer. Däremot kan de föreslagna målen och verksamhetsmodellerna utnyttjas också vid trafiksystemplanering i stadsregioner. 
3 §. Definitioner. Den gällande paragrafen gäller utvecklande och underhåll av landsvägsnätet. Det nuvarande innehållet ska enligt förslaget överföras till 13 §, medan denna paragraf ska innehålla behövliga definitioner. 
I 1 punkten definieras trafiksystemet, som för det första omfattar alla trafikformer, dvs. vägtrafiken, järnvägstrafiken, sjötrafiken och flygtrafiken. Trafiksystemplaneringen ingår i trafikformerna och omfattar cykling, gång, skärgårdstrafik, kollektivtrafik och internationella förbindelser. Trafiksystemet består av person- och godstrafik och av de trafiknät som används till sådan trafik och av trafikinformation, trafikservice och trafikmedel samt av de system som styr trafiken. Trafiken betjänas av trafiknäten, dvs. trafikinfrastrukturen, som omfattar trafikleder såsom vägar, järnvägar och farleder och även trafikens knutpunkter såsom terminaler, hamnar och flygplatser. Trafiknäten inbegriper också gränsövergångsställena, de internationella havsområdena och luftrummet plus andra leder och knutpunkter som betjänar de internationella förbindelserna. Definitionen av begreppet trafiksystem omfattar också kommunikation som betjänar trafiken och som nu och i framtiden i allt större utsträckning integreras med trafiksystemet som en helhet och exempelvis med kommunikationsbaserade tjänster.  
Information spelar en allt större roll inom trafiksystemet och dess utveckling. Allt oftare är information ett råmaterial och en förutsättning för trafiktjänsterna. Till trafikinformationen räknas bland annat passageraruppgifter, nät- och trafikinformation, information om väderlek och väglag samt register över olika trafikformer och kommunikationsmedel. 
Med sådana tjänster som omfattas av definitionen avses tjänster enligt lagen om transportservice (320/2017). Till trafiktjänsterna räknas tjänsterna inom kollektivtrafiken och annan persontrafik samt godstransporttjänsterna. Lagen om transportservice möjliggör dessutom utveckling av helt nya former av transportservice samt nya trafikkoncept och servicemodeller. Trafiktjänsterna kan vara offentliga, på marknadsvillkor baserade eller privata tjänster eller kombinationer av tjänster i anslutning till trafik som tillhandahålls företag och offentliga aktörer eller för privat bruk. 
Systemen som styr trafiken innefattar exempelvis lednings- och tågkontrollsystem och system för luftrumsplanering. 
Med väghållning avses planering, byggande och underhåll av landsvägar, trafikledning samt produktion och uppdatering av information i anslutning till dessa uppgifter. I den gällande lagen definieras väghållning i 9 §. På landsvägarna produceras trafikförvaltningens trafikledningstjänster i dagens läge av Trafikverkets vägtrafikcentraler, vars verksamhet är åtskild från den övriga väghållningen. Regeringens finanspolitiska ministerutskott beslutade den 13 juni 2017 att Trafikverkets trafikledningsfunktioner ska bolagiseras. Utkast till regeringens proposition till riksdagen med förslag till lag om ombildning av Trafikverkets trafiklednings- och trafikstyrningstjänster till aktiebolag och till vissa lagar som har samband med den. Utkastet är på remiss till den 7 februari 2017. De trafikledningsfunktioner inom väg-, sjö- och järnvägstrafiken som Trafikverket har hand om i dag blir statliga aktiebolag den 1 januari 2019. I fortsättningen ska de trafikstyrningstjänster som behövs för väghållningen köpas från det trafikstyrningsbolag som ska bildas, och nivån bestäms i ett avtal mellan Trafikverket och bolaget. I avtalet ska beaktas de nedan föreskrivna kraven i fråga om landsvägarna och deras servicenivå. Trafikverket ska se till att behoven på landskapsnivå och de regionala behoven beaktas i detta avtal. 
I den föreslagna lagen ska byggande avse anläggande av ny väg och förbättring av väg. Med förbättring avses då åtgärder som är av mer än ringa betydelse. 
Underhåll definieras som skötsel och reparation av väg. Skötsel ska då avse åtgärder som säkerställer att vägen och dess konstruktion fungerar dagligen och förebygger uppkomsten av förtida skador på vägen eller konstruktionen. Genom reparation återställs skadade vägar och konstruktioner för att motsvara dagens behov. 
Väghållare enligt den föreslagna lagen är Trafikverket. Staten ska fortsätta att vara ägare till landsvägarna och landsvägsnätet ska fortsättningsvis förvaltas av Trafikverket. 
En ny term som införs i lagen är väghållningsområde, som avser ett samarbetsområde som bildas av de landskap som är parter i ett samarbetsavtal som avses i 15 f § i denna lag. Samarbetsområdet ska svara för de väghållningsuppgifter som landskapen har i uppgift att organisera. I 8 kap. i landskapslagen finns det bestämmelser om formerna för landskapens offentligrättsliga samarbete: gemensamt organ, gemensam tjänst och avtal om skötseln av en myndighetsuppgift. Samarbetsområdet ska bildas utifrån ett avtal mellan landskapen genom någon av de former för samarbete som landskapslagen medger. 
Med väghållningsavtal avses ett avtal mellan väghållaren, dvs. Trafikverket och landskapen om ordnande av väghållningen. Närmare bestämmelser om väghållningsavtal finns i 15 m §. Väghållningsavtalet ska i fortsättningen vara ett centralt instrument i förhållande till Trafikverket som svarar för landsvägarna i dess helhet och landskapen som sköter väghållning områdesvis samt till exempel med avseende på finansieringen av väghållningen. 
4 §. Landsvägar. Paragrafen innehåller en allmän definition av landsvägar och bestämmelser om klassificering av landsvägar i riksvägar och stamvägar samt i regionala vägar och förbindelsevägar. I paragrafen föreskrivs dessutom hur det bestäms vad det nationellt viktiga stomnätet omfattar. Eftersom det är meningen att staten inte längre ensam ska svara för väghållningen av landsvägarna föreslås det att definitionen av landsväg i 1 mom. ändras så att en landsväg ska vara en av staten ägd eller med vägrätt förvaltad väg som har överlåtits för allmänt bruk och är i Trafikverkets besittning. Landsvägarna ska redovisas i Trafikverkets balansräkning. Eftersom alla landsvägar inte är statsägda utan är föremål för vägrätt ska i bestämmelsen också nämnas att de är i Trafikverkets besittning. Trots att staten också i fortsättningen i egenskap av väghållare ska ansvara för landsvägarna går det på grund av landskapsreformen inte längre att i definitionen säga att staten ska upprätthålla landsvägarna. Utgångspunkten, som inte föreslås bli ändrad, är att landsvägarna ska ha upplåtits för allmän trafik. En förutsättning för deras existens är ett administrativt beslut. I fråga om byggande av en landsväg innebär detta att en vägplan har godkänts, att vägen byggs och dessutom ett administrativt beslut om att vägen upplåts för allmän trafik. Dessutom ska en vägplan utarbetas för att en enskild väg eller gata ska bli en landsväg. Ett område som fastställts som vägområde övergår enligt 57 § i väghållarens ägo då inlösningsbeslutet vinner laga kraft. Enligt 93 § i markanvändnings- och bygglagen övergår äganderätten till landsvägen dessutom utan ersättning till kommunen, då en detaljplan träder i kraft för området efter övertagandet av landsvägen. I det sammanhanget inrättas vägrätt för väghållaren. I sådana situationer som avses i 58 § grundas för väghållaren i ställen för äganderätt dessutom vägrätt för vägområdet, så som föreskrivs i vägplanen.  
I paragrafens 2 mom. beskrivs riksvägarnas, stamvägarnas och de regionala vägarnas servicefunktion. De övriga landsvägarna är förbindelsevägar. Det föreslås att kommunikationsministeriet ska bemyndigas att genom förordning utfärda närmare bestämmelser om klassificeringen av riksvägar, stamvägar, regionala vägar och förbindelsevägar. Denna bestämmelse ska ersätta gällande 3 mom. enligt vilket kommunikationsministeriet bestämmer vilka vägar som är riksvägar och vilka som är stamvägar samt till vilken del de är nationellt viktiga stomvägar. Trafikverket bestämmer vilka landsvägar som är regionala vägar och vilka som är förbindelsevägar.  
Paragrafens gällande 3 mom. ska enligt förslaget ersättas med en beskrivning av det nationellt viktiga stamvägnätets servicesyfte. De landsvägar som hör till stomnätet sammanbinder de nationellt och internationellt största centren och knutpunkterna och betjänar framför allt den långväga trafiken. Med de nationella centrumen avses i synnerhet landskapscentra. Ett annat centrum av riksomfattande betydelse kunde av särskilda skäl också vara någon annan plats som är viktig för tillgängligheten. Med knutpunkter avses framför allt hamnar, flygstationer, gränsstationer och järnvägsstationer. Stomnätet ska betjäna också den internationella trafiken vilket innebär att sådan centra också har en internationell betydelse. Med långväga trafik avses resor och transporter som är över 100 kilometer långa. I momentet föreskrivs dessutom att kommunikationsministeriet ska bemyndigas att genom förordning bestämma till vilken del riks- och stamvägarna hör till det nationellt viktiga stomnätet. Stomnätet ska av särskilda skäl även kunna omfatta andra landsvägar som är viktiga för trafiken. Ordalydelsen i paragrafens gällande 3 mom. motsvarar inte kraven i den gällande grundlagen och det har rått oklarhet om huruvida kommunikationsministeriet och Trafikverket har varit behöriga att utfärda normbeslut eller förvaltningsbeslut. Den nuvarande klassificeringen av landsvägarna i riksvägar och stamvägar är baserad på trafikministeriets beslut av den 2 december 1992 om riksvägar och av den 21 juni 1993 om stamvägar. Klassificeringen motsvarar inte längre i alla avseenden den nuvarande verksamhetsmiljön och den bör således revideras. En översyn av klassificeringen kan göras i anslutning till den riksomfattande trafiksystemplaneringen. 
Beslut som motsvarar de tidigare klassificeringsbesluten kan emellertid i princip utfärdas endast som förvaltningsinterna föreskrifter om det egna förvaltningsområdet. Med anledning av den nuvarande grundlagen rekommenderas det också att man förhåller sig restriktivt till att utfärda sådana föreskrifter om de har mera omfattande konsekvenser. Materiella rättsbestämmelser ska numera alltid tas in i en lag eller förordning. Eftersom definitionen av begreppet stomnät har en betydelse som sträcker sig till och som också uttryckligen avser att påverka bland annat näringslivets konkurrenskraft och områdesanvändning, är det i likhet med den övriga klassificeringen av landsvägarna sålunda skäl att utfärda materiella rättsliga bestämmelser om saken i stället för administrativa föreskrifter. 
Utöver den klassificering som anges i landsvägslagen gäller för landsvägarna också den klassificering som ingår i den så kallade TEN-T-förordningen (Europaparlamentets och rådets förordning (EU) nr 1315/2013 av den 11 december 2013 om unionens riktlinjer för utbyggnad av det transeuropeiska transportnätet och om upphävande av beslut nr 661/2010/EU), vilket innebär att vissa landsvägar också ingår i stomnätet enligt bilaga I till förordningen. Åtminstone de vägar som hör till TEN-stomnätet ska också höra till stomnätet som definieras med stöd av 3 mom., eftersom stomnätets servicesyfte innefattar också beaktandet av internationella förbindelser. I förordningen om bestämmande av stomnäten ska också i andra avseenden beaktas TEN-T-förordningen och de krav som ställs på vägar som hör till TEN-nätet.  
Det föreslås att den första meningen i 4 mom. förtydligas så att där används uttrycket ” annan väg avsedd för trafik av en viss art”. Uttrycket stämmer överens med bestämmelserna om landsvägsregister i nya 108 a § och i 2 § i den gällande landsvägsförordningen (924/2005). I momentet stryks den sista meningen, eftersom uttrycket ”i tillämpliga delar” enligt de senaste anvisningarna om författningsberedning inte bör användas. Denna lag är tillämplig på vintervägar också utan en särskild bestämmelse. 
6 §. Landsvägsfärjor. Det föreslås att 1 mom. kompletteras med en bestämmelse om att på frigående färjor ska tillämpas vad som föreskrivs om ro-ro-passagerarfartyg. Ro-ro-passagerarfartyg definieras i 2 § i lagen om fartygs tekniska säkerhet och säker drift av fartyg (1686/2009) som ett fartyg som medför fler än tolv passagerare och som har ro-ro-lastutrymmen eller utrymmen av särskild kategori enligt definitionen i regel II-2/A/2 i bilaga I till non-SOLAS-direktivet (Europaparlamentets och rådets direktiv 2009/45/EG om säkerhetsbestämmelser och säkerhetsnormer för passagerarfartyg). Frigående färjor är ro-ro-passagerarfartyg. Ändringen innebär en precisering av vad som avses med frigående färjor och vilka bestämmelser som ska tillämpas på sådana färjor. Bestämmelserna ligger då bättre i linje med nuläget och tillägget medför inga ytterligare krav för befintliga fartyg i fråga om konstruktion eller utrustning. 
I 2 mom. föreslås det att den andra meningen utgår. Den behövs inte längre. På frigående färjor som är ro-ro-passagerarfartyg tillämpas visserligen fortfarande sjölagen (674/1994), men på frigående färjor ställs inte längre tekniska krav med stöd av sjölagen. På sådana färjor ställs numera tekniska krav enligt lagen om fartygs tekniska säkerhet och säker drift av fartyg och Trafiksäkerhetsverkets med stöd av den utfärdade föreskrifter samt lagen om fartygspersonal och säkerhetsorganisation för fartyg (1687/2009) och statsrådets med stöd av den utfärdade förordning om fartygs bemanning och fartygspersonalens behörighet (166/2013). 
Vidare föreslås det att det bemyndigande slopas som Trafiksäkerhetsverket har enligt 2 mom. att utfärda närmare föreskrifter om förarens behörighet och det intyg som krävs av förare av vajerfärja. Avsikten är att aktörerna (serviceproducenterna inom färjetrafiken) ska ges mer ansvar. Vajerfärjornas driftsäkerhet och sjösäkerhet blir inte lidande av att normgivningsbemyndigandet slopas. Beviljande av intyg som förare av vajerfärjor ska ha hör inte till Trafiksäkerhetsverkets kärnuppgifter, och åren 2015 och 2016 beviljades 28 sådana intyg per år utifrån tentamen. När bemyndigandet utgår behöver momentet ange de grundläggande kraven på de berörda förarna. Dessutom föreslås tillägg av serviceproducentens ansvar. Hittills har den som velat ha intyg för förare av vajerfärja avlagt tentamen antingen på svenska eller på finska, och då har det gått att samtidigt kontrollera att den sökande har tillräckliga språkkunskaper. När nu intygen enligt förslaget ska frångås behövs det bestämmelser om att föraren ska ha tillräckliga språkkunskaper för att kunna ge anvisningar till passagerarna i nödsituationer. Som tillräckliga språkkunskaper anses tillräckliga kunskaper i svenska eller finska. Det är viktigt att den som för vajerfärjan kan kommunicera med passagerarna på ett begripligt sätt i nödsituationer framför allt eftersom det kan finnas ett relativt stort antal passagerare ombord. 
Vidare föreslås det att det andra normgivningsbemyndigande som Trafiksäkerhetsverket har enligt 2 mom. preciseras genom tillägg av att myndigheten får meddela närmare föreskrifter också om vajerfärjors utrustning. I dagens läge gäller enligt 4 § 2 mom. i förordningen om landsvägsfärjor att bestämmelser om vajerfärjors utrustning finns i Trafiksäkerhetsverkets besiktningsföreskrifter. Bemyndigandet bör finnas i lag och förordningen bör ändras. Dessutom motsvarar det som sägs i förordningen inte nuläget eftersom det inte finns bestämmelser om vajerfärjors utrustning i Trafiksäkerhetsverkets besiktningsföreskrifter. Ordet väghållningsmyndighet ska enligt förslaget ändras till väghållare i 2 mom. 
I 3 mom. ändras ordet väghållningsmyndighet till väghållare. Dessutom föreslås det att andra meningen kompletteras med att väghållaren kan besluta att en färja ska gå enligt tidtabell dels av orsaker som har samband med trafiken, dels också på motiverad ansökan av ett landskap, en kommun eller någon annan myndighet eller aktör. I 4 mom. föreslås inga ändringar. 
8 §. Serviceområden som hör till landsväg. Det föreslås att paragrafens rubrik ändras till serviceområden som hör till en landsväg. Avsikten är att understryka att paragrafen inte gäller alla kommersiella tjänster som erbjuds landsvägsanvändare och till landsvägarna hörande områden utan endast sådana till vägområdet hörande områden som har inlösts i väghållarens ägo och användningen av dem. I 1 och 2 mom. ändras ordet väghållningsmyndighet till väghållare. Det föreslås att de uppgifter som enligt paragrafens 2 mom. hör till väghållaren preciseras så att till momentet fogas kravet att väghållaren ska producera information.  
9 §. Väghållning. Enligt förslaget ska hela paragrafen upphävas och dess definition av väghållning och byggande av landsväg ingå i 3 § så som anges ovan. 
10 §. Väghållare och kostnaderna för väghållningen. Paragrafen innehåller bestämmelser om väghållare och kostnaderna för väghållning. För klarhets skull föreslås det att definitionen av väghållare i 1 mom. ändras så att det är Trafikverket i stället för staten som är väghållare. Trafikverket är den myndighet som ansvarar för statens trafikleder. En sådan lösning ligger i linje med banlagen, där det sägs att Trafikverket är banhållare. Staten ska även i fortsättningen stå för kostnaderna för väghållningen. I 2 och 3 mom. föreslås inga ändringar. Trafikverket i egenskap av väghållare och landskapen inom väghållningsområdet kan enligt förslaget avtala om hur de företräds vid de avtalsförhandlingar som avses i paragrafens 2 och 3 mom. för att komma överens om ändamålsenliga arrangemang. 
11 §. Myndigheter som svarar för väghållningen. Den gällande paragrafen innehåller bestämmelser om väghållningsmyndigheten. Det är meningen att väghållningsuppgifterna och de anknytande myndighetsuppgifterna i fortsättningen ska vara uppdelade mellan Trafikverket och landskapen, och därför föreslås paragrafen få bestämmelser om de myndigheter som svarar för väghållningen och om principerna för arbetsfördelningen mellan Trafikverket och landskapen. Eftersom det i denna paragraf uttryckligen är fråga om myndigheter som svarar för väghållningen ska benämningen Trafikverket användas om väghållaren i stället för det ovan definierade begreppet väghållaren. 
Trafikverket ska enligt 1 mom. i fortsättningen svara för de uppgifter som staten har i egenskap av ägare av landsvägsnätet och de riksomfattande uppgifterna inom väghållningen. Med riksomfattande uppgifter avses de väghållningsuppgifter som Trafikverket sköter i dagens läge och de uppgifter som nu i huvudsak är koncentrerade till en NTM-central och som har riksomfattande betydelse. Också vissa av de tillståndsuppgifter inom väghållningen som i dag sköts av nio NTM-centraler föreslås bli överförda till väghållaren. Uppgifter som anknyter till förvaltningens av statens egendom i form av trafikleder är exempelvis uppgifter som gäller markförvärv och förvaltningen av landsvägs- och banfastigheter. De uppgifter som överförs till väghållaren, dvs. Trafikverket, anges närmare i den allmänna motiveringens avsnitt 3.3 De viktigaste förslagen (s. 24 ).  
Till Trafikverkets uppgifter hör i fortsättningen dessutom att styra landskapen vid skötsel av uppgifterna inom väghållningen samt att med landskapen inom väghållningsområdet avtala om ordnande av väghållningen. Närmare bestämmelser om avtalsförfarandet ingår i 1 b kap. Trafikverket kan enligt förslaget styra landskapen dels genom avtalsförfarandet i fråga om väghållningen och dels också genom så kallad informationsstyrning. Sådan styrning är inte juridiskt bindande, men den kan stödja landskapen när de fullgör sina uppgifter och främja utveckling och användning av enhetlig praxis. Med informationsstyrning avses bland annat jämförelse- och analysuppgifter, rekommendationer, anvisningar och handböcker av rekommendationskaraktär, meddelanden, nätverkssamarbete och kontakter, verksamhets- och servicemodeller, bästa praxis, strategier och utvecklingsprogram, organisering av utbildning, förhandlingsdagar och andra sammankomster samt forsknings- och utvecklingsprojekt. 
Enligt paragrafens 2 mom. svarar landskapen inom sina verksamhetsområden för skötseln av högst nio väghållningsområdens uppgifter inom väghållningen i enlighet med avtalet om väghållningen och under Trafikverkets styrning. Trafikverket svarar dock för genomförandet av viktiga vägprojekt, inklusive byggplanering, byggande och upphandling. Som viktiga vägprojekt kan betraktas till exempel i statsbudgeten uttryckligen nämnda riks- och stamvägar samt livliga regionala vägar och projekt som berör stomnätet. Till denna del hör också projekt som kräver mångsidigt specialkunnande samt alla projekt som har landskapsöverskridande betydelse eller konsekvenser. Det är ändamålsenligt att Trafikverket ansvarar för genomförandet av sådana projekt, eftersom de kan vara förenade med särskilda behov i fråga om dimensioneringen, effektivt utnyttjande eller specialkompetens. Också i samband med sådana projekt där flera parter deltar på grundval av avtal eller där det är fråga om långvariga avtalsarrangemang, såsom exempelvis takprojekt vid tunnelbygge, kan det vara ändamålsenligt att Trafikverket har hand om planeringen. Landskapen och Trafikverket ska tillsammans i samband med att avtalet om väghållning utarbetas besluta när det rör sig om särskilda skäl och när Trafikverket ska sköta planeringen. 
Varje landskap svarar självt för beslutsfattandet när det gäller den plan för väghållning och trafik som gäller det egna verksamhetsområdet. Respektive landskap beslutar om godkännandet av samarbetsavtal som mellan de landskap som hör till ett väghållningsområde ingås om viktiga riktlinjer för organiseringen av verksamheten inom väghållningsområdena. 
Det gällande 2 mom. avses bli 3 mom. med oförändrat innehåll.  
13 §.Allmänna krav för väghållning. I denna paragraf sammanställs bestämmelserna om byggande av landsväg i gällande 13 § samt bestämmelserna om utvecklande och underhåll av landsvägsnätet i gällande 3 §. Dessutom föreslås att till paragrafen fogas vissa nya krav och att Trafiksäkerhetsverket bemyndigas att utfärda närmare föreskrifter för att säkerställa kraven. 
Samtidigt ändras paragrafens rubrik så att den bättre motsvarar bestämmelsens nya innehåll och görs vissa kompletteringar i fråga om kraven. Med väghållning avses i enlighet med 3 § 2 punkten planering, byggande, underhåll och trafikförvaltning av landsvägar samt produktion och upprätthållande av informationen i anknytning till dessa uppgifter. 
I paragrafens 1 mom. sammanställs de bestämmelser som gäller främjandet av de centrala målsättningarna i fråga om utveckling och underhåll av landsvägsnätet och som styr också investeringarna i landsvägar. Målet är att förtydliga de syften som ska främjas i fråga om väghållningen samt att understryka vikten av att de beaktas vid tillämpningen av denna lag. Som ett nytt krav nämns i momentets 1 punkt främjandet av målen för den riksomfattande trafiksystemplanen. I lagförslagets 1 a kap. föreskrivs om den riksomfattande trafiksystemplanen. Också för närvarande förutsätts till exempel i 3 § 1 mom. att trafiksystemet ska ses som en helhet. I fortsättningen ska den helhet som trafiksystemet utgör behandlas i den nämnda riksomfattande planen och därför ska bestämmelser om beaktande av trafiksystemet som en helhet avse främjandet av trafiksystemplanen på riksnivå. 
Enligt momentets 2 punkt gäller liksom i dagens läge att man ska främja uppnåendet av de riksomfattande målen för områdesanvändningen, utvecklandet av områdena i allmänhet och uppnåendet av de mål som ställts för samhällsstrukturen och miljön vid planeringen av markanvändningen. De riksomfattande målen för områdesanvändningen ingår i systemet för planering av områdesanvändningen enligt markanvändnings- och bygglagen, och deras syfte är att se till att ärenden av nationell betydelse beaktas i landskapens och kommunernas planläggning och i de statliga myndigheternas verksamhet. I fråga om de riksomfattande målen för områdesanvändningen beaktas också försvarets och försörjningsberedskapens behov, som ska beaktas också i samband med väghållningen. Till områdesutvecklingen hör bland annat regionutvecklingsbeslutet och de mål som ställs upp i det. Bestämmelser om regionutvecklingsbeslutet kommer att finnas i lagen om regionutveckling och tillväxttjänster, som ingår i en proposition som arbets- och näringsministeriet bereder. Dessutom är det skäl att utveckla landsvägsnätet och enskilda landsvägar så att förutsättningarna för den planerade utvecklingen av områdes- och samhällsstrukturen kvarstår, om man ser till miljömålen och den ekonomiska effektiviteten. Bestämmelsen om kravet att en ekonomisk områdes- och samhällsstruktur ska beaktas innebär att landsvägsnätet och enskilda landsvägar ska planeras och byggas på ett sådant sätt att förutsättningarna för den planerade utvecklingen av områdes- och samhällsstrukturen kvarstår, om man ser till den samhällsekonomiska effektiviteten.  
I momentets 3 punkt nämns skyldigheten att främja minskningen av trafikutsläppen. För utvecklingen av landsvägsnätet är exempelvis åtgärder som möjliggör och främjar utvecklingen av infrastrukturen för distribution av nya bränslen och laddningsstationsnätet för elbilar beaktansvärda faktorer som också har betydelse för minskningen av utsläppen. Landsvägsnätet bidrar för sin del till att tillgodose trafikbehov som är en följd av olika funktioner. Landsvägsnätets omfattning och egenskaper samt den tillgänglighet som det för med sig inverkar på funktionernas placering och sålunda också på trafikefterfrågan och trafikprestationen. 
Enligt det nya kravet i 4 punkten ska i samband med väghållningen främjas möjligheterna att utnyttja information och digitaliseringen samt automatiseringen av trafiken och förutsättningarna för utvecklandet av trafiktjänsterna. Information är en grundläggande förutsättning för utnyttjande av de möjligheter som digitaliseringen ger. Informationen utgör råmaterial för nya digitala tjänster. Heltäckande information och de förbindelser som behövs för informationsöverföring och byggandet av förbindelserna är en central förutsättning för utvecklingen av digitala trafiktjänster och även för annan digitalisering och automatisering. Automatiken ökar snabbt inom vägtrafiken och det måste skapas beredskap för detta också när landsvägarna utvecklas. De krav som självkörande fordon ställer på vägkvaliteten är relativt höga. Det behövs exempelvis körfältsmarkeringar av hög kvalitet och en exakt digital infrastruktur. Snabba och funktionssäkra dataförbindelser intar en central ställning när det gäller att förmedla information om trafiken, vägarna och de anknytande tjänsterna. I praktiken kan främjandet av möjligheterna att utnyttja informationen och digitaliseringen samt automatiseringen av trafiken vid planering, byggande och underhåll av landsvägar inverka till exempel på definitionen av vägområdets omfattning samt på behovet att placera utrustning och anordningar av olika slag på vägområdet. Utöver tjänster som är baserade på information och digitalisering är också till exempel behovet av rastplatser för yrkestrafiken en viktig tjänst när det gäller utvecklingen av landsvägarna och väghållningen.  
I 2 mom. sammanställs de centrala kraven i fråga om väghållningen. Kraven gäller de för väghållningen ansvariga aktörernas verksamhet i fråga om alla funktioner inom väghållningen. De krav som ställs i momentet är förpliktande men de ska tolkas med beaktande av den landsvägs trafikmässiga betydelse som det är fråga om i det enskilda fallet. Med en landsvägs betydelse för trafiken avses karaktären av den trafik som använder landsvägen, dvs. resornas och transporternas längd, riktning och ändamål. Också trafikvolymen har en viktig inverkan på en landsvägs trafikmässiga betydelse. Som olika syften när det gäller resor och transporter kan nämnas bland annat godstrafik, kollektiv persontrafik, personbilstrafik och cykeltrafik. Resornas och transporternas riktning påverkas till exempel av hur olika funktioner och tjänster är placerade i nationella och regionala centra eller på andra orter samt placeringen av trafikknutpunkter som exempelvis hamnar. 
Till momentets 1 punkt överförs det för närvarande i 3 § 2 mom. ingående grundläggande kravet att landsvägarna ska erbjuda möjlighet till trygg och fungerande trafik och transporter i hela landet till skäliga kostnader och med beaktande av olika trafikformer, olika befolkningsgruppers trafikbehov och olika näringsgrenars transportbehov. Omnämnandet av nya färdsätt innebär tydligare fokusering på olika trafikformer, dvs. också på fotgängartrafikens, cykeltrafikens och kollektivtrafikens behov. Framför allt genom val av färdsätt och genom att påverka valet är det möjligt att minska trafikens miljöolägenheter. Exempelvis genom placeringen av hållplatser på landsvägarna, genom utrustning av hållplatserna och genom infartsparkeringsplatser är det möjligt att med utnyttjande av hållbara färdsätt främja uppkomsten av goda mobilitetstjänster samt att förmå människor att börja använda kollektivtrafik och cykla kortare sträckor. 
Till momentets 2 punkt överförs bestämmelsen i gällande 3 § 2 mom. andra meningen om att de olägenheter som landsvägsnätet och trafiken orsakar miljön ska bli så små som möjligt och naturresurserna användas sparsamt.  
Till 3 punkten överförs enligt förslaget det i gällande 13 § 2 mom. om byggande ingående kravet att väghållningen inte ska orsaka större skada eller olägenhet än nödvändigt. Av bestämmelsen framgår också principen om minimering av olägenheterna i förhållande till behovet (allmänt behov), dvs. den avvägning som i samband med vägprojekt ska göras mellan skadliga konsekvenser och samhällsekonomisk effektivitet. 
I 4 punkten föreskrivs det att landsvägarna med avseende på trafiken och tekniskt sett ska vara så fungerade och säkra som möjligt och att syftet med dem uppnås på ett så förmånligt sätt som möjligt. Motsvarande bestämmelse ingår i gällande 13 § 2 mom.  
Enligt 5 punkten ska informationen om landsvägarna uppdateras och vara tillgänglig. Med information avses i denna punkt bland annat farledsinformation, information om utrustning och anordningar samt information om underhåll av vägnätet och styrning av trafiken. Informationen ska vara tillgänglig för alla via öppna gränssnitt, om något annat inte anses vara motiverat. 
Enligt 6 punkten ska landsvägarna och den digitala infrastrukturen i anknytning till dem vara kompatibla med den övriga trafiken och dess digitala infrastruktur. Med digital infrastruktur i anslutning till landsvägarna avses exempelvis kommunikationsnät i anslutning till landsvägarna samt informationssystem för behandling av landsvägsrelaterade data. Digital infrastruktur i anslutning till landsvägarna kan bland annat möjliggöra förmedling av trafikstyrningsinformation till fordon eller digitala trafikstyrningsanordningars funktion. Med kompatibilitet avses till exempel att landsvägsanvändare sömlöst ska kunna färdas på landsvägarna och vid behov använda det övriga trafiknätet. Kompatibiliteten kan säkerställas exempelvis genom föreskrifter om landsvägarnas utrustning och trafiktekniska lösningar, vilka med stöd av 4 mom. kunde utfärdas av Trafiksäkerhetsverket. Närmare föreskrifter som gäller kompatibiliteten kan utfärdas till exempel om (den digitala eller fysiska) infrastrukturen i anslutning till automatisering.  
Till paragrafens 3 mom. överförs gällande 13 § 1 mom. samt sista meningen i 13 § 2 mom. där det föreskrivs om förutsättningarna för förbättring av landsväg och byggande av ny landsväg. Sådana planer med rättsverkningar som ska beaktas vid byggande av landsväg är, i enlighet med markanvändnings- och bygglagen, landskapsplan, generalplan med rättsverkningar och detaljplan. Med förbättring avses då åtgärder som inte har endast ringa betydelse.  
I paragrafens 4 mom. föreskrivs att Trafiksäkerhetsverket får utfärda sådana föreskrifter om väghållningen som gäller vägkonstruktion, utrustning, trafiktekniska lösningar och användningen av landsvägar samt om begräsningar. Syftet är att genom föreskrifterna säkerställa trafiksäkerheten, hanteringen av trafikledsegendom och väghållningens kostnadseffektivitet och att minska miljöolägenheterna på ett riksomfattande enhetligt sätt. Med vägkonstruktion och trafiktekniska lösningar avses exempelvis anslutningar och de tillhörande tekniska lösningarna. Trafiksäkerheten och hanteringen av miljöskador sköts också framför allt genom lösningar som gäller vägkonstruktion och genom tekniska lösningar. Syftet med bemyndigandet att utfärda föreskrifter om användning av landsvägar och om begränsningar i samband därmed är att Trafiksäkerhetsverket, då det behövs för att säkerställa de krav som avses i 2 mom., ska kunna utfärda föreskrifter exempelvis om hastighetsnivån på ett vägavsnitt samt om automatisk trafik på vissa filer eller vägavsnitt. Sådana föreskrifter ska enligt förslaget kunna utfärdas också så att de gäller endast en del av landsvägsnätet. 
13 a §.Servicenivån på resor och transporter på landsvägar. I nya 13 a § föreskrivs om servicenivån när det gäller resor och transporter på landsvägar. Syftet med att definiera servicenivån är att främja fungerande resor och transporter för medborgarna och näringslivet, samt att främja trafiksäkerheten och en jämlik servicenivå i landets olika delar. Avsikten är att kunderna, dvs. medborgarna och näringslivet, och regionerna ska kunna förvänta sig att servicenivån uppfyller vissa kriterier beroende på en hurdan del av nätet det gäller. Det är också viktigt att kunderna och regionerna på förhand vet vilken nivå på servicen de kan vänta sig på en viss del av vägnätet i framtiden. 
Syftet med paragrafen är att säkerställa att servicenivån på landsvägarna i fråga om sin trafikmässiga betydelse på likartade delar av vägnätet är enhetlig och likvärdig i hela landet samt förenlig med de rådande kundbehoven, då den granskas framför allt utifrån kostnadseffektiviteten från användarnas och trafikens samt transporternas synpunkt. Definitionen av servicenivån baseras på landsvägens betydelse från trafiksynpunkt och den kommer till användning i samband med all planering och verksamhet i anslutning till vägnätet. Den servicenivå som avses i paragrafen har betydelse framför allt när det gäller behoven att utveckla och förbättra landsvägarna och genom den preciseras å andra sidan de allmänna kraven enligt 13 § när det gäller utvecklandet, byggande och underhåll av landsvägarna. Målet är att eftersträva en servicenivå som stödjer företagens och regionernas konkurrenskraft, främjar vardagsfunktionerna och trafiksystemets samhällsekonomiska effektivitet. Den finansieringsnivå som står till buds har betydelse för uppnåendet av servicenivån. Också riktlinjerna i den riksomfattande trafiksystemplaneringen har betydelse för en exaktare definition av servicenivån, liksom även kommunikationsministeriets förordning som utfärdas med stöd av det bemyndigande som föreslås i paragrafens sista mening.  
Enligt 1 mom. ska väghållaren se till att servicenivån är tillräcklig med hänsyn till de krav som avses i 13 § 1 mom. och till den betydelse som varje landsväg har för trafiken. De krav som nämns ovan i 13 § 1 mom. kan på olika typer av landsvägar i praktiken betyda olika åtgärder. Målet är bland annat att säkerställa att trafikmiljön i framtiden stödjer digitaliseringen och automatiseringen av trafiken samt utvecklingen av nya tjänster. Exempelvis digitaliseringen och möjligheterna att utnyttja information samt möjliggörandet av trafikens automatisering i olika delar av nätet kommer emellertid åtminstone under de närmaste åren att vara av varierande nivå. Också åtgärderna för tryggande av trafiksäkerheten varierar i fråga om olika vägtyper samt beroende på trafikmängderna. Dessutom kan till exempel transportrutterna för farliga ämnen ha betydelse för en vägs trafikmässiga betydelse på ett sätt som måste beaktas i fråga om upprätthållandet av servicenivån. 
Som centrala faktorer när det gäller servicenivån och faktorer som ska beaktas för upprätthållandet av servicenivån nämns i 1 mom. restiden, restidens förutsebarhet, säkerheten och kostnadseffektiviteten. Med kostnadseffektiviteten som en servicenivåfaktor, när det gäller resor och transporter, avses trafikens och transporternas kostnadseffektivitet i relation exempelvis till möjligheten att utnyttja landsvägsnätet med fordon som är kostnadseffektiva från aktörens synpunkt och att välja kostnadseffektiva rutter. Servicenivåfaktorer som inverkar på restiden är hastighetsbegränsningar och dessas enhetlighet samt å andra sidan anslutningar och andra faktorer som avbryter och förlänger resan. Exempelvis olika typer av anslutningar har också olika inverkan på restiderna och sålunda på servicenivån när det gäller landsvägarna. Anslutningar och andra avbrott eller restidsförlängande faktorer inverkar å andra sidan också på kostnadseffektiviteten, trafiksäkerheten och miljökonsekvenserna då fordon, i synnerhet tunga transportfordon, måste göra inbromsningar och accelerationer. Förteckningen över servicenivåfaktorer är inte uttömmande. Som faktorer kan beaktas också andra omständigheter som har en central betydelse för landsvägsanvändarna och olika trafikmiljöer och som kan preciseras t.ex. i den förordning som ska utfärdas i enlighet med 5 mom.  
I 2 mom. föreslås det bestämmelser om servicenivån på nationellt viktiga stomvägar. Sådana vägar ska sammanbinda de nationella och internationellt sett största centrumen och betjäna i synnerhet riksomfattande långdistanstrafik. Stomnätets förbindelser spelar en viktig roll för den internationella trafikens transportkedjor. Nationellt viktiga stomvägar ska hålla en hög servicenivå för långdistanstrafiken. På grund av stomnätens trafikmässiga betydelse och de kundbehov som hänför sig till dem måste servicenivån vara högre än på det övriga landsvägsnätet. Det innebär en jämn färdhastighet och att det är lätt att förutse restiderna. I praktiken betyder det en kontinuerlig hastighetsbegränsning på i huvudsak minst 80 km/h, goda omkörningsmöjligheter med jämna mellanrum och anslutningar där trafiken flyter smidigt i vägens huvudriktning. Stomnätet ska stödja en säker trafik och det ska vara en säker arbetsmiljö för yrkesförare och för dem vars näring innefattar långdistanstransporter. Väghållaren ska genom stomnätet sörja för att den information i realtid som ges om trafiken och trafikförhållandena är heltäckande och aktuell. 
Stomnätets aktuella trafikinformation ska stödja förutsebarheten i fråga om restiderna samt utvecklandet av nya tjänster. I synnerhet uppgifter om störningar och vägarbeten är sådan trafikinformation som är viktig för restidens förutsebarhet. För att säkerställa tillgången på information i realtid och uppdaterad information om störningar förutsätts det samarbete med väghållaren på regionnivå. Med information om förhållandena avses till exempel information om genomförda underhållsåtgärder samt om väglaget och väderleksförhållandena på en väg. För att man ska kunna ställa höga och jämna hastigheter som mål måste man fästa särskild uppmärksamhet vid underhållet av vägnätet, exempelvis spårdjup och en hög daglig skötselnivå, för att målen för servicenivå ska kunna nås. Vägytornas och broarnas skick inom stomnätet ska motsvara det mål som ställts upp för ett säkert trafiksystem. Nedan i 33 § föreskrivs närmare om nivån på underhållet. Dessutom ska stomnätet möjliggöra tillräckliga rast- och viloplatser för den tunga trafiken. Det är skäl att inom stomnätet beakta rutter för fordonskombinationer av typen High Capacity Transport (HCT) och andra specialfordon.  
Enligt det föreslagna 3 mom. ska de huvudvägar som inte hör till stomnätet ha en sådan servicenivå på resor och transporter som är anpassad till trafikmängden, trafikmiljön och lokala behov för att de ska kunna användas till den regionala trafik som är typisk för den delen av vägnätet, men också till långdistanstrafik. Vägarnas trafikmässiga betydelse och trafikmängden på denna del av landsvägsnätet varierar, vilket bör beaktas i den närmare definitionen av servicenivån. Servicenivån kan således variera, men i dagens läge och i framtiden är det emellertid viktigt att se till att dessa riks- och stamvägar förmedlar långdistanstrafik på ett smidigt och säkert sätt. Riks- och stamvägarna förenar landskapscentra och viktiga regioncentra. Hastighetsbegränsningarna kan variera i en något större utsträckning än de lokala behov som gäller i fråga om stomnätet. Anslutningstätheten kan vara större än inom stomnätet och vid valet av anslutningstyper är det möjligt att använda flera alternativ. I synnerhet när det gäller livligt trafikerade riks- och stamvägar är det skäl att så heltäckande om möjligt säkerställa tillgången till uppdaterad trafik- och förhållandeinformation. När det gäller nätets kvalitetsnivå ska man i fråga om nivån på underhållet beakta de regionala trafikbehoven på den delen av nätet.  
Enligt det föreslagna 4 mom. ska de regionala vägarna och förbindelsevägarna ha en servicenivå som motsvarar de regionala behoven och vägens betydelse för trafiken. Landskapen har en central roll när det gäller att i samarbete med kommunerna identifiera av de lokala behoven samt koordinera av dem med väghållningen, med beaktande av också av gränssnitten för landsvägs- och gatunätet. När det gäller anslutningstyperna och hastighetsbegränsningarna är det möjligt att göra friare val som baseras på de lokala behoven än när det är fråga om det övriga vägnätet. Den trafikmässiga betydelsen av region- och förbindelsevägarna enligt den nuvarande klassificeringen och trafikmängderna varierar avsevärt, i synnerhet i fråga om regionvägarna. När det gäller nivån på underhållet av dessa landsvägar och säkerställandet av trafiksäkerheten ska enligt förslaget beaktas de trafikmässiga skillnaderna mellan olika vägar.  
Enligt paragrafens 5 mom. kan genom förordning av kommunikationsministeriet utfärdas närmare bestämmelser om servicenivån på resor och transporter på landsvägar. Genom förordning kan utfärdas mera detaljerade bestämmelser om hur servicenivån på resor oh transporter som enligt denna paragraf förutsätts på olika delar av landsvägsnätet kan uppnås och hur olika servicenivåfaktorer ska beaktas. Beroende på lösningarna i förordningen där stomnätet definieras kan stomnätets servicenivå preciseras också genom att stomnätet internt indelas i två eller flera stomnätsklasser så att någon del av stomnätet, på basis av vägarnas trafikmässiga betydelse, förutsätts hålla en nivå som överstiger minimikraven. I samtliga fall måste man emellertid hålla sig inom de gränser som lagens krav på servicenivå tillåter. Detta skulle vara möjligt också i fråga om servicenivån på andra vägar. 
1 a kap Trafiksystemplanering 
15 a §.Trafiksystemplaneringoch målen för den. I denna paragraf föreslås bestämmelser om trafiksystemplanering och målen för den. I dagens läge görs trafiksystemplaneringen på riksnivå, på landskapsnivå samt i stadsregioner och kommuner. Sådan planering på flera nivåer har gjorts i flera tiotal år trots att det inte tidigare föreskrivs i lag om saken. Trafiksystemplaneringen är en kontinuerlig och samarbetsbaserad process för övergripande granskning av trafiksystemets tillstånd och utvecklingsbehov i fråga om samtliga trafikformer. Trafiksystemplaneringen är en långsiktig och strategisk form av planering.  
I paragrafen föreskrivs att trafiksystemplaneringen ska göras i samarbete mellan olika myndigheter och andra aktörer. Med myndigheter avses statens, landskapens och kommunernas myndigheter. Det är särskilt viktigt med ett omfattande samarbete om man vill få trafiksystemet att fungera bättre och effektivisera planeringen.  
Syftet med trafiksystemplaneringen är att främja trafikens och transporternas funktion och säkerhet samt utvecklingen av ett ekologiskt, socialt och ekonomiskt hållbart trafiksystem. Vid planeringen är det skäl att beakta bland annat växelverkan mellan trafiken, markanvändningen, servicestrukturerna och näringsverksamheten samt de nuvarande och framtida transportbehov som följer av olika funktioner, olika människogruppers transportbehov och behovet av fungerande resekedjor, näringslivets behov av transporter och behovet av fungerande transportkedjor, trafiksäkerheten konsekvenser av trafiksystemet och dess utveckling samt trafiksystemets utvecklings- och finansieringsbehov. Med mobilitetstjänster avses såväl offentliga, marknadsbaserade och på delningsekonomi baserade tjänster samt sådana privata tjänster som gynnar och stödjer mobilitet och transporter. I samband med trafiksystemplaneringen görs en omfattande granskning av hur trafiksystemet och dess utveckling påverkar bland annat den regionala utvecklingen, olika invånares och företags resor och transporter och hur de fungerar, trafiksäkerheten samt olika typer av andra samhällspolitiska mål. Som ett resultat av trafiksystemplaneringen kan man bilda sig en uppfattning om trafiksystemets underhålls- och utvecklingsbehov samt vilka finansieringsbehov inom den offentliga förvaltningen som åtgärderna föranleder.  
Med de transportbehov som olika funktioner skapar avses bland annat trafikmängder och trafikformer. Inom planeringen ska dessutom beaktas olika gruppers transportbehov och färdsättsalternativ med beaktande av diskrimineringslagen. Med detta avses bland annat tillgänglighetsfrågor. Med olika former av godstransporter avses bland annat transportalternativen för näringslivet. En miljövänlig och energieffektiv trafik ska främjas genom en långsiktig och sektorsövergripande utveckling av trafiksystemet baserad på förebyggande åtgärdsmodeller som betonar ansvarstagande. I samband med trafiksystemplaneringen ska också beaktas de internationella och riksomfattande miljömålen, exempelvis minskning av utsläppen och en hållbar utveckling. Trafiksystemets energieffektivitet påverkas av trafikprestationen och av möjligheten att använda alternativa färdsätt. Med andra miljöolägenheter avses bland annat buller, utsläpp i luft och vatten, trafikens utrymmesbehov samt konsekvenserna för trivseln i livsmiljön. 
Trafiksystemets funktion och säkerhet påverkar bland annat rese- och transportkedjorna, restidernas förutsebarhet, resornas och transporternas kostnader samt resekomforten. I ett fungerande trafiksystem är förbindelserna ändamålsenligt ordnande och förbindelsesträckorna genomtänkta helheter där trafikvolymen och resenärernas behov beaktas. Trafiksäkerheten främjas genom en ansvarsfull, förebyggande och riskanalysbaserad utveckling av trafiksystemet.  
De nya mobilitetstjänster som uppkommer i och med att digitaliseringen och automatiseringen utvecklas och ökar bör tas i beaktande och kunna utnyttjas vid trafiksystemplaneringen. Det framtida trafiksystemet ska bygga på ett nytt funktionssätt där användarorienterade trafik- och transporttjänster som är baserade på utnyttjande av digitaliseringsinformation friktionsfritt fungerar tillsammans. I fråga om trafiktjänster är det skäl att i samband med trafiksystemarbetet beakta olika tjänsteleverantörer som tillhandahåller tjänster som utgör delar av hela resekedjor. Det systemet kommer således att utgöra en helhet där tjänster, information och infrastruktur är kompatibla.  
Kravet på växelverkan mellan trafiken och andra samhälleligt betydelsefulla helheter, exempelvis markanvändning, boende, tjänster och näringsverksamhet, säkerställs genom att trafiksystemplaneringen sammankopplas med den helhet som utgörs av den riksomfattande, regionala och lokala planeringen. På detta sätt ser man till att de olika helheterna stödjer varandra och att behoven inom de andra helheterna beaktas inom trafiksystemplaneringen samt att det görs insatser för att främja dem. Trafiksystemplaneringen bör vara fast förankrad i planeringen av områdesanvändningen. Genom områdesanvändningen och placeringen av olika funktioner påverkas trafikefterfrågan och avgörs frågor som gäller förutsättningarna för utnyttjande av olika mobilitets- och transportformer. Utvecklandet av trafiksystemet skapar å andra sidan möjligheter för olika lösningar när det gäller områdesanvändningen. Lösningarna i fråga om områdesanvändningen och trafiksystemet som en helhet har en avgörande betydelse för samhällenas effektivitet i energihänseende och ekonomiskt.  
Vid trafiksystemplaneringen är det skäl att beakta samtliga trafikformer och -nät, exempelvis väg-, vatten- och banleder samt flygstations- och hamnnätet. Det är särskilt viktigt att sörja för kompatibiliteten mellan olika trafikformer och datakommunikation, med beaktande av medborgarnas och näringslivets behov. Med mobilitetstjänster avses å andra sidan befintliga respektive nya tjänster som i framtiden utvecklas med hjälp av digitalisering och automatisering. Vid trafiksystemplaneringen är det viktigt att beakta privata och marknadsbaserade mobilitetstjänster samt trafik- och transporttjänster trots att de i och för sig är föga lämpade att planeras i samband med trafiksystemplaneringen. Privata och marknadsbaserade tjänster kan emellertid ha betydelse till exempel för farledsinvesteringar samt för tidsplanering och optimal dimensionering av åtgärder som avser kollektivtrafiktjänster. Utvecklings- och finansieringsbehoven när det gäller tjänsterna ska vid trafiksystemplaneringen ses mot bakgrund av tjänster som anskaffas med offentliga medel. Planeringen ska också innefatta konsekvensanalyser till behövliga delar och dessutom ska finansieringsbehoven för åtgärderna bedömas. Planeringen omfattar vidare eventuella förstudier, utredningar om förbindelsesträckor och andra särskilda utredningar som läggs till grund för trafiksystemplanen.  
Trafiksystemplaneringen omfattar planer, målsättningar och krav i fråga om utveckling, underhåll och trafiktjänster.  
15 b §.Den riksomfattande trafiksystemplanen. Genom den föreslagna lagen föreskrivs om trafiksystemplaneringen på två nivåer, dvs. på riksnivå och på landskapsnivå. Trafiksystemplaneringen ska emellertid inte göras hierarkiskt på olika planeringsnivåer, liksom planeringen av markanvändningen, utan den ska snarare baseras på växelverkan mellan olika nivåer och på kontinuerligt samarbete mellan aktörerna.  
Paragrafen avses innehålla bestämmelser om den riksomfattande trafiksystemplanen och dess innehåll. Kommunikationsministeriet ska ansvara för beredningen av den riksomfattande långsiktiga trafiksystemplanen i samarbete med olika aktörer. Statsrådet beslutar om godkännande av den riksomfattande trafiksystemplanen. Avsikten är att en bred bas för beredningen av planen ska säkerställas genom att föreskriva om saken i förslaget till 15 d §. Dessutom föreslås 15 e § ett bemyndigande enligt vilket närmare bestämmelser om utarbetandet av planen kan utfärdas genom förordning av statsrådet. Om det dessutom anses behövligt att höra riksdagen, är statsrådet i det enskilda fallet behörigt att till exempel besluta ge en redogörelse. I grundlagens 44 och 45 § samt i 23 och 24 i riksdagens arbetsordning föreskrivs om behandling av meddelanden, upplysningar och redogörelser i riksdagen.  
Den riksomfattande trafiksystemplanen ska styra statens och landskapens förfaranden och förhandlingar, och den kommer att påverka fastställandet av servicenivån och planeringen i landskapen. Avsikten är att planen ska bidra till att uppfylla lagens syfte och till dess verkställighet. I planen ska ingå en bedömning av nuläget i fråga om trafiksystemet och av den framtida verksamhetsmiljön, målen för utveckling av trafiksystemet och förslag till åtgärder för uppnående av målen. I planen ska i enlighet med målen enligt 15 § beaktas nuvarande och kommande trafikbehov, utnyttjandet av information och digitalisering, förutsättningarna för utvecklandet av trafik- och transporttjänsterna samt trafikens säkerhet, miljökonsekvenser och energieffektivitet. Bedömningar, mål och åtgärdsförslag ska också kunna göras i fråga om exempelvis mobilitetsstyrning. 
I planen ska också tas in trafiksystemets åtgärds- och finansieringsprogram för 10–12 år. Planen ska gälla de offentliga aktörernas, dvs. statens, landskapens och kommunernas åtgärder samt finansieringen av det statliga trafiksystemet. Programmet ska vid behov ses över i samband med det övriga trafikpolitiska strategi- och planeringsarbetet samt när det sker förändringar i situationen. I samband med justeringarna ska det säkerställas att planen samordnas med planen för den offentliga ekonomin. För klarhetens skull föreslås dessutom en uttrycklig bestämmelse enligt vilken den riksomfattande trafiksystemplanen i början av varje regeringsperiod ska justeras och samordnas med planen för den offentliga ekonomin. Vid förändringar i planen ska den justeras också vid andra tidpunkter. Planen för den offentliga ekonomin utgör en finansieringsram för det program som avses i 3 mom., skapar en verklighetsgrund för genomförandetidtabellen och periodiserar statens årliga finansiering av åtgärderna. Planen har sålunda en central betydelse för genomförandet av programmet och trafiksystemplanen. 
Planen ska innehålla mål och krav som gäller utveckling, underhåll och tjänster. I samband med beredningen av den riksomfattande trafiksystemplanen är det i fortsättningen också möjligt att bereda uppdateringar av förordningen om det nationellt viktiga stomnätet. I trafiksystemplanen kan tas in riktlinjer om trafiknätets och -tjänsternas servicenivå.  
I trafiksystemplanen ska beaktas också konsekvenserna av olika trafiklösningar samt jämföras åtgärdernas genomslag. I lagen om bedömning av miljökonsekvenserna av myndigheters planer och program (200/2005) föreskrivs om myndigheternas skyldighet att utreda miljökonsekvenserna av en plan eller ett program. I den riksomfattande trafiksystemplanen ska på grund av dess betydelse och omfattade konsekvenser ingå en sådan miljökonsekvensbedömning som avses i den lagen. När planen bereds ska de krav som följer av Europeiska unionens lagstiftning och andra internationella förpliktelser beaktas. Det gäller exempelvis TEN-T-förordningen och ITS-direktivet (Europaparlamentets och rådets direktiv 2010/40/EU av den 7 juli 2010 om ett ramverk för införande av intelligenta transportsystem på vägtransportområdet och för gränssnitt mot andra transportslag). 
Kommunikationsministeriet ska enligt förslaget säkerställa samordningen av den riksomfattande trafiksystemplanen med de övriga riksomfattande planerna. Riksomfattande planer tas numera fram inom olika förvaltningsområden bland annat genom de riksomfattande målen för områdesanvändningen (RMO), som det föreskrivs om i markanvändnings- och bygglagen (132/1999), regionutvecklingsbeslut, som det kommer att finnas bestämmelser om i lagen om regionutveckling och tillväxttjänster (regeringens proposition till riksdagen med förslag till lag om regionutveckling och tillväxttjänster) och den klimatpolitiska planen på medellång sikt (Kaisu), som det föreskrivs om i klimatlagen (609/2015). Den riksomfattande trafiksystemplanen ska enligt förslaget samordnas med de ovan nämnda planerna för att säkerställa lösningar som är ändamålsenliga från helhetssynpunkt. Planen för den offentliga ekonomin har så som beskrivs ovan en speciell betydelse för genomförandet av planen, jämfört med de övriga riksomfattande planerna. 
Såsom ovan konstateras föreskrivs i lagen inte om trafiksystemplaneringen i stadsregioner. I Helsingforsregionen är det Samkommunen Helsingforsregionens trafik som gör trafiksystemplaneringen så som föreskrivs i lagen om samarbete inom avfallshanteringen och kollektivtrafiken mellan kommunerna i huvudstadsregionen (829/2009). 
Den riksomfattande trafiksystemplaneringen ska i stället emellertid vid behov göras tillsammans med trafiksystemplaneringen i kommunerna och stadsregionerna, för att garantera rese- och transportkedjornas servicenivå. I fråga om den riksomfattande trafiksystemplanen skulle detta betyda till exempel att planeringen av åtgärder som påverkar servicenivån när det gäller nationellt viktiga väg- eller banprojekt eller kollektivtrafik ska ske i samråd med stadsregionerna, i synnerhet då åtgärderna har en betydande inverkan på planeringen av en stadsregions markanvändning, bostadsproduktion eller servicenät. Det kan i samband med den riksomfattande trafiksystemplaneringen också vara motiverat att granska statens målsättningar när det gäller utvecklingen av trafiksystemen i stora stadsregioner, eftersom dessa systems funktion är av riksomfattande betydelse.  
Den riksomfattande trafiksystemplanen är till sin karaktär en strategisk plan som gäller principerna för utveckling av trafiksystemet samt de riksomfattande målsättningarna och de åtgärder som behövs för att uppnå dem. Planen styr övriga myndigheter och aktörer inom förvaltningsområdet så att de i sin verksamhet beaktar de målsättningar och åtgärdsförslag som framgår av planen, trots att planen inte har några rättsliga verkningar.  
Med tanke på genomförandet av planen är det viktigt att i den ta in ett förslag till uppföljning av planen. 
15 c §.Landskapets trafiksystemplan. Paragrafen avses innehålla bestämmelser om landskapens trafiksystemplaner och deras innehåll. Varje landskap ska i syfte att uppnå målen i den riksomfattande trafiksystemplanen och främja genomförandet av åtgärderna i den utarbeta en trafiksystemplan för sitt verksamhetsområde. Landskapets trafiksystemplan får även innehålla andra mål som behövs på grund av landskapets förhållanden och som beror på landskapets särdrag samt arbeta för att främja och utveckla trafikens och trafiksystemets effektivitet, trygghet och ekologiska hållbarhet. Planen kan också innehålla mål och åtgärder för mobilitetsstyrning som gäller främjande av gång-, cykel- och kollektivtrafik. I enlighet med 6 § 1 mom. 15 punkten i landskapslagen ska landskapen också sköta uppgifter i samband med statsunderstöd för mobilitetsstyrning, och därmed faller det sig naturligt att också ta upp mobilitetsstyrningen i landskapets trafiksystemplan. Vidare hör trafiksäkerheten till landskapen enligt 6 § 1 mom. 14 punkten i samma lag, och då kan det vara ändamålsenligt att också behandla den i planen. Ett allt mer framträdande delområde inom helheten trafiksystemets funktion är i fortsättningen användning och främjande av intelligenta transportlösningar och automatisering, och därför bör landskapen ta upp mål och åtgärder i fråga om detta i sina trafiksystemplaner. I trafiksystemplanerna på landskapsnivå ska göras en omfattande bedömning av nya verksamhets- och beslutsmodeller för utvecklings av trafiksystemet. Faktorer som påverkar landskapets förhållanden kan vara bland annat geografin, trafikmängderna, näringsverksamheten och -strukturen, avstånden, trafikformerna, befolkningsstrukturen och andra faktorer på landskapsnivå. Varje landskap ska närmare definiera sina särdrag i själva landskapsstrategin.  
Landskapens trafiksystemplaner är fleråriga och långsiktiga, och landskapen ska bedöma deras genomförande och effekter minst en gång per fullmäktigeperiod och vid behov utarbeta en reviderad plan. Planen ska skapa målen för landskapets fyraåriga plan för väghållning och trafik, som det också föreskrivs om i den föreslagna lagen. 
Landskapen kommer i enlighet med principerna i landskapslagen att vara självstyrande aktörer. Därför kommer varje landskap att kunna bestämma om det utarbetar sin trafiksystemplan i samarbete över landskapsgränserna med ett eller flera andra landskap. Landskapet kommer också att kunna bestämma om planen ska tas fram i samband med eller som en del av någon annan strategisk plan i landskapet, exempelvis landskapsstrategin eller landskapsprogrammet. Under alla omständigheter ska landskapet bereda sin trafiksystemplan med beaktande av målen i landskapsstrategin och landskapets övriga strategiska planer samt de krav som landskapsplanen ställer. Samordningen med landskapets övriga planering innebär också planering av områdesanvändningen inom landskapet. 
Med tanke på trafiksystemets kontinuitet och funktion är det viktigt att landskapens trafiksystemplaner samordnas med trafiksystemplanerna i de landskap som gränsar till landskapets område. I landskapets trafiksystemplan ska också beaktas planeringen av kommunernas och stadsregionernas trafiksystem inom landskapets område. I fråga om trafiksystemplanen på landskapsnivå betyder samarbetet med trafiksystemplaneringen i kommunerna och stadsregionerna bland annat att stadsregionernas målsättningar och planer för utveckling av trafiken, markanvändningen, boendet och servicen ska beaktas och samordnas med planeringen på landskapsnivå. Detsamma gäller bland annat utvecklingen av kollektivtrafiktjänsterna i övrigt. Samordningen med kommunernas trafiksystemplanering är en förutsättning för trafiksystemets övergripande funktion. Städernas gatunät och trafiksystem utgör på riksnivå och landskapsnivå viktiga trafikknutpunkter som bör beaktas som en del av helheten. 
I enlighet med 11 § i lagen om regionutveckling och tillväxttjänster i den proposition i ämnet som beretts av arbets- och näringsministeriet får intentionsavtal eller andra typer av samarbetsavtal upprättas för genomförandet av målen enligt den lagen. Det är också möjligt att ingå intentionsavtal och andra avtal utifrån trafiksystemplanen. De kan ingås med staten eller andra landskap. Sedan år 2011 har i stadsregionerna Helsingfors, Åbo, Tammerfors och Uleåborg ingåtts intentionsavtal mellan kommunerna i stora stadsregioner och staten om markanvändning, boende och trafik. Denna lag begränsar eller hindrar inte att kommunerna och staten ingår intentionsavtal om ett frivilligt avtalsförfarande gällande stadsregionernas trafiksystem. 
Enligt paragrafens 4 mom. ska landskapets trafiksystemplan beaktas i de myndigheters verksamhet som är verksamma inom landskapets område. Detta betyder att till exempel landskapets kommuner i sin egen trafiksystemplanering ska uppmärksamma innehållet i och målsättningarna för landskapets trafiksystemplan. Också Trafikverket kan exempelvis i egenskap av banhållare vara en sådan på området verksam myndighet som avses här. Planen skulle inte i rättsligt hänseende påverka de på området verksamma övriga myndigheternas verksamhet eller på ett bindande sätt påverka deras beslutsfattande. 
Med tanke på genomförandet av planen är det viktigt att i den ta in ett förslag till uppföljning av planen. 
15 d §.Förfarandet för beredningen av planerna. Paragrafen innehåller bestämmelser om förfarandena för beredningen av trafiksystemplanerna. Enligt 1 mom. ska alla landskap och andra för trafiksystemet viktiga myndigheter sammankallas till ett gemensamt möte när den riksomfattande trafiksystemplanen bereds. Utlåtande om planutkastet ska begäras av de ministerier, myndigheter och andra aktörer för vars verksamhetsområde eller uppgifter planen har en väsentlig betydelse. 
Enligt 2 mom. ska landskapet bereda landskapets trafiksystemplan i växelverkan med Trafikverket, områdets kommuner och övriga myndigheter samt med de verksamhetsutövare i området för vars verksamhetsområde trafiksystemplanen kan ha väsentlig betydelse. Med verksamhetsutövare avses bland annat tjänsteproducenter och näringslivet samt hamn- och flygplatsaktörer. Vid behov kan en samarbetsgrupp inrättas för denna växelverkan. Vid beredningen av landskapets trafiksystemplan ska ministerierna och de övriga landskapen och aktörerna ges tillfälle att yttra sig om utkastet till planen. 
Trafikverket och Trafiksäkerhetsverket ska delta i trafiksystemplaneringen både på riksnivå och på landskapsnivå. Trafikverket bidrar till den riksomfattande planeringen med sin kompetens bland annat i fråga om de nationella målen, ban- och sjötrafiken och i fråga om åtgärdsuppgifter. Dessutom bär Trafikverket inom ramen för sin behörighet det riksomfattande ansvaret för att trafiksystemet fungerar och främjar säkerheten i trafiken och regionernas balanserade utveckling och hållbara utveckling.  
I 4 mom. föreskrivs det att också andra instanser ska ges tillfälle att bekanta sig med utkastet och att framföra sina åsikter om planen. Syftet är att se till att även allmänheten och andra aktörer än de ovan nämnda ges möjlighet att påverka. Med andra instanser avses bland annat, men inte enbart, tjänsteproducenter, offentliga aktörer, medborgare, näringslivet i dess roll av kund, andra myndigheter, städer, kommuner, intresse- och frivilligorganisationer, hamn- och flygplatsaktörer och andra som har intresse av att påverka utvecklingen av trafiksystemet. Möjligheten att bekanta sig med planutkastet och framföra sin åsikt om planen ska ges genom offentliggörande av en kungörelse i enlighet med den bestämmelse om offentliga kungörelser som föreslås i förvaltningslagens 26 a § och som det hänvisas till nedan i 108 §. Kungörelsen och de handlingar som den avser ska publiceras på myndighetens webbplats. Vid behov ska kungörelsen offentliggöras också i en tidning med allmän spridning inom verkningsområdet eller på något annat sätt som myndigheten bestämt. Enligt 108 § ska minst 30 dagar reserveras för att framföra åsikter. Det rör sig om en föreskriven minimitid för utlåtanden och åsikter. Någon maximitid föreskrivs inte genom lag. Information om en godkänd plan plus motivering och om hur utlåtandena och åsikterna har beaktats ska också kungöras på motsvarande sätt. 
15 e §. Bemyndigande att utfärda förordning. Paragrafen avses innehålla ett bemyndigande att utfärda förordning. Det är meningen att närmare bestämmelser om utarbetandet av trafiksystemplanerna vid behov ska få utfärdas genom förordning av statsrådet. 
1 b kap.Ordnande av väghållning 
15 f §.Väghållningsområden. Paragrafen föreslås innehålla bestämmelser om landskapens skyldighet att sköta väghållningen i samarbete inom högst nio samarbetsområden för väghållning på något av de sätt som föreskrivs i 8 kap. i landskapslagen. Det är i synnerhet till följd av behovet av särskild kompetens och de knappa personalresurserna som landskapen behöver samarbeta inom väghållningen i och med landskapsreformen. I 8 kap. i landskapslagen finns det bestämmelser om formerna för landskapens offentligrättsliga samarbete: gemensamt organ, gemensam tjänst och avtal om skötseln av en myndighetsuppgift. I denna paragraf förutsätts det att landskapen i samarbete sköter sina väghållningsuppgifter enligt denna lag. Härmed avses framför allt beredning och verkställighet i anslutning till väghållningsuppgifter. Utgångspunkten är den att respektive landskap ska fatta beslut i sådana viktiga väghållningsärenden som hör till landskapets behörighet. Till denna kategori av viktiga ärenden hör avtal om väghållningsområden som ingås med andra landskap, godkännande av den för landskapet beredda planen om väghållning och trafik samt godkännande av det väghållningsavtal som ingås med Trafikverket.  
Enligt vad som föreskrivs längre fram i lagen ska varje landskap ha behörighet när det gäller planering, underhåll och andra väghållningsuppgifter, men i enlighet med denna paragraf ska uppgifterna dock skötas i samråd med de övriga landskapen inom högst nio väghållningsområden.  
Uppgifter som inom ett väghållningsområde ska skötas av landskapen i samarbete och som kan karaktäriseras som beställaruppgifter är enligt förslaget i sin helhet:  
- Planering av väghållning och finansiering 
- Beredning av väghållnings- och trafikplaner samt väghållningsavtal 
- Projektplanering av landsvägar 
- Anskaffningar i samband med planering, underhåll och byggande av landsvägar samt uppföljning av genomförandet 
- Produktion av information om landsvägsnätet 
Uppgifter som ska skötas i samarbete inom ett väghållningsområde är exempelvis beredningsarbete i anslutning till uppgifter som avses i följande lagar och, om så avtalas i samarbetsavtalet mellan landskapen, också beslut om uppgifterna: 
- Planeringsuppgifter som avses i 3 kap., exempelvis dialog om planer, framläggande av planer och bemötanden 
- Förslag och beslut enligt 34 § om begränsat underhåll och om att hålla cykelbanor och gångbanor i skick utan halkbekämpning 
- Begränsning av trafik i enlighet med 35 § 
- Ordnande av rätt till tillfällig farväg enligt 36 § 
- Underhåll av en enskild vägs anslutning eller en lantbruksanslutnings vägtrumma enligt 38 
- Avlägsnande av anslutning enligt 40 § 
- Åtgärder enligt 43 § i samband med korsning mellan särskild vinterväg och farled 
- Uppgifter och rättigheter enligt 44 och 45 § gällande skyddsområde och frisiktsområde för landsväg 
- Rätt att i enlighet med 51 § anlägga en snöskärm och lägga upp snö utanför vägområdet 
I samarbetsavtalet ska avtalas om de uppgifter som ska skötas inom väghållningsområdet samt om landskapens behörighet och ansvarsförhållanden inom området. Oberoende av samarbetsformen ska i samarbetsavtalet dessutom åtminstone avtalas om företrädande av landskapen inom väghållningsområdet, beslutsprocesserna, resurserna och täckande av kostnaderna, uppföljningen, avtalets giltighetstid och principerna för ändring av avtalet samt om andra centrala frågor i anslutning till skötseln av väghållningsuppgifterna. I anslutning till behörighetsfördelningen och företrädandet av landskapen inom väghållningsområdet är det viktigt att avtala om landskapens lagstadgade myndighetsuppgifter när det gäller väghållningen , till exempel vilket landskap som i enlighet med 35 § ska sköta trafikbegränsningar och vilken aktör som i landskapet ska sköta uppgiften. Eftersom särskild finansiering avsätts för väghållningen och ett avtal om finansieringen ingås mellan väghållningsområdets landskap och väghållaren i ett väghållningsavtal, är det viktigt att i samarbetsavtalet avtala framför allt om personalkostnader för vilka landskapen beviljas finansiering med allmän täckning. Vidare ska i samarbetsavtalet fastställas ansvarsfördelningen när det gäller produktion och uppdatering av uppgiftsrelaterad information.  
I sådana fall då landskapen har ett gemensamt organ ska det dessutom avtalas om organets sammansättning och om de i samarbetet deltagande landskapens rätt att välja medlemmar till organet samt vilket landskap som ska vara ansvarigt landskap i enlighet med landskapslagens 48 §. I sådana fall då en gemensam tjänst inrättas ska det avtalas om vilket av de landskap som deltar i avtalet som ska ansvara för arbetsgivarförpliktelserna. Då man som samarbetsform väljer ett avtal om skötsel av myndighetsuppgifter ska det fastställas vilken eller vilka tjänsteinnehavare i landskapet som ska tilldelas uppgifterna.  
Landskapen ska avtala om samarbetet på ett sätt som garanterar att kraven enligt 2 mom. 1–3 punkten blir uppfyllda. Enligt 1 punkten ska det genom landskapens samarbetsavtal säkerställas att väghållningen sköts kostnadseffektivt, enhetligt, sakkunnigt och långsiktigt. NTM-centralerna satsat stort på att effektivisera väghållningen, och av uppgifterna för och de anställda vid centralernas ansvarsområden för trafiken har omkring hälften koncentrerats till antingen en eller flera centraler. Upphandlingen av underhåll och byggande är från ingången av 2016 koncentrerad till fyra upphandlingsområden. Områdena har medfört effektivitet och gjort verksamheten mer enhetlig. I och med landskapsreformen ritas aktörsfältet om inom väghållningen, men samtidigt måste väghållningsuppgifterna betraktas som en helhet där det inte är ändamålsenligt att kräva separat koncentration av upphandlingsuppgifterna. Finansieringen och personalresurserna kommer dock fortsatt att vara knappa inom väghållningen, och därför kommer det att krävas garantier för att landskapens samarbete leder till att uppgifterna sköts kostnadseffektivt och sakkunnigt. Landskapsreformen leder till att landskapen blir 18 till antalet samt till samarbetsområden som kan ha olika förväntningar och syn på hur väghållningen ska skötas. Det kan också finnas betydande skillnader inom samma landskap eller samarbetsområde per fullmäktigeperiod. Därför måste samarbetsavtalen garantera enhetlighet och långsiktighet i väghållningen. Långsiktigheten inbegriper också ett antagande om att samarbetsavtalen är åtminstone relativt varaktiga och att det finns tillräcklig grund för förändringar i samarbetsområdena. I 15 i § föreskrivs dessutom särskilt om ändring av samarbetsavtal som gäller väghållningsområden. Ett enhetligt landsvägsnät ska dessutom säkerställas genom Trafikverkets väghållningsavtal och dess övriga styrning. 
Enligt 2 punkten ska samarbetsavtalet säkerställa att den lagstadgade servicenivån uppnås och att kundernas behov beaktas. Den lägsta tillåtna servicenivån anges i 1 c kap. i den föreslagna lagen. Servicenivån ska fortsatt anges närmare i väghållningsavtalet mellan landskapen och staten och genom eventuella föreskrifter från Trafikverket. Samarbetsavtalet ska kunna garantera att servicenivån uppnås i enlighet med lagen. Målet hänger nära samman med väghållningsresurserna och därmed också med kravet enligt 1 punkten om att väghållningen ska skötas kostnadseffektivt. När servicenivån bestäms skapar det också förväntningar bland vägtrafikanterna i fråga om landsvägarna inom de olika kategorierna. Att beakta kundernas behov innefattar dels uppnående av den servicenivå som krävs, dels också exempelvis beaktande av förväntningarna på enhetliga landsvägar och i vissa fall möjliggörande av åtgärder som är särskilt inriktade på lokala förhållanden. 
Enligt momentets 3 punkt ska de väghållningsområden som bildas genom samarbetsavtalen vara ändamålsenliga med avseende på geografin och deras storlek och även i övrigt. De landskap som hör till ett väghållningsområde ska vara belägna invid varandra och sålunda utgöra en ändamålsenlig geografisk helhet till exempel med tanke på väghållningsentreprenader. Också områdenas storlek har betydelse för bildandet av entreprenadhelheter och likaså med tanke på kostnadseffektiviteten enligt momentets 1 punkt. På bedömningen av områdens ändamålsenlighet inverkar också till exempel pendlingsområden. 
Enligt paragrafens 3 mom. kan ett enskilt landskap bilda ett väghållningsområde på egen hand förutsatt att landskapet kan ordna skötseln av väghållningsuppgifterna på egen hand och förutsatt att väghållningsområdena sammanlagt inte är flera än nio.  
15 g §.Avtal om väghållningsområde. Enligt paragrafens 1 mom. ska samarbetsavtal om väghållningsområden ingås tills vidare. I enlighet med detaljmotiveringen till 15 f § 1 mom. är en långsiktig skötsel av väghållningen också förenad med förväntningen att väghållningsområdena åtminstone ska vara tämligen varaktiga och att avtal om väghållningsområdena därför inte ska ingås för viss tid. I momentet föreskrivs dessutom att ett avtal om ett väghållningsområde ska träda i kraft i början av kalenderåret efter att avtalet ingåtts. Då landskapsreformen träder i kraft ska ett samarbetsavtal vara i kraft och första gången kunna tillämpas den 1 januari 2020, då landskapen övertar ansvaret för de väghållningsuppgifter som enligt lagen överförs till dem. Också samarbetsavtal som eventuellt ingås senare ska alltid träda i kraft i början av kalenderåret.  
Kommunikationsministeriet ska innan uppgifterna överförs kunna försäkra sig om att ett avtal om samarbete över landskapsgränserna finns och att det uppfyller de krav på skötseln av väghållningsuppgifter som anges i 15 f § 2 mom. Dessutom måste landskapen ha tillräckligt med tid att organisera uppgifterna efter det att avtalet godkänts eller, om landskapen inte lyckas nå någon överenskommelse, efter det att statsrådets beslut och det kompletterande avtalet mellan landskapen godkänts. I paragrafens 2 mom. föreskrivs därför att landskapen ska bereda och godkänna samarbetsavtal som avses i 15 f § så att kommunikationsministeriet och väghållaren delges det godkända avtalet senast den 30 augusti året före det år då samarbetsavtalet träder i kraft. 
Enligt det föreslagna 3 mom. ska landskapen ge kommunikationsministeriet och väghållaren tillfälle att yttra sig om landskapens samarbetsavtal innan de godkänns. 
Kommunikationsministeriet ska i sitt yttrande framföra sin åsikt om huruvida den samarbetsform som landskapen valt uppfyller de krav som uppgiften ställer. Om ministeriet anser att samarbetsavtalet är bristfälligt när det gäller att uppfylla kraven ska ministeriet och de berörda landskapen förhandla om saken. Landskapen kan utifrån förhandlingarna vid behov se över avtalet innan det godkänns. 
15 h §.Ersättande av landskapens samarbetsavtal med beslut av statsrådet. Enligt paragrafen får statsrådet fatta beslut om landskapens samarbete när det gäller väghållningsuppgifter, om landskapen inte lyckas avtala om skötseln av uppgifterna på det sätt som avses i 15 f §. Statsrådets befogenhet ska avse de landskap och de uppgifter i fråga om vilka inget avtal kommit till stånd. 
Det kan bli aktuellt att statsrådet ska besluta om samarbetet dels när landskapen inte över huvud taget avtalar om hur uppgifterna ska skötas, dels också när det bedöms att det samarbete som landskapen avtalat om inte är tillräckligt för att uppfylla de krav som ställs på skötseln av uppgifterna i 15 f § 2 mom. Det är kommunikationsministeriet som gör bedömningen efter det att landskapen till ministeriet gett in det avtal de godkänt till följd av förhandlingarna enligt 15 g § 3 mom. 
Statsrådet kan enligt 2 mom. besluta att landskapens samarbete ska organiseras genom ett sådant gemensamt organ som avses i 48 § i landskapslagen. I så fall kan statsrådet samtidigt besluta vilket av de landskap som deltar i samarbetet som ska vara ett sådant ansvarigt landskap som avses i 48 § 1 mom. i landskapslagen och även om det som anges i landskapslagens 49 § 1–3 punkten i fråga om det gemensamma organet. Ett gemensamt organ som inrättas med tanke på väghållningsuppgifterna kommer att vara ett organ som är underställt det ansvariga landskapets fullmäktige och landskapsstyrelse, och organisationen under organet ska ingå i det ansvariga landskapets organisation. 
Statsrådet ska också kunna besluta om annat som är nödvändigt när det gäller att inrätta ett gemensamt organ, som det föreskrivs om i landskapslagens 49 § 1–3 punkten och som gäller ett avtal om ett frivilligt landskapsorgan. Statsrådet ska således bestämma det gemensamma organets uppgifter och besluta om de deltagande landskapens rätt att utse ledamöter i organet samt grunderna för kostnaderna för uppgifterna och fördelningen av dem. 
Dessutom kan statsrådet kunna utfärda andra bestämmelser som behövs för att sköta uppgifterna i syfte att uppfylla kraven enligt 15 f § 2 mom. 
Det är meningen att landskapen ska lyckas komma överens sinsemellan om hur samarbetet organiseras. Därför ska statsrådets beslut bara gälla tills landskapen avtalar om saken på det sätt som avses i lagen. Statsrådet ska således i sitt beslut alltid samtidigt bestämma om det förfarande genom vilket statsrådets beslut kan ersättas med ett samarbetsavtal mellan landskapen som ingås i enlighet med 15 i §. Statsrådets beslut ska emellertid vara i kraft till utgången av det kalenderår då landskapen ingår samarbetsavtal. Detta krav behövs bland annat på grund av avtalsförfarandet i fråga om väghållningen. Beaktande av ändringar som sker under ett pågående år skulle göra det oskäligt svårt att organisera väghållningen.  
Enligt 4 mom. ska statsrådets beslut beredas vid kommunikationsministeriet. Ministeriet ska då höra de landskap som beslutet gäller och även andra ministerier och myndigheter. 
Statsrådets beslut med stöd av denna paragraf kan överklagas i enlighet med 105 §. I 107 § föreskrivs om omedelbar verkställighet av beslut. 
15 i §.Ändringar som gäller väghållningsområden. I denna paragraf föreskrivs om förutsättningarna för ändringar som gäller väghållningsområden. Enligt paragrafens 1 mom. kan ett samarbetsavtal enligt 15 f § som gäller ett väghållningsområde högst en gång per fullmäktigeperiod ändras eller sägas upp för ingående av nytt avtal. Eftersom väghållningsområdena i en viss utsträckning förväntas vara varaktiga, är en förutsättning för genomförande av sådana ändringar eller uppsägningar dessutom att det skett en väsentlig förändring i verksamhetsmiljön, finansieringsnivån eller i andra förhållanden som har betydelse för väghållningsområdets verksamhet eller att det genom att avtalet ändras eller sägs upp och ett nytt avtal ingås är möjligt att underlätta genomförandet av de krav som avses i 15 f § 2 mom.  
I paragrafens 2 mom. föreskrivs att på ändringar av samarbetsavtal och på ingående av nya samarbetsavtal ska tillämpas vad som i 15 g och 15 h § föreskrivs om samarbetsavtal och om ersättande av samarbetsavtal med statsrådets beslut. I fråga om ändringar och ingående av nya avtal och dessas ikraftträdande gäller således 15 g § om förfarandet, och vid behov är det också i så fall möjligt att ersätta avtalet med statsrådets beslut.  
15 j §.Finansiering av väghållningen. Staten ska även i fortsättningen ansvara för väghållningen enligt 10 § och för dess kostnader, medan Trafikverket ska vara ansvarig myndighet. Det föreslagna 15 k § avses innehålla bestämmelser om finansieringen av de uppgifter vars organisering landskapen ansvarar för.  
Det föreslås att finansieringen specificeras för varje landskap enligt vägnätets och trafikens karaktär och andra omständigheter så att enhetligheten i landsvägsnätet och dess skick säkerställs och de krav som föreskrivs i 13 a och 33 dvs. de allmänna kraven på väghållningen, servicenivån och nivån på underhållet, uppfylls. Med vägnätets och trafikens karaktär avses till exempel vägnätets längd, trafikmängden och sammansättningen samt vägarnas och broarnas skick. Andra omständigheter kan till exempel bero på geografiska faktorer och deras inverkan på väderleksförhållandena och därmed på snöröjningsbehovet. Syftet med fördelningsmodellen är att sörja för rättvisa när det gäller hur skicket på trafikledsnätet utvecklas i olika delar av landet. Väghållaren fördelar medlen mellan de 18 landskapen och finansieringen för framtida väghållning utifrån väghållningsavtal som ingås med samarbetsområdena för väghållning. Även om landskapen ska sköta väghållningen genom gränsöverskridande samarbete inom högst nio samarbetsområden ska finansieringen fördelas kalkylmässigt mellan 18 landskap. 
I praktiken innebär fördelningen att samarbetsområdena för väghållningen får en budgetram för beredning av väghållningsupphandling. Staten ska också i fortsättningen stå för väghållningsutgifterna. Utgifterna hänförs i statsbudgeten till momentet för grundläggande farledshållning. Av statsbokslutets avkastnings-kostnadskalkyl framgår samtliga löpande kostnader. Investeringarna aktiveras i balansräkningen som en tillgångsökning (av utgifterna för grundläggande farledshållning och väghållning aktiveras cirka hälften i balansräkningen). Tillgångar som utgörs av väginvesteringar tas i sin helhet upp i statens balansräkning. Särskild finansiering som anvisas för uppdrag enligt avtal som ingåtts mellan staten och landskapen ska i balansräkningen noteras som en händelse som hör till kategorin uppdragsmedel. Väghållningsnätet ska inte tas upp i landskapsbudgetens driftsekonomidel och inte heller i investeringsdelen. I landskapets resultaträkning framgår utgifterna inte som verksamhetskostnader och betalda investeringar framgår i balansräkningen inte som en ökning av tillgångarna.  
Genom väghållningsavtalet kommer dessutom de nationella prioriteringarna för väghållningen, landskapens planer för väghållningen och trafiken samt statsbudgeten att bli beaktade. De påverkar alla finansieringen. Finansieringsfrågorna och väghållningsavtalet påverkas också av de mål som kommunikationsministeriet ställer upp för Trafikverket inom resultatstyrningsprocessen. Genom dem går det delvis att i praktiken omsätta målen inom den nationella trafikpolitiken och framför allt inom den riksomfattande trafiksystemplanen. 
Enligt 2 mom. ska väghållaren reservera en del av väghållningsanslagen i statsbudgeten för väghållaren för de riksomfattande uppgifterna inom väghållningen som överförs till Trafikverket och för olika tematiska program och akuta eller oförutsägbara reparationsbehov som landskapen omöjligen kan tillgodose inom sin budgetram. Ett tematiskt program kan till exempel vara ett trafiksäkerhetsprogram. Reparationsbehov kan uppkomma exempelvis vid översvämningar eller andra väderleksförhållanden eller till följd av andra oförutsägbara skador. Centraliserad finansiering som reserverats för Trafikverket fördelas till landskapens väghållningsområden 1–2 gånger per år efter särskilda samtal om oförutsedda behov.  
15 k §.Plan för väghållning och trafik. Paragrafen ska enligt förslaget innehålla bestämmelser om en fyraårig plan för väghållning och trafik, som alla 18 landskap ska utarbeta. Det är meningen att planen ska beredas för att gälla en fullmäktigeperiod. Planen ska utarbetas i början av fullmäktigeperioden. Den ska gälla kundbehov, vägunderhåll, dvs. skötsel av vägar och bland annat bro- och beläggningsreparationer, regionala investeringar och deras finansiering samt andra frågor som gäller landskapets väghållning. I planen ska behandlas planens beräknade konsekvenser genom en uppskattning av verkningarna av de åtgärder som ingår i den. Landskapen kan om de så önskar också inkludera annat som gäller de trafikuppgifter som landskapets trafikmyndighet ansvarar för. Till dessa uppgifter hör enligt landskapslagen uppgifter i samband med statsunderstöd för enskilda vägar och mobilitetsstyrning, trafiksystemplanering, samordning av trafiksäkerhetsarbetet och, om landskapet har åtagit sig dessa uppgifter, planering och ordnande av persontrafik och skärgårdstrafik. Planen är det viktigaste underlaget för arbetet med avtalet om väghållning. 
I fråga om väghållning kan ärendehelheter som behandlas i planen vara till exempel  
– finansiering av väghållningen 
– kundbehov och läget inom vägtrafiken på det berörda området 
– vägunderhåll (skötsel och reparationer) 
– regionala investeringar och deras planering 
– konsekvenserna av trafiken och väghållningen. 
Enligt 2 mom. ska planen för väghållning och trafik beredas inom samarbetsområdet för väghållning i enlighet med samarbetsavtalet mellan landskapen. Planen kommer emellertid att gälla ett enskilt landskap och därför ska den aktör som enligt samarbetsavtalet svarar för att planen tas fram under beredningen samarbeta med det landskap som planen gäller. Landskapen kan sinsemellan komma överens om samarbetets karaktär och samarbetssättet. Beslutanderätten när det gäller att godkänna planen har det landskap som planen gäller. 
Planen för väghållning och trafik är viktig också med tanke på de uppgifter som gäller kommunerna inom landskapets område och deras trafik samt samarbetet mellan kommunerna och landskapet, exempelvis när det gäller underhållet och styrningen av trafiken. Kommunerna ska således erbjudas möjlighet att framföra sin åsikt om planen för väghållning och trafik på så sätt att väghållningsområdet eller landskapet ger kommunerna tillfälle att yttra sig om planutkastet. NTM-centralerna har också hittills bett om kommunernas ställningstaganden till motsvarande planer. 
Det är styrningen från väghållarens sida och i synnerhet varje landskaps landskapsprogram och landskapsstrategi och landskapets trafiksystemplan som ger utgångspunkterna för beredningen av planen. Planen för väghållning och trafik ska vara ett genomförandedokument som kompletterar och preciserar de nämnda programmen. 
Lagen ställer inga hinder för att inarbeta planen för väghållning och trafik i någon annan plan som gäller landskapets verksamhet eller någon motsvarande helhet. 
15 l §.Avtal om väghållning. Enligt det föreslagna 1 mom. ska väghållaren och samarbetsområdet för väghållning i syfte att ordna väghållningen bereda ett fyraårigt väghållningsavtal. Grunden för beredningen av avtalet är på det sätt som sägs i motiven till 15 m § utkastet till landskapets plan för väghållning och trafik. I praktiken ska avtalet kunna göras mer bindande för det första avtalsåret, och i samband med de årliga förhandlingar som nämns i 15 m § ska avtalet kunna uppdateras genom översyn av avtalet för året innan och precisering av formuleringarna för nästa år. 
I väghållningsavtal är det framför allt fråga om åtgärder som ska genomföras inom väghållningsområdet under följande verksamhetsår och om finansiering av åtgärderna. Avtal om den finansiering som står till buds för skötsel av uppgifterna och om inriktningen av finansieringen ska ingås per väghållningsprodukt. I avtalet ska anges de framtida finansieringsreserveringar som får användas av landskapen inom väghållningsområdet. Frågan om till vilken underhållsklass varje landsväg hör bestäms i väghållningsavtalet. Med stöd av förordningsbemyndigandet i 33 § föreskrivs om underhållsklasserna. Avtalet ska dessutom gälla de mål och tillvägagångssätt som gäller väghållningen, målen för verksamheten och ekonomin samt rapporteringen och andra frågor som är viktiga för väghållningen. I 100 § föreskrivs om väghållarens och landskapens beredskapsskyldighet. I väghållningsavtalet ska avtalas om åtgärder som är nödvändiga för uppfyllande av denna skyldighet. I 15 o § föreskrivs om egenkontroll och också om åtgärder i samband med förpliktelser som föreskrivs i paragrafen. I väghållningsavtalet ska avtalas om samarbetet mellan Trafikverket och väghållningsområdet. I det ska också avtalas om ansvars- och skadeståndsfrågor, till exempel för det fall att avtalsparterna inte fullgör sina avtalade skyldigheter som räknas upp i paragrafen.  
Endast ett avtal ska ingås mellan samarbetsområdet för väghållning, landskapen och väghållaren, och alla avtalsparter ska godkänna det. Det är alla landskap i samarbetsområdet som är avtalsparter. Avtalet får innehålla en separat del för varje landskap inom samarbetsområdet. På detta sätt erbjuds det möjligheter att göra fördelningen av medlen och åtgärderna öppen för insyn inom samarbetsområdet. Det är ändå inte obligatorisk att skriva in en landsskapsspecifik del i avtalet. 
15 m §.Förfarandet vid avtal om väghållning. Enligt den föreslagna paragrafens 1 mom. ska samarbetsområdet för väghållning bereda ett utkast till plan för väghållning och trafik innan förhandlingarna om avtalet om väghållningen inleds med väghållaren. Planerna ska utgöra utgångspunkt för avtalsförhandlingarna och de utgör det viktigaste underlaget för arbetet med avtalet om väghållning. 
Enligt det föreslagna 2 mom. ska förhandlingarna föras årligen på hösten. I enlighet med vad som sägs i motiven till 15 m § innebär det i praktiken att planen eller planutkastet ska tas fram i maj–september. Avtalet ska vara mer exakt i fråga om det första året och mer allmänt hållet för de följande åren. För det första året kan det vid behov utarbetas en mer exakt handlingsplan för samarbetsområdet för väghållning eller någon annan beskrivning av det första avtalsåret, som kan tas in i eller fogas till avtalet. Avtalet ska ses över årligen och vid behov när det sker förändringar i verksamhetsmiljön exempelvis till följd av översvämningar, stormar eller andra liknande situationer. 
Enligt 3 mom. ska i enlighet med avtalet mellan landskapen inom samarbetsområdet väghållarens företrädare för Trafikverket och för samarbetsområdet delta i avtalsförhandlingarna. Med andra ord kan representanter för det landskap som ansvarar för uppgifterna inom samarbetsområdet eller för alla landskap delta i förhandlingarna i enlighet med avtalet mellan landskapen. Bestämmelserna medger överenskommelse om saken inom samarbetsområdet och dessutom organisering på ett ändamålsenligt sätt med tanke på de tillgängliga resurserna och andra frågor. Det är inte nödvändigt att i landskapens samarbetsavtal avtala om vilka representanter som ska delta i förhandlingarna, utan det går också att avtala om saken på annat sätt inom samarbetsområdet. Avtalet undertecknas av väghållarens representant och representanterna för landskapen inom samarbetsområdet för väghållning. 
Enligt det föreslagna 4 mom. ska också kommunikationsministeriet delta i förhandlingarna, om överenskommelse inte nås i förhandlingarna enligt paragrafen. 
15 n §.Ersättande av avtal om väghållning med beslut av statsrådet. Om inget avtal om väghållning nås och inte heller samförstånd vid förhandlingarna med kommunikationsministeriet, ska statsrådet på föredragning av kommunikationsministeriet fatta ett beslut om de ärenden som ska avgöras genom ett avtal om väghållning. Detta är nödvändigt för att trygga kontinuitet samt användbarhet när det gäller de landsvägar som används för allmän trafik och nödvändiga mobilitetsbehov. Utan avtal kommer samarbetsområdet för väghållning inte att ha tillgång till finansiering för väghållningen och då kan nödvändiga dagliga och andra väghållningsuppgifter förbli ogjorda. 
Enligt 2 mom. ska statsrådet samtidigt bestämma om det förfarande genom vilket statsrådets beslut kan ersättas med ett avtal mellan väghållaren och de landskap som hör till samarbetsområdet för väghållning. Målet är att ett väghållningsavtal ska ingås, och ett eventuellt statsrådsbeslut ska därför bara gälla tills det att parterna nått samförstånd om ett avtal. 
Enligt 3 mom. ska sådana beslut av statsrådet beredas vid kommunikationsministeriet, och i samband med beredningen ska ministeriet höra de landskap som beslutet gäller, väghållaren och andra ministerier och myndigheter vars verksamhetsområde i väsentliga avseenden kan omfatta väghållning. 
Beslut som statsrådet fattat med stöd av denna paragraf kan överklagas i enlighet med 105 §. I 107 § föreskrivs om omedelbar verkställighet av beslut.  
15 o §.Egenkontroll av väghållningen. I landsvägslagen finns för närvarande inga bestämmelser om övervakning av väghållningen. Denna övervakning har hittills gjorts i enlighet med Trafikverkets egna riktlinjer och i enlighet med bestämmelser i entreprenadavtal. Beställarens och producenternas egenkontroll kommer i fortsättningen att spela en central roll. Det föreslås att i lagen tas in en bestämmelse om kontrollskyldigheten. Målet är att egenkontrollen i framtiden till följd av bestämmelsen ska vara mera systematisk och öppnare. Med egenkontroll avses ett system varmed det säkerställs att verksamheten och servicen ordnas på det sätt som lagstiftningen förutsätter.  
I paragrafen föreskrivs att väghållaren, dvs. Trafikverket och landskapet ska upprätta ett program för egenkontroll av de uppgifter inom väghållningen som den ska sköta. Programmet för egenkontroll är ett ledningsinstrument. Avsikten är också att säkerställa väghållningsuppgifternas planmässighet, kvalitet och lagenlighet samt väghållningens enhetlighet i hela landet. I programmet ska fastställas hur uppfyllandet av lagens allmänna krav för väghållningen, servicenivån på resor och transporter på landsvägar samt uppnåendet av målet för underhållet säkerställs. I programmet för egenkontroll ska det anges hur uppfyllandet av kraven följs upp och hur konstaterade brister avhjälps. I analysen om hur målen och kraven uppnåtts kan till exempel utnyttjas exakta mätare, när sådana kan tillämpas (exempelvis i samband med underhåll), kundåterkoppling och kvalitativa analyser. I fråga om avhjälpandet av brister ska med hjälp av egenkontrollprogrammet behandlas behoven att förbättra och göra ändringar i processerna och förfarandena. Trafikverkets program för egenkontroll av väghållningen och landskapens kontroll för egenkontroll av väghållningsområdena kompletterar varandra så att båda programmen inriktas på att ordna kontrollen i anslutning till aktörens egen roll. 
I fråga om landskapets egenkontroll är det av en central betydelse att beakta väghållningsbeställarens synpunkter samt tryggandet av beställarens rättigheter och skyldigheter i de avtal som ingås med serviceproducenterna, men också att i väghållningsavtalen ta in de skrivningar som är viktiga från beställarens synpunkt. I landskapens roll ingår också att för egen del följa upp väghållningsavtalen och rapportera om genomförandet. De avtal som ingås med serviceproducenterna är nära förknippade med landskapens egenkontroll och i dem ska i enlighet med 3 mom. avtalas om övervakning av producenterna samt om behandling av avvikelser i fråga om kvalitet som behövs för att verkställa landskapets egenkontroll. Landskapen ska i fortsättningen sköta beställaruppgifterna för väghållningen inom högst nio väghållningsområden. Inom väghållningsområdena ska landskapen sinsemellan avtala vem som sköter kontrollen och se till att det i entreprenadavtalen tas in tillräckliga bestämmelser om tillsynen över serviceproducenter. I entreprenadavtalen ska beaktas såväl serviceproducentens skyldighet att övervaka sin egen verksamhet och behandla kvalitativa avvikelser som landskapets olika former av övervakning när det gäller serviceproducenterna. Entreprenören kan dessutom ha egna kvalitetssäkringsmetoder. Vid ordnandet av landskapets egenkontroll kan också utnyttjas förfaranden som i tillämpliga delar är enhetliga med den egenkontroll som landskapet genomför i sina övriga uppgifter. 
Trafikverkets infallsvinkel när det gäller egenkontrollen och också i övrigt i egenskap av väghållare för landsvägsnätet ska vara riksomfattande och inriktad på landsvägsnätet i dess helhet. Trafikverket är i egenskap av väghållare skyldigt att säkerställa och övervaka väghållningens kvalitet på riksnivå och att säkerställa att väghållningen är tillräckligt enhetlig i hela landet. Trafikverkets roll i fråga om egenkontrollen inriktas på beredningen av väghållningsavtal, uppföljning av avtalen och beredning av de ändringar som behöver göras i följande avtal. Trafikverkets program för egenkontroll ska å andra sidan inriktas på de riksomfattande väghållningsuppgifter som Trafikverket ska sköta samt på tillsyn över de avtal som ska ingås med landskapen och målsättningarna i dem.  
Ett viktigt element i egenkontrollen är också en sådan offentlig rapport om åtgärderna och iakttagelserna som ska upprättas enligt 2 mom. Programmets offentlighet och tillgänglighet via datanäten förbättrar verksamhetens öppenhet. Landsvägsanvändarna kan på så sätt följa och utvärdera landskapens och Trafikverkets verksamhet och egenkontrollens effekt. Detta krav betyder inte att varje kvalitativ avvikelse måste rapporteras separat eller omedelbart exempelvis i situationer där ett ärende inte ännu är slutbehandlat mellan beställaren och serviceproducenten. 
I lagen definieras inte i detalj innehållet i egenkontrollprogrammet och den information som ska offentliggöras. Enligt paragrafens 4 mom. kan genom förordning av kommunikationsministeriet utfärdas närmare bestämmelser om innehållet i och utarbetandet av egenkontrollprogrammet samt om den plan i programmet som gäller främjande av kvalitetshanteringen.  
Dessutom ska Trafiksäkerhetsverket i fortsättningen ha i uppgift att sörja för myndighetsövervakningen av väghållningen, som det föreskrivs närmare om i 100 b §. Syftet med egenkontrollen är å andra sidan att förhindra sådana situationer där Trafiksäkerhetsverket i efterhand måste ingripa i verksamheten. 
15 p §.Rätt att få information. I denna paragraf föreskrivs om de väghållningsansvarigas rätt att få information av varandra och av andra myndigheter samt av en sådan privat tjänsteleverantör som på deras vägnar enligt avtal sköter en bestämd uppgift. De ska enligt förslaget ha rätt att avgiftsfritt och utan hinder av sekretessbestämmelserna få den information som är nödvändig för att väghållaren och landskapet ska kunna sköta sina väghållnings-, egenkontroll- och tillståndsuppgifter enligt denna lag. Det kan till exempel vara fråga om information som behövs för väghållning och omständigheter som har betydelse för väghållningen samt om information som har samband med regionala förhållanden. Väghållarens informationsbehov kan gälla exempelvis tillståndsuppgifter inom väghållningen och utredning av regionala förhållanden i samband med genomförandet av väghållning. Landskapets informationsbehov kan ha samband med exempelvis uppföljning av upphandlingsavtal och med sådan information om entreprenörers åtgärder som behövs för rapportering om avvikelser. Utgångspunkten är den att landskapen ska beakta sina informationsbehov i förhållande till enskilda tjänsteleverantörer också i de avtal som de ingår med dem. I fortsättningen ska emellertid också en väghållare som inte sköter beställaruppgifter men svarar för tillståndsuppgifter i samband med väghållning kunna behöva information av tjänsteleverantörer som har ingått avtal med landskapen.  
2 kap.Planering av landsväg 
15 q §.Uppgifter vid planering av landsväg. I den föreslagna nya paragrafen om landsvägsplanering föreskrivs det om planer inför landsvägsprojekt, den planerande myndigheten och myndighetssamarbetet när planer utarbetas. 
I 1 mom. slås det rådande läget fast i fråga om planeringen av landsvägsprojekt. Utredningsplaner och vägplaner ska även i fortsättningen vara de vägprojektplaner som regleras i landsvägslagen. Dessutom ska 1 mom. hänvisa till de planeringsgrunder som gäller utredningsplaner och vägplaner. Närmare bestämmelser om grunderna ska finnas i de nya paragraferna (15 r och 15 s §) om planeringsgrunder för utredningsplaner och vägplaner, beredning och godkännande av grunderna och iakttagande av grunderna. 
Planeringsobjekten bestäms i samband med väghållningsavtalet på förslag av landskapen inom väghållningsområdet. Valet av planeringsobjekt ska baseras på den riksomfattande och på landskapsnivå upprättade trafiksystemplanen. I väghållningsavtalet ska avtalas åtminstone om betydande planeringsobjekt. Enligt avtalet kan fastställandet av övriga planeringsobjekt lämnas beroende av de beslut som väghållningsområdets landskap fattar.  
Paragrafens 2 mom. motsvarar 11 § 2 mom. om den ansvariga myndigheten för väghållning. Där står det att samarbetsområdet för väghållning svarar för organiseringen av väghållningen inom dess verksamhetsområde i enlighet med avtalet om väghållningen och under väghållarens styrning. Det är således i regel landskapet som ansvarar för utarbetandet av utredningsplanen och vägplanen. Planeringsuppgifterna liksom de övriga väghållningsuppgifter som landskapen ska sköta enligt denna lag, ska skötas per väghållningsområde i enlighet med vad som framgår av samarbetsavtalet om landskapens väghållningsområde. För klarhetens skull ska i den första paragrafen i 2 kap. tas in ett uttryckligt omnämnande om saken, men också andra planeringsuppgifter i samband med väghållningen ska inom väghållningsområdena skötas i enlighet med den förpliktelse som föreskrivs i 15 f § och som gäller samarbete mellan landskapen. 
Också väghållaren är emellertid behörig att utarbeta planer. Väghållaren kan åta sig att svara för utarbetandet av en utredningsplan eller vägplan som gäller betydande eller krävande vägprojekt. Som betydande vägprojekt kan betraktas till exempel i statsbudgeten särskilt nämnda riks- och stamvägar samt livligt trafikerade regionvägar eller projekt som gäller stomnätet. Dessa planer kan på grund av riktgivande byggnadstidtabeller direkt vara sammankopplade med Trafikverkets arbetsinsats för genomförande av projekten. På grund av en övergripande tidtabell är det motiverat att genomföra planeringen och byggandet enligt landsvägslagen som en enda helhet. Det kan också vara fråga om projekt för vilka det behövs mångsidig specialkompetens eller projekt som har betydelse eller konsekvenser för samhället, exempelvis vägprojekt på E18 eller på riksväg 4 inom stomnätet TEN-T.  
I 2 mom. föreslås dessutom en klarläggande bestämmelse som säger att landsvägslagens bestämmelser om utarbetande av utredningsplaner, vägplaner, projektbedömningar, planeringsgrunder och utvärderingar även gäller väghållaren när denne svarar för planeringen eller projektgenomförandet. 
När landskapen och staten får nya roller inom vägprojektplaneringen kommer deras och också andra myndigheters samarbete att accentueras ytterligare inom planeringen. Därför innehåller 3 mom. en allmän bestämmelse som framhäver betydelsen av myndighetssamarbete. Bestämmelsen motsvarar delvis 8 § 2 mom. i banlagen, som innehåller bestämmelser om banhållarens skyldighet att samarbeta med andra myndigheter när planer görs upp. 
Till denna lag har fogats bestämmelser om trafiksystemplanen på riks- och landskapsnivå. Planeringen av landsvägar ska förverkliga målsättningarna gör utvecklingen av trafiksystemet. Till paragrafens 3 mom. ska enligt förslaget fogas ett omnämnande om att planeringen av landsvägar sammanhänger med trafiksystemplanerna på riks- och landskapsnivå. Bestämmelsen om sambandet med den mera allmänna trafiksystemplaneringen har överförts till detta moment från nuvarande 17 §. Dessutom föreskrivs i 3 mom. att planeringen ska grunda sig på landsvägens utvecklingsbehov, den riksomfattande trafiksystemplanen, planeringsgrunderna för utrednings- och vägplaneringen samt på planeringen av områdesanvändningen. 
15 r §Projektbedömning. Paragrafen föreslås innehålla bestämmelser om projektbedömning. Även om paragrafen är ny rör det sig om ett existerande bedömningsförfarande i samband med planering. Det är Trafikverket som genom sina anvisningar styr hur projektbedömningen ska utarbetas och dess innehåll. Genom landskapsreformen uppkommer ett behov av att se till att det förfarande som stödjer beslutsfattandet om projektplanering och projektgenomförande tillämpas enhetligt inom vägprojekt. 
Syftet med projektbedömningar är att stödja beslutsfattandet när det gäller planering och genomförande av projekt. I fråga om utredningsplaner ska projektbedömningen användas för att stödja valet av åtgärder inom projektet och för jämförelse av de olika projektalternativens effekter och lönsamhet. Projektbedömningen ger insyn i de val som den som utarbetat planen har gjort och säkerställer att de projektalternativ som ger mest effekt och genomslag går framåt i processen. I vägplansfasen kommer den information som projektbedömningen genererar att göra det lättare att jämföra olika projekt med varandra i fråga om effektivitet och genomslag, och i sista hand kommer den att stödja det politiska beslutsfattandet vid valet av projekt. Ofta förutsätts också i fråga om projekt för vilka ansöks om EU-finansiering att det görs lönsamhets- och andra bedömningar.  
Det är den myndighet som ansvarar för utarbetandet av planen som ska göra projektbedömningen. I regel således samarbetsområdet för väghållning. I situationer där det är väghållaren som ska utarbeta planen ska väghållaren också göra projektbedömningen. Projektbedömningen ska vara en del av förberedningen av planen och därför ska man samarbeta enligt 15 q § 3 moment med andra myndigheter så som kommuner. Utgångsinformation och projektets verkningar är viktiga att bedöma i samarbete med dem vars verksamhet är påverkad av projektet. 
För projektbedömningens vidkommande är det viktigaste att bedömningen håller hög kvalitet, med andra ord att den är objektiv, öppen för insyn och tillförlitlig. Det är också viktigt att projektbedömningarna är sinsemellan jämförbara, vilket förutsätter att de tas fram på ett samstämmigt sätt. I dagens läge försöker man se till att bedömningarna är jämförbara och insynsvänliga genom anvisningar från Trafikverket. Projektbedömningar ska sålunda göras i enlighet med väghållarens anvisningar. Jämförbarheten och insynsvänligheten kan säkerställas genom att följa anvisningarna. 
Projektbedömningen ska innehålla en beskrivning av utgångspunkterna och konsekvenserna, en bedömning av själva projektet, en plan för uppföljning och utvärdering samt rapportering och dokumentering av bedömningen. En projektbedömning enligt ovan innefattar följande delar: 
Beskrivningen av utgångspunkterna 
– projektalternativ 
– hur jämförelsen lagts upp 
– trafikprognos 
Beskrivning av konsekvenserna 
– bestämmande och val av konsekvenser 
– val av mått och kriterier för konsekvenserna 
– sammanställande av planeringsparametrarna för konsekvenserna 
Bedömning av projektet 
– bedömning av effekterna 
– lönsamhetskalkyl 
– genomförbarhetsstudie 
– slutsatser 
Plan för uppföljning och utvärdering 
– rapportering och dokumentering av bedömningen 
– rapportering om projektbedömningen 
– sammanfattning av projektbedömningen 
– dokumentering av projektbedömningen 
15 s §.Planeringsgrunder för utredningsplanering och vägplanering. Lagen föreslås innehålla bestämmelser om planeringsgrunder för utredningsplaneringen och vägplaneringen. Det är fråga om att skriva in rådande planeringspraxis i lag. Planeringsgrunderna tas i dagens läge fram utifrån Trafikverkets anvisningar. Genom landskapsreformen uppkommer ett behov av att se till att denna behövliga planeringspraxis tillämpas enhetligt inom landskapens vägprojektplanering. 
Grunderna ska stödja och främja måluppfyllelse när det gäller de allmänna målen enligt lagen och målen för trafiksystemplaneringen. Syftet är att säkerställa att bland annat de mål i fråga om servicenivåer som uppställs inom trafiksystemplaneringen fullföljs när vägprojekt planeras. I planeringsgrunderna anges landsvägens referenshastighet, tvärsektion och principerna för anslutningar mellan landsvägar och till enskilda vägar. Alla dessa delfaktorer är av avgörande betydelse när det gäller att uppnå servicenivåmålen. 
Syftet med planeringsgrunderna är att uppställda mål inom trafiksystemplaneringen och den ingående förplaneringen ska införlivas i planeringen av vägprojekt. Grunderna är projektplaneringsmål som ska främjas inom planeringen. Därför föreslås en bestämmelse om att de ska beaktas och deras fullgörande främjas när utredningsplaner eller vägplaner utarbetas. Den föreslagna ordalydelsen medger den flexibilitet som behövs när grunderna ska iakttas, men kräver också att det säkerställs att uppnåendet av målsättningarna för planeringsgrunderna främjas. 
I enlighet med nuvarande praxis ska det inte vara nödvändigt att ta fram planeringsgrunder för alla vägprojekt. Riksvägarna, stamvägarna och livligt trafikerade regionala vägar är viktiga trafikmässigt och över landskapsgränserna, och därför är det motiverat att väghållaren kan besluta om planeringsgrunder behöver utarbetas för utredningsplaner och vägplaner för dessa. Som livligt trafikerade regionala vägar ska betraktas till exempel regionala vägar vilkas trafikmängder är exceptionellt stora jämfört med andra regionala vägar. Som exempel kan nämnas att en av Finlands livligast trafikerade vägar, dvs. Ringväg I är en regional väg (regionväg 101). Väghållaren ska ha rätt att besluta om detta även i situationer där det är samarbetsområdet för väghållning som svarar för att planen utarbetas. Beslut om andra grunder för planering av vägnät ska fattas av landskapet i enlighet med den ansvarsfördelning som landskapen inom väghållningsområdet har kommit överens om.  
Landskapet ska svara för beredningen av planeringsgrunderna i enlighet med den ansvarsfördelning som landskapen inom väghållningsområdet har kommit överens om i samarbete med väghållaren och de övriga myndigheter som ärendet gäller såsom kommuner. När väghållaren tar på sig ansvaret för att utarbeta en utredningsplan eller vägplan ansvarar den också i enlighet med 15 p § 3 mom. för att ta fram planeringsgrunderna, och den ska då samarbeta med landskapet och eventuellt med andra myndigheter. 
Väghållaren godkänner de planeringsgrunder som gäller riksvägar och stamvägar samt regionala vägar med livlig trafik. Detta är motiverat eftersom de trafiklederna är viktiga trafikmässigt och över landskapsgränserna. I fråga om det övriga vägnätet ska landskapet godkänna planeringsgrunderna. Enligt den ansvarsfördelning som landskapen inom väghållningsområdet har kommit överens om kan det godkännande landskapet vara det landskap där planeringsobjektet är beläget, eller om man så beslutar, det landskap som i övrigt sköter väghållningsuppgifterna inom väghållningsområdet.  
Att godkänna planeringsgrunderna är inte detsamma som att fatta ett bindande och överklagbart beslut. Detta beror på planeringsgrundernas natur och på att de kommer att granskas närmare i samband med utredningsplanering eller vägplanering. Planeringsgrunderna ska ses som mål som styr planeringen och som blir preciserade vid övergången från en planeringsfas till en annan. Det kan också behövas ändringar i grunderna allt eftersom planeringen framskrider. Ändringarna bör ske med beaktande av samma förfarande som när grunderna utarbetas. Till detta hör bland annat en samarbetsskyldighet mellan väghållaren och samarbetsområdet för väghållning. Deltagande aktörer i utredningsplaneringen eller vägplaneringen, exempelvis fastighetsägare inom planeringsområdet, får tillfälle att bedöma grunderna inom planeringsprocessen. De som enligt 27 § får uttrycka sin åsikt eller yttra sig kan framföra sin ståndpunkt inom det förfarande för växelverkan som avses i den paragrafen. 
16 §.Rätt till utredning. Paragrafen gäller den rätt till utredning som är förknippad med utarbetandet av utredningsplaner och vägplaner. Rätten hör till den myndighet som svarar för att planen utarbetas. Eftersom uppgifterna inom utredningsplaneringen och vägplaneringen huvudsakligen överförs på landskapens väghållningsområden föreslås det att hänvisningen till väghållningsmyndigheten i 16 § 1 och 2 mom. ändras till en hänvisning till samarbetsområdet för väghållning. Uppgiften ska enligt vad som avtalats i landskapens samarbetsavtal skötas inom väghållningsområdet. Dessutom korrigeras skrivsättet för ordparet utredningsplan och vägplan i 1 och 2 mom. i den finska versionen samt för konjunktionerna i förteckningen i den andra meningen i 1 mom. 
Enligt 2 mom. ska kommunen underrättas när utarbetandet av en utredningsplan eller en vägplan samt utredningar som har samband med den inleds. Dessutom ska de personer som nämns i 27 § 1 mom. underrättas genom kungörelse eller på annat lämpligt sätt. Staten har i egenskap av ägare till landsvägarna och Trafikverket i egenskap av väghållare fortfarande intresse av att känna till planeringsskedena när det gäller trafikledsnätet. Av den anledningen föreslås ett sådant tillägg till 16 § 2 mom. som innebär att utöver kommunen också väghållaren ska underrättas om upprättandet av utredningsplanen och vägplanen samt om inledandet av undersökningar i anslutning till planerna. Det föreslås att 2 mom. dessutom ändras så att när utarbetandet av en utredningsplan eller en vägplan samt utredningar som har samband med den inleds ska det utfärdas en kungörelse om saken med tillämpning av förfarandet för landskapets meddelanden. På motsvarande sätt ska landskapet i samband med växelverkan enligt 22 § kungöra att planen har lagts fram på det sätt som landskapets meddelanden ska läggas fram enligt landskapslagen. 
Om väghållaren i enlighet med 15 p § tar på sig ansvaret för att upprätta utredningsplanen eller vägplanen kommer bestämmelserna om upprättande av utredningsplanen, vägplanen, projektbedömningen, planeringsgrunderna och utvärderingen samt växelverkan att även gälla väghållaren. 
17 §. Planering av väg och områdesplanering. Skrivsättet för ordparet utredningsplan och vägplan korrigeras i 1 och 4 mom. i den finska versionen. 
Enligt 3 mom. ska en landsväg kunna planeras också utan plan, om vägens sträckning och förhållande till övrig områdesanvändning med beaktande av vägens karaktär i övrigt kan klarläggas i samarbete med kommunen och landskapsförbundet. I fortsättningen kommer utarbetandet av utredningsplaner och vägplaner att fördelas mellan samarbetsområdet för väghållning och väghållaren. När landskapen ansvarar för planeringen blir hänvisningen till dem onödig. I de fall där det är väghållarna som svarar för planeringen krävs det dock även i fortsättningen samarbete när förhållandet mellan vägens sträckning och annan markanvändning utreds. Därför föreslås det att 3 mom. ändras så att vägens sträckning och förhållande till övrig områdesanvändning kan klarläggas i samarbete med kommunen och vid behov landskapet. 
Det föreslås att 5 mom. flyttas till 15 p §. 
19 §. Utredningsplanens innehåll. I 19 § i landsvägslagen finns bestämmelser om utredningsplanens innehåll. Kraven på innehållet ska nu enligt förslaget utvidgas till att planen också ska beakta den riksomfattande trafiksystemplanen enligt 15 e § och landskapets trafiksystemplan enligt 15 f §. Dessutom ska utredningsplanerna också innehålla en projektbedömning enligt 15 s § samt de planeringsgrunder som avses i 15 s §, om sådana ska utarbetas. 
22 §. Vägplanens innehåll. Paragrafen innehåller bestämmelser om krav på innehållet i vägplanerna. Enligt andra meningen i 1 mom. ska till vägplanen fogas en bedömning av vägens verkningar samt i den anges de åtgärder som behövs för att avlägsna eller minska de menliga verkningar som vägen medför. Det föreslås nu att meningen preciseras med att det är fråga om de menliga verkningarna av att en väg byggs eller av trafiken. Avsikten är inte att ändra rådande praxis eftersom det redan i dagens läge är så att bedömningen av de menliga verkningarna och åtgärderna för att minska eller avlägsna verkningarna gäller följderna av att vägar byggs eller av trafiken. Det föreslås att till hänvisningen i paragrafens 1 mom. om skydds- och frisiktsområden fogas hänvisningar till motsvarande paragrafer. 
I paragrafens 3 mom. föreslås en strykning av det överflödiga ordet ”nedan”. 
Kraven på innehållet ska nu enligt förslaget utvidgas till att vägplanen också ska beakta den riksomfattande trafiksystemplanen enligt 15 b § och landskapets trafiksystemplan enligt 15 c §. Vägplanen ska emellertid inte behöva påvisa att målen för den riksomfattande trafiksystemplanen och landskapets trafiksystemplan har beaktats när detta redan påvisats i den utredningsplan som gjorts för samma projekt och vägplanen utarbetas i enlighet med utredningsplanen. Också i sådana fall ska vägplanen innehålla en redogörelse för hur trafiksystemplaneringen har beaktats till den del målen inte kunnat beaktas i utredningsplanen till följd av att den är allmänt hållen. Om avvikelse måste göras från utredningsplanen när vägplanen utarbetas och detta innebär att den redogörelse som gjorts i samband med utredningsplanen för hur målen i den riksomfattande trafiksystemplanen och trafiksystemplanen på landskapsnivå beaktats inte längre kan anses vara tillräcklig, antingen helt eller delvis, måste en ny redogörelse göras i detta avseende. Om ingen utredningsplan alls har utarbetats ska redogörelsen för hur trafiksystemplanerna beaktats göras när vägplanen utarbetas, och den ska fogas till planen. 
Dessutom sägs det i 4 mom. att vägplanerna också ska innehålla en projektbedömning enligt 15 r § och de planeringsgrunder som avses i 15 s §. I den andra meningen i paragrafens 4 mom. föreslås också en språklig justering så att ordet ”när” ändras till ”om”. 
24 §.Enskilda vägars anslutningar och lantbruksanslutningar samt utloppsdiken i vägplanen. I 2 mom. föreskrivs det om ordnande av en ny vägförbindelse i situationer där användningen av en befintlig anslutning till en enskild väg eller en lantbruksanslutning förbjuds i vägplanen. Då är det väghållningsmyndigheten som ansvarar och står för att vägförbindelsen ordnas. Eftersom termen väghållningsmyndighet ska frångås i samband med landskapsreformen föreslås det att ordet här ersätts med ordet väghållare 
27 §.Växelverkan. Paragrafen innehåller bestämmelser om förfarandet för växelverkan när utredningsplaner och vägplaner utarbetas. Enligt 1 mom. ska bland annat fastighetsägare och övriga sakägare ges tillfälle att delta när planer utarbetas. I 2 mom. sägs det å sin sida att de i 1 mom. nämnda intressenterna ska ges tillfälle att göra en anmärkning med anledning av planen innan planen godkänns. Båda momenten är skrivna i passiv på ett sätt som inte anger vilken myndighet som ska ge intressenterna tillfälle att delta och lämna anmärkning. För klarhets skull föreslås det att man i lagen skriver in att dessa uppgifter hör till den myndighet som har ansvar för att planen utarbetas, dvs. efter landskapsreformen i regel samarbetsområdet för väghållning. Uppgifterna ska inom väghållningsområdet skötas av det landskap som också annars i enlighet med samarbetsavtalet mellan landskapen sköter väghållningsuppgifterna. Dessutom korrigeras skrivsättet för ordparet utredningsplan och vägplan i 1 och 2 mom. i den finska versionen. I paragrafens 1 mom. fogas ordet kommunerna till förteckningen över aktörer som ska ges möjlighet att delta i beredningen av planen, bedöma verkningarna av planen och skriftligen eller muntligen framföra sin åsikt i saken. Ändringen behövs framför allt till följd av den ändring som föreslås i 2 mom. och som innebär att man övergår till att i stället för förfarandet med kommunala meddelanden tillämpa förfarandet med framläggande av planer när det gäller landskapets meddelanden. 
För att göra förfarandena smidigare föreslås det att paragrafens 2 mom. ändras så att på förfarandet att hålla planerna offentligt framlagda i fortsättningen ska tillämpas det i den föreslagna landskapslagen föreskrivna förfarandet gällande landskapets meddelanden i stället för förfarandet enligt kommunallagen. Eftersom uppgifterna inom utredningsplaneringen och vägplaneringen huvudsakligen överförs på samarbetsområdet för väghållning föreslås det att hänvisningarna till väghållningsmyndigheten ändras till hänvisningar till samarbetsområdet för väghållning. Genom det i paragrafens 2 mom. föreslagna tillägget att utredningsplanen och vägplanen ska hållas offentligt framlagda oavbrutet i 30 dagar säkerställs det att tiden för att hålla planerna framlagda inte avbryts av till exempel helgdagar och ämbetsverkens semesterperioder. Eftersom förfarandet ändras föreskrivs i momentet att landskapet ska ge de kommuner som planen avser tillfälle att yttra sig också om anmärkningar som framförts mot planen. Enligt den gällande lagen skulle sådana anmärkningar tillställas den kommunen som sett till att planen hålls framlagd, och kommunen har tillställt väghållningsmyndigheten sitt utlåtande om planen och om anmärkningar som gjorts mot den samt om inlämnande anmärkningsskrivelser. 
Enligt 3 mom. ska de som gjort en anmärkning och som skriftligen har bett om att bli underrättade och samtidigt uppgett sin adress bli underrättade om väghållningsmyndighetens motiverade ställningstagande till den anmärkning som gjorts. Det framgår inte direkt av bestämmelsen huruvida de som nämns i 3 mom. ska underrättas om väghållningsmyndighetens ställningstagande till anmärkningarna innan beslutet om att godkänna planen fattas eller om myndighetens svar på anmärkningarna kan ingå i beslutet. Tavastehus förvaltningsdomstol slog i ett beslut av den 3 maj 2017 (17/0136/2) fast att ordalydelsen i 27 § i landsvägslagen inte kräver svar på anmärkningar före beslutet om godkännande. Ordalydelsen i 27 § 3 mom. kan anses vara oklar i detta avseende och därför föreslås det att momentet formuleras klarare, dvs. så att ställningstagandena till anmärkningar ska ingå i det beslut om planen som den som gjort anmärkningen tillställs. Dessutom föreslås det att hänvisningen till väghållningsmyndigheten ändras till samarbetsområdet för väghållning och hänvisningen till Trafikverket till väghållaren. Landskapet ska enligt förslaget underrätta dels den som gjort anmärkningen och dels också områdets kommuner om anmärkningen. Motsvarande hänvisningsändringar görs också i första och andra meningen i 4 mom. Dessutom ändras landskapsförbundet i 4 mom. till övriga landskap. I sista meningen i 4 mom. föreslås också inskrivning av rådande praxis, dvs. att samarbetsområdet för väghållning ska ge sitt motiverade ställningstagande också om de utlåtanden om planen som myndigheter och kommuner har gett. 
27 a §.Förhandsöverläggning. Landsvägslagen föreslås få en paragraf om förhandsöverläggning, vilket kommer att stärka samarbetet och informationsutbytet mellan den ansvariga myndigheten för att planer utarbetas, dvs. samarbetsområdet för väghållning, och andra myndigheter. Det kommer också att bidra till en smidigare planering. Syftet med förhandsöverläggningar är att främja hanteringen av de utrednings- och utvärderingsförfaranden som krävs för den berörda planen och ett smidigare informationsutbyte mellan den som utarbetar planen och den som godkänner den samt andra myndigheter samt att förbättra kvaliteten på planen och framställningen om dess godkännande. 
Väghållaren ska i egenskap av myndighet som godkänner utredningsplaner och vägplaner, medan planen utarbetas, kunna ordna förhandsöverläggningar med samarbetsområdet för väghållning och vid behov också med andra berörda myndigheter, såsom kommuner och Statens tillstånds- och tillsynsmyndighet. Initiativ till överläggningar ska kunna tas av väghållaren, samarbetsområdet för väghållning eller någon annan relevant myndighet. 
27 b §.Framställning om godkännande av en utredningsplan och en vägplan. Paragrafen avses innehålla bestämmelser om framställningar om godkännande av en utredningsplan eller vägplan och om de upplysningar som ska fogas till framställan. Det rör sig om en ny paragraf, men innehållet motsvarar ett etablerat förfarande inom trafikförvaltningen där den utarbetande myndigheten, i dagens läge NTM-centralernas trafikansvarsområde och i fortsättningen landskapet enligt vad som avtalats i samarbetsavtalet om väghållningsområdet gör en framställning till väghållaren om att planen ska godkännas. 
Paragrafens 2 och 3 mom. ska gälla innehållet i framställningarna och vilka handlingar som ska fogas till framställan. I 4 mom. anges det att framställan ska lämnas skriftligen. Ansökan ska också ges in elektroniskt till väghållaren. I 5 mom. föreslås ett bemyndigande att utfärda förordning i fråga om innehållet i framställningar om godkännande. 
30 §.Ändring av och mindre avvikelser från planerna. Skrivsättet för ordparet utredningsplan och vägplan korrigeras i första meningen i den finska versionen. I enlighet med de senaste anvisningarna om författningsberedning föreslås dessutom att uttrycket ”gäller i tillämpliga delar” stryks. 
I fråga om ändring av redan godkända utredningsplaner och vägplaner gäller vad som föreskrivs om utarbetande av nya planer. Som en avvikelse från denna huvudregel kan väghållningsmyndigheten dock tillåta ändringar med obetydliga verkningar från vägplaner utan ett egentligt ändringsförfarande. Enligt motiveringen till den proposition som ledde till att landsvägslagen antogs är mindre ändringar av vägplanen kopplade till situationer där det under anläggningsarbetets gång uppstår oförutsedda överraskningar som kräver ändringar i den godkända vägplanen. Som exempel nämns situationer där vägens höjdläge eller vissa tekniska lösningar ändras när markförhållandena visar sig vara annorlunda än väntat. 
I praktiken antecknas sådana mindre ändringar inte i den godkända vägplanen. Det rör sig de facto inte om att ändra vägplanen, utan om en ändring som görs i planen och som har obetydliga verkningar. Ändringen bedöms vara nödvändig och ändamålsenlig i samband med genomförandet av planen. Därför föreslås det en ändring i ordalydelsen i andra meningen, dvs. att det i stället för ändringar som till sina verkningar är obetydliga ska röra sig om undantag som till sina verkningar är ringa. Avsikten med ändringen är inte att ändra det rådande rättsläget, och bestämmelsen om villkoren för undantag gäller fortsatt ringa undantag. Det föreslås att bestämmelsen om undantag från vägplanen med ringa verkningar ska bli 2 mom. och samtidigt ändras paragrafrubriken för att motsvara innehållet. Dessutom föreslås det att hänvisningen till väghållningsmyndigheten i 2 mom. ändras till en hänvisning till samarbetsområdet för väghållning. 
31 §.Planernas giltighetstid. I 1 och 3 mom. finns bestämmelser om utredningsplaners och vägplaners giltighetstid och om förlängning av giltighetstiderna. Det är väghållaren som ska fatta beslut om förlängning för båda typerna av planer. Däremot säger paragrafen ingenting om hur ett ärende som gäller förlängning av giltighetstiden ska inledas. 
I och med landskapsreformen kommer det i regel att vara samarbetsområdet för väghållning som svarar för att utredningsplaner och vägplaner utarbetas, och därför ligger det i samarbetsområdets intresse att också ha hand om giltighetstiderna. Således föreslås det att tredje meningen i 1 mom. om förlängning av utredningsplaners giltighetstid och andra meningen i 3 mom. om förlängning av vägplaners giltighetstid kompletteras med att förlängningsbesluten ska fattas på samarbetsområdets ansökan. Dessutom föreslås det att hänvisningarna i 1 och 3 mom. till Trafikverket som den myndighet som beslutar om förlängning av beslut om att godkänna planer ändras till hänvisningar till väghållaren 
32 §.Uppföljning och utvärdering. I 1 mom. ändras hänvisningen till Trafikverket till en hänvisning till väghållaren. Dessutom föreslås ett nytt 2 mom. om utvärdering av vägprojekt. Bestämmelsen om utvärdering är i och för sig ny på lagnivå, men utvärdering av vägprojekt är inget nytt förfarande eftersom de ansvariga myndigheterna för vägprojekt, NTM-centralernas trafikansvarsområde och Trafikverket, redan i dagens läge utvärderar projekt. 
Syftet med utvärderingarna är att få fram ytterligare uppgifter om projektens konsekvenser samt att utveckla vägplaneringen och projektbedömningen. Utvärderingen ska visa varför man gjort väsentliga avvikelser från vad som ursprungligen planerades inom projektet. Möjligheten till utvärderingar kommer också att uppmuntra till satsningar på projektbedömningarnas kvalitet. 
Enligt förslaget ska utvärderingar bara göras för sådana projekt som varit föremål för projektbedömning och för vilka det finns särskilda skäl att göra en utvärdering i efterhand. Med andra ord behöver en utvärdering inte göras för varje vägprojekt som det gjorts projektbedömning för. Särskilda skäl till att göra en utvärdering är exempelvis situationer där det utifrån projektets konsekvenser anses finnas möjligheter att lära sig något inför framtida projekt eller om man ser att projektkonsekvenserna utvecklas på ett sätt som avviker stort från vad projektbedömningen visade. 
För utvärderingen ansvarar samarbetsområdet för väghållning, men i samarbete med väghållaren och under dess styrning. 
Utvärderingen kan utarbetas i flera etapper i syfte att få reda på konsekvenserna av ett vägprojekt på kort och lång sikt. Typiskt sett skulle en första utvärdering göras när det har gått 2–7 år sedan vägen öppnades för trafik. Konsekvenserna på lång sikt, såsom konsekvenserna för markanvändning och samhällsstrukturen, kan däremot utvärderas cirka 10–15 år efter det att vägen öppnades för trafik. 
Utvärderingarna ska typiskt sett bedöma frågor som gäller projektgenomförandet, trafikprognoser och körkostnader, trafikolyckor, andra observerade konsekvenser av projektet och utfallet när det gäller projektets effekter och lönsamhet. Följande kan utvärderas: 
Projektgenomförande 
– hur kostnadskalkylen utfallit 
– hur den vägplan som legat till grund för projektbedömningen genomförts 
– hur trafiken och miljön påverkades under byggtiden 
Trafikprognos och körkostnader 
– trafikvolym och förskjutningar i trafiken  
– restider och trafikmässiga servicenivåer 
– fordons- och utsläppskostnader 
Trafikolyckor 
– olyckor på projektnätet 
– olyckor på den del av trafiknätet dit trafiken förflyttats 
Andra observerbara konsekvenser 
– hur markanvändningen och samhällsstrukturen utvecklats 
– hur naturen och den byggda miljön påverkats 
Effektutfall 
– utvärdering av hur de uppställa målen nåtts 
– utvärdering av hur kriterierna för bedömning av effekten uppfylls 
Lönsamhetsutfall 
– utvärdering av kostnadsnyttoförhållandet 
– utvärdering av avkastningen för olika år 
32 a §.Hur järnväg beaktas vid planeringen av en väg. Enligt förslaget ska ett nytt 2 mom. fogas till paragrafen. Det rör sig om en informativ bestämmelse om att de ändringar i järnvägar som avses i 1 mom. i den plan som gäller byggandet av en landsväg ska presenteras separat i enlighet med vad som föreskrivs i banlagen. När ändringar som gäller järnvägar planeras ska man utöver banlagens bestämmelser också beakta andra bestämmelser och föreskrifter som gäller järnvägsplanering, Trafikverkets anvisningar om banhållning och etablerad planeringspraxis inom banhållningen. 
3 kap.Underhåll av en landsväg, tillfälliga trafikarrangemang samt anslutningar och övriga åtgärder som gäller landsvägen 
33 §.Underhåll av landsväg. Paragrafen avses innehålla bestämmelser om nivån på landsvägsunderhållet. Med underhåll avses i enlighet med definitionen i 3 § skötsel och reparation av vägar. Med en vägs skick avses sålunda dels beläggningens och broars skick och dels vägens framkomlighet genom dagligt underhåll. Det föreslås att begreppet underhåll i enlighet med branschens rekommendationer ersätts med begreppet reparation. I begreppet reparation ingår bland annat beläggningsarbeten och reparation av vägkonstruktioner och broar.  
Enligt det gällande 1 mom. ska landsvägar hållas i ett tillfredsställande skick, vilket nu enligt förslaget ersätts med ”i ett sådant skick som motsvarar trafikens behov och trafikledens betydelse för trafiken”. De ärenden som enligt paragrafens nuvarande 1 och 2 mom. ska beaktas när det gäller nivån på underhållet och underhållet i övrigt ska enligt förslaget överföras till förteckningen i 1 mom. Enligt momentets 1 punkt ska hänsyn tas till trafikmiljön, lokala behov och väglaget. Med trafikmiljön avses exempelvis sådana delar av en landsväg som gångbanor och cykelbanor, busshållplatser, anslutningsparkering, bullerhinder samt miljön där en väg är belägen (exempelvis tätort eller glesbygd). I anslutning till beaktandet av trafikmiljön och de regionala behoven ska bland annat beaktas samordningen av nivån på underhållet med gatunätet, så att det inte sker plötsliga förändringar i vägens nivå vid en övergång till kommunens gatuenhet. Detta gäller också gångbanor och cykelbanor i anslutning till landsvägar. På detta sätt främjas fungerande rese- och transportkedjor. Dessutom ska förteckningen kompletteras med en ny hänvisning till de allmänna krav på väghållningen som föreskrivs i 13 § och den servicenivå som avses i 13 a § samt med krav som gäller livscykelverkningar och kostnadseffektivitet samt bevarandet av vägegendomen. För att den servicenivå som avses i 13 a § ska nås på trafiknätet krävs det vissa underhållsåtgärder bland annat i fråga om spårdjup och den dagliga nivån på skötseln. Med beaktande av underhållets livscykelverkningar avses att man vid valet av åtgärder beaktar varje strukturs livscykel (rätt åtgärd i rätt tid). I kostnadseffektiviteten ingår bland annat valet av åtgärder och objekt, genomförandet och upphandlingen. Med bevarandet av vägegendomen avses att underhållet ska göras på ett sådant sätt att vägegendomen bevaras i enlighet med målsättningen (minskar, hålls oförändrad eller växer kontrollerat). Bevarandet av vägegendomen innebär exempelvis i fråga om vinterunderhåll i praktiken att man undviker användning av salt på vägar med lätt beläggning. 
Det föreslås att till paragrafens 2–4 mom. fogas bestämmelser om nivån på underhållet av landsvägarna inom stomnätet, på andra riks- och stamvägar än de som hör till stomnätet samt på andra region- och förbindelsevägar än de som hör till stomnätet. De nya nivåkraven ska i fortsättningen beaktas vid beslutsfattandet om statsfinansiering av väghållningen samt i samband med skötseln av landskapens väghållningsuppgifter.  
Inom stomnätet ska underhållet anpassas framför allt till långdistanstrafikens behov. Underhållet av landsvägarna inom stomnätet ska vara av hög kvalitet. Med underhåll av hög kvalitet avses proaktiva och livscykeleffektiva åtgärder som minimerar trafikstörningar under alla årstider och dygnstider. Tack vare högklassigt underhåll blir resor och transporter inom stomnätet förutsebara.  
Vinterunderhållet ska tidsplaneras så att åtgärderna i en så liten utsträckning som möjligt medför olägenheter för trafiken. Underhåll av hög kvalitet innebär också att underhållsåtgärderna vintertid är korta och anpassade till väderförhållandena, men körförhållandena kan på grund av väderförhållandena tillfälligt variera. För stomnätets vidkommande eftersträvas det att vägarna huvudsakligen är bara. Under kalla perioder får det på vägarna i en viss utsträckning finnas tunna längsgående hårdpackade snövallar som inte i någon större utsträckning påverkar körandet och i situationer då det sker väderomslag får det förekomma lindrig halka. Halka bekämpas i regel med förebyggande åtgärder.  
Kriterier på en landsvägs skick är bland annat dess spårighet, ojämnhet och skador samt vägytans grovhet, enstaka ojämnheter samt skadefrekvenser. Högklassigt underhåll i fråga om reparation av vägkonstruktioner och beläggningar innebär att de landsvägar som hör till stomnätet från väganvändarnas synpunkt är i gott skick och håller en jämn kvalitet. Vägavsnitt som är i dåligt skick samt viktbegränsningar får förekomma endast i liten utsträckning eller inte alls. Reparationer av landsvägar inom stomnätet ska vara proaktiva och livscykeleffektiva. Rätt dimensionerade åtgärder ska vidtas i rätt tid. Reparationsskulden får inte tillåtas växa.  
Underhållet av riks- och stamvägar som inte hör till stomnätet ska anpassas till trafikvolymen, trafikmiljön och de regionala behoven, således med beaktande också av långdistanstrafikens behov. Underhållet av riks- och stamvägar som inte hör till stomnätet ska fortfarande vara av god kvalitet, men tidsmässiga och lokala variationer tillåts med beaktande av de trafikmässiga behoven och förhållandena. Det får förekomma variationer och olägenheter till exempel beroende på väderförhållandena samt årstiden och dygnstiden. Beroende på trafikmängderna och vädret kan vägytan vara delvis bar och delvis får det på vägen finnas längsgående vallar av hårdpackad snö eller också kan vägen vara helt täckt av hårdpackad snö. Med undantag för de mest problematiska väderförhållandena ska på vägarna råda ett gott vinterföre som inte är jämförbart med bar asfalt, men tillräckligt tryggt för väganvändare som anpassar sig till de rådande förhållandena.  
På sådana riks- och stamvägar som inte hör till stomnätet varierar skicket mer än på stomnätet, beroende på vägarnas varierande trafikmässiga betydelse. Vägavsnitt som är i dåligt skick kan förekomma i en något större utsträckning än inom stomnätet. Utgångspunkten är den att reparationsskulden inte får tillåtas växa. I fråga om reparationsåtgärder eftersträvas livscykeleffektivitet.  
Underhållet av region- och förbindelsevägar som inte hör till stomnätet ska enligt förslaget anpassas till den regionala trafikens behov. Nivån på underhållet av vägarna inom denna del av landsvägsnätet får vara lägre än inom det övriga vägnätet, men nivån får tidsmässigt eller lokalt variera med beaktande av trafikmässiga behov och förhållanden. Underhållet får sålunda till vissa delar, exempelvis på livligt trafikerade regionvägar, såsom ringvägar och städers infartsleder, också motsvara underhållet av riks- och stamvägar. I fråga om region- och förbindelsevägar som inte hör till stomnätet eftersträvas objektvis så förmånliga underhållslösningar som möjligt för att tillgodose de regionala behoven med beaktande av trafikens sammansättning och vägens betydelse. När det gäller den regionala trafikens behov är det skäl att beakta bland annat skolskjutsar, social- och hälsovårdstransporter, ruttrafik och de behov som orsakas av lokala arbetsresor. Landskapen och kommunerna har en central roll för identifieringen av de lokala behoven och anpassningen av nivån på underhållet enligt dem. Trafiksäkerheten måste värnas liksom inom andra delar av nätet. Åtgärdstiderna behöver inte nödvändigtvis vara lika korta som inom övriga delar av nätet. I normala situationer ska vägarnas friktion och jämnhet vara tillräcklig för en måttlig trafik. Vid väderomslag kan föret ibland vara problematiskt i många timmar, vilket förutsätter särskild försiktighet från trafikanterna sida.  
I fråga om region- och förbindelsevägar som inte hör till stomnätet eftersträvas kostnadsbesparingar genom att vid behov tillåta att landsvägar är i ett sämre och oenhetligare men ändå ändamålsenligt skick. Landsvägarna ska hållas i ett så gott och trafikabelt skick som möjligt bland annat genom lagning av beläggningsskador och andra reparationer och, om möjligt, genom att förhindra uppkomsten av skador. Det godtas dock att reparationsskulden på denna del av nätet ibland kan växa.  
I paragrafens 5 mom. föreskrivs att närmare bestämmelser om nivån på underhållet av landsvägar och om underhållsklasserna utfärdas genom förordning av kommunikationsministeriet. Genom förordning kan således föreskrivas hur den underhållsnivå som förutsätts i denna paragraf i praktiken ska uppnås. I fråga om underhållet tillämpas för närvarande Trafikverkets interna kvalitetskrav som inte bestäms enligt lagens klassificering. En central utgångspunkt när det gäller att fastställa de nuvarande nivåerna har varit vägens trafikmängd. Det kan också i fortsättningen finnas ett behov att till exempel utöver den tredelning som föreslås i 2–4 mom. fastställa flera underhållsklasser, dock med iakttagande av lagens krav när det gäller nivån på underhållet. En sådan noggrannare klassificering måste emellertid baseras på de faktorer som nämns i denna paragrafs 1 mom. och på landsvägens trafikmässiga betydelse. Vid behov är det emellertid möjligt att beakta också andra särskilda omständigheter.  
I väghållningsavtalen bestäms till vilken underhållsklass varje landsväg hör. Målet är en i hela landet enhetlig underhållsnivå som utöver det allmänna trafikbehovet och landsvägens trafikmässiga betydelse dessutom beaktar de i paragrafen nämnda omständigheter som förutsätter särskild granskning.  
34 §.Begränsat underhåll. I paragrafens 1 mom. föreslås en sådan ändring att det i fortsättningen ska vara väghållaren som på förslag av landskapet beslutar om begränsat underhåll, vilket leder till att en väg eller en del av en väg stängs av för allmän trafik. För närvarande är det väghållningsmyndigheten som är behörig i sådana ärenden. I paragrafens 1 mom. preciseras dessutom skyldigheten att också i digital form producera information om tillfällig avstängning av en landsväg eller en del av en landsväg. I 2 mom. ändras ordet väghållningsmyndighet till väghållare.  
35 §.Tillfälligt trafikförbud eller tillfällig begränsning av trafiken. I 1 mom. ändras ordet väghållningsmyndighet till väghållare.  
Det föreslås att till paragrafen fogas ett nytt 2 mom. där det föreskrivs om landskapets rätt att bevilja temporärt undantag från de förbud eller den begränsning som avses i 1 mom. Bestämmelsen om undantag motsvarar nuläget, eftersom det redan nu av särskilda skäl har kunnat beviljas undantag i menförestider, exempelvis för nödvändiga transporter och specialtransporter av virke, marksubstanser, bränsle, industriella gödselmedel, byggnadsmaterial samt skogs- och byggarbetsmaskiner. Det är också i fortsättningen fråga om tillstånd som prövas från fall till fall och beviljas i undantagsfall då det uttryckligen är fråga om ett särskilt transportbehov. Också i själva begränsningsbeslutet måste det nämnas vilken typ av trafik begränsningen gäller.  
I paragrafens nya 3 mom. preciseras skyldigheten att också i digital form producera information om tillfälliga förbud och begränsningar.  
36 §.Tillfällig farväg. I 1 mom. ändras ordet väghållningsmyndighet till väghållare. I momentet föreslås också språkliga justeringar. I paragrafens nya 3 mom. preciseras skyldigheten att också i digital form producera information om tillfälliga förbud och begränsningar.  
37 §. Anslutning till landsväg. I 1–4 mom. ändras ordet väghållningsmyndighet till väghållare. I paragrafens 1 och 2 mom. föreslås dessutom språkliga justeringar. 
38 §.Anläggande, underhåll eller ändring av anslutning eller övergångsställe. I 1, 2och 4 mom. ändras ordet väghållningsmyndighet till väghållare. Dessutom föreslås det att 1 mom. får en ny bestämmelse. Den innebär att det i fortsättningen är den som ansvarar för landsvägens underhåll som svarar för underhåller av vägtrummor till enskilda vägars anslutning eller lantbruksanslutningar. Enligt momentet ska väghållaren eller det på avtal baserade samarbetsområdet för väghållning svara för underhållet av vägtrummor vid enskilda vägars anslutningar eller lantbruksanslutningar. Syftet är att få dräneringen av landsvägarna att fungera bättre och att minska skador på vägkonstruktionen till följd av tjälskador och sämre bärighet. 
I paragrafens 1 mom. föreslås dessutom språkliga justeringar. Hänvisningen till viteslagen i paragrafens 4 mom. ska enligt förslaget ändras så att den blir informativ. 
39 §.Avskärande av en enskild väg, en gata eller en snöskoterled. I 1 mom. ändras ordet väghållningsmyndighet till den som ansvarar för projektet. Med den som ansvarar för projektet avses den som svarar för projektgenomförandet. Det kan utifrån den uppgiftsfördelning som anges i 11 § röra sig om samarbetsområdet för väghållning eller väghållaren. I de särskilda fall som avses i 10 § 2 mom. kan det vara någon annan som ansvarar för projektet. 
40 §.Avlägsnande av anslutning. I 1 mom. ändras ordet väghållningsmyndighet till den som ansvarar för projektet. Med den som ansvarar för projektet avses den som svarar för projektgenomförandet. Det kan utifrån den uppgiftsfördelning som anges i 11 § röra sig om samarbetsområdet för väghållning eller väghållaren. I de särskilda fall som avses i 10 § 2 mom. kan det vara någon annan som ansvarar för projektet. I 2 mom. ändras ordet väghållningsmyndighet till väghållare. I paragrafens nya 3 mom. preciseras skyldigheten att också i digital form producera information om tillfälliga förbud och begränsningar.  
42 §.Arbete på vägområde samt placering av konstruktioner, anläggningar och anordningar på vägområde. I 1–4 mom. ändras ordet väghållningsmyndighet till väghållare. I 4 mom. föreslås dessutom en språklig justering. 
Till 5 mom. fogas i förslaget en hänvisning till placering av sådana anordningar eller mindre konstruktioner som behövs för insamling och utdelning av post på ett vägområde i de situationer som avses i 45 § 3 mom. i postlagen (415/2011). Det föreslås att till p 5 mom. också fogas en bestämmelse enligt vilken väghållarens tillstånd dock inte krävs för en förbindelseväg och regionväg som inte är markerad med ett vägmärke som anger förkörsrätt, om området ska användas kortvarigt och då det är fråga om att trävaror förvaras kortvarigt. Utgångspunkten är den att delar av ett vägområde dock ska användas för lagring av trävaror bara då andra förvaringssätt till exempel är oskäligt kostnadskrävande. Av trafiksäkerhetsskäl får trävaror förvaras endast utanför dikets yttre slänt. När det är fråga om kortvarig förvaring utanför dikets yttre slänt eller om lastning av trävaror och väghållarens anvisningar iakttas i samband med verksamheten, bedöms verksamheten inte förorsaka sådan fara för trafiksäkerheten eller större olägenhet för väghållningen, som i allmänhet förutsätter tillstånd för särskild användning av ett vägområde. Därför föreslås ett sådant tillägg till 42 § 5 mom. att tillstånd med vissa undantag inte krävs för lastning och förvaring av trävaror på förbindelsevägar och sådana regionvägar som inte är markerade med ett vägmärke som anger förkörsrätt. Med kortvarig förvaring avses en period på högst sex månader. För att tiden ska kunna konstateras ska trävarorna förses med kontaktuppgifter varav framgå datum för placering av trävarorna samt vem som ansvarar för trävarorna. Vid lagring och lastning av trävaror ska också i fortsättningen beaktas vägtrafiklagens bestämmelser, i synnerhet 29 § 2 mom. om trafiksäkerheten vid på- och avlastning. Ved- och virkestravar ska placeras så att de inte förorsakar fara för trafiken och så att de inte hindrar väghållning eller annan verksamhet enligt landsvägslagen på vägområdet. Vid valet av placeringsplats ska det särskilt beaktas att travarna på ett säkert sätt kan lastas på ett fordon. Väghållaren har också rätt att i enlighet med 101 § 2 mom. ingripa vid fara som utgör ett omedelbart hot för trafiken. Väghållaren kan enligt sin prövning ge anvisningar om förvaring av trävaror samt om avlastning och pålastning. Det gällande momentets bestämmelser om tillfälliga meddelanden och undantag i fråga om tillståndsplikten ska enligt förslaget sammanställas till en förteckning. 
42 a §.Placering av vissa kablar på vägområde. I 1 och 3 mom. ändras ordet väghållningsmyndighet till väghållare. I paragrafens 1 och 5 mom. föreslås dessutom språkliga justeringar. 
42 b §.Skyldighet att flytta, skydda och avlägsnakonstruktioner, anläggningar och anordningar. I 1 och 2 mom. ändras väghållningsmyndighet till väghållare liksom det senare omnämnandet av väghållningsmyndighet i 3 mom. Det första omnämnandet av väghållningsmyndighet i 3 mom. ändras till ”den som ansvarar för projektet”. Med den som ansvarar för projektet avses den som svarar för projektgenomförandet. Det kan utifrån den uppgiftsfördelning som anges i 11 § röra sig om samarbetsområdet för väghållning eller väghållaren. I de särskilda fall som avses i 10 § 2 mom. kan det vara någon annan som ansvarar för projektet. 
43 §. Korsning mellan särskild vinterväg och farled. I 1 och 2 mom. ändras ordet väghållningsmyndighet till landskapet. I paragrafens 2 mom. föreslås dessutom en språklig justering. 
4 kap.Begränsningar i markanvändningen som gäller områden utanför landsvägsområdet 
44 §.Skyddsområde för landsväg. I 2 mom. ändras ordet väghållningsmyndighet till väghållare. 
45 §.Frisiktsområde för landsväg. I 2 mom. ändras ordet väghållningsmyndighet till väghållare. Dessutom föreslås i momentet en språklig justering. 
47 §.Rätt att bevilja undantag. I 1 mom. ändras ordet väghållningsmyndighet till väghållare. Tillståndsuppgiften i fråga är i dagens läge bara delvis centraliserad. I fortsättningen ska uppgiften att bevilja undantag från förbud som avses i 44–46 § koncentreras till väghållaren, dvs. Trafikverket. 
48 §.Undantag från begränsningar. I 2 mom. ändras ordet väghållningsmyndighet till väghållare. I 1–3 mom. föreslås dessutom språkliga justeringar.  
49 §.Förfarandet vid avlägsnande av växtlighet och naturhinder. I denna paragraf ändras ordet väghållningsmyndighet till landskapet. I den första meningen ska dessutom konjunktionen ”och” ändras till ”eller”. 
51 §.Snöskärm och uppläggning av snö. I 1 och 2 mom. ändras ordet väghållningsmyndighet till landskapet. I paragrafens 1 mom. föreslås dessutom en förtydligande ändring för att klargöra att också kravet att den kommunala byggnadstillsynsmyndigheten ska bevilja tillstånd har samband med bebodda områden och gäller i det fall att en fastighetsägare eller innehavare inte ger samtycke. Enligt den ursprungliga motiveringen till landsvägslagen är avsikten att hela meningen ska gälla bebodda områden och att kommunens byggnadstillsynsmyndighet kan bevilja tillstånd om samtycke inte erhålls. Avsikten är inte att ändra rättsläget till denna del. 
52 §. Reklam och annonsering invid vägar. I 2–4 mom. ändras ordet väghållningsmyndigheten till väghållaren. Dessutom nämns nu också samarbetsområdet för väghållning och landskapet i 4 mom. bland dem som väghållaren kan begära utlåtande av. Det föreslås att sista meningen i 4 mom. stryks som obehövlig. Genom förordning av statsrådet kan det föreskrivas att någon annan statlig myndighet än närings-, trafik- och miljöcentralen är väghållningsmyndighet, om detta med tanke på väghållningen ska anses ändamålsenligt. Motsvarande möjlighet ska enligt förslaget inte kvarstå. I fortsättningen ska Trafikverket och landskapen vara de myndigheter som sköter väghållningsuppgifter.  
52 b §.Bemyndigande att meddela föreskrifter. I denna paragraf ändras ordet väghållningsmyndighet till väghållare. 
5 kap. Förvärv av områden samt ersättningar 
53 a §. Hur järnväg beaktas vid en landsvägsförrättning. Det föreslås att i paragrafens hänvisning till banlagen stryks den lagens nummer i författningssamlingen eftersom detta nämns redan i det nya 2 mom. i 32 a §.  
54 §. Inledande av landsvägsförrättning. I denna paragraf ändras ordet väghållningsmyndigheten till väghållaren. Dessutom föreslås att landskapet ska få ansöka om en landsvägsförrättning under förutsättning att väghållaren har gett sitt samtycke till detta. Väghållaren kan ge sitt samtycke exempelvis i väghållningsavtalet, om detta anses vara ändamålsenligt. 
56 §. Besittningstagande. I 1, 3 och 4 mom. ändras ordet väghållningsmyndighet till väghållaren. 
56 a §.Överlåtelse av en enskild väg. I denna paragraf ändras ordet väghållningsmyndigheten till väghållaren.  
57 §.Fastställande av föremålet för inlösning samt uppkomst av äganderätt till vägområdet. I 1 mom. ändras ordet väghållningsmyndigheten till väghållaren. I paragrafens 2 mom. föreslås en språklig justering. 
62 §.Behandling av inlösen vid två förrättningar. I 1 mom. ändras ordet väghållningsmyndigheten till väghållaren. 
69 §. Reglering av enskilda vägar. I 2 mom. ändras ordet väghållningsmyndigheten till väghållaren. 
74 §. Övriga ersättningar och landsvägsförrättning som gäller ersättningar. I den finskspråkiga paragrafens 2 mom. ändras ordet väghållningsmyndigheten till väghållaren. I den svenskspråkiga paragrafen har gjorts en förtydligande justering av ordalydelsen. 
75 §.Landsvägsförrättning i särskilda fall. I 1 och 2 mom. ändras ordet väghållningsmyndigheten till väghållaren. I 3 mom. stryks uttrycket ”gäller i tillämpliga delar”. 
79 §.Utbetalning av ersättning samt ränta. I 1 och 2 mom. ändras ordet väghållningsmyndighet till väghållare. Dessutom föreslås det att 4 mom. upphävs, eftersom det i fortsättningen är väghållaren, dvs. Trafikverket, som är ersättningsskyldig och då ska den även sköta utbetalningarna. Någon separat bestämmelse om detta behövs inte längre. Dessutom föreslås i 1 och 3 mom. språkliga justeringar. 
80 §.Deponering av ersättning som är stridig. I denna paragraf ändras ordet väghållningsmyndigheten till väghållaren. Dessutom föreslås en språklig justering. 
81 §.Tvångsverkställighet i särskilda fall. I 1 mom. ändras ordet väghållningsmyndigheten till väghållaren.  
83 §.Ringa ersättningar. I 1 mom. ändras ordet väghållningsmyndigheten till väghållaren. Dessutom förtydligas paragrafen i språkligt hänseende. 
85 §. Kostnaderna för landsvägsförrättning. I 1 mom. ändras ordet väghållningsmyndighet till väghållare. 
6 kap. Upphörande och indragning av landsväg samt indragning av biområde 
88 §.Upphörande av landsväg. I 1 mom. ändras ordet väghållningsmyndigheten till väghållaren och landskapet, medan det i 2 mom. ändras till väghållaren. I paragrafens 1 mom. föreslås dessutom ett sådant språkligt förtydligande att uttrycket ”vägrätten fortsätter att vara i kraft” ersätts med uttrycket ”vägrätten förblir i kraft”, medan ordet ”gäller” i 2 mom. ändras till ”tillämpas”. 
90 §.Konstruktioner och anordningar på ett tidigare vägområde. I 1 och 2 mom. ändras ordet väghållningsmyndigheten till ”den som ansvarar för projektet”. Med den som ansvarar för projektet avses ansvariga för projektgenomförandet. Det kan utifrån den uppgiftsfördelning som anges i 11 § röra sig om samarbetsområdet för väghållning eller väghållaren. I de särskilda fall som avses i 10 § 2 mom. kan det vara någon annan som ansvarar för projektet. I 3 mom. ändras ordet väghållningsmyndighet till väghållare. I 1 och 2 mom. stryks det obehövliga uttrycket ”från det att vägen upphört”. 
91 §.Överföring av ett tidigare vägområde. I 2 mom. ändras ordet väghållningsmyndigheten till väghållaren. I 3 mom. föreslås dessutom en språklig justering. 
93 §.Ett tidigare vägområde som enskild väg. I 3 och 4 mom. ändras ordet väghållningsmyndigheten till väghållaren. Dessutom tas i 3 mom. den tidpunkt in i lag som avses i 8 § i statsrådets förordning om landsvägar (924/2005) och som gäller upphörande av ansvaret att underhålla en tidigare landsväg. I 1 mom. stryks dessutom det onödiga uttrycket ”tills vidare”. 
95 §.Indragning av biområde. I 1 och 3 mom. ändras ordet väghållningsmyndigheten till väghållaren. 
95 a §.Indragning och överlåtelse av en del av ett vägområde. I 1 och 4 mom. ändras ordet väghållningsmyndigheten till väghållaren och i 2 mom. till landskapet eller väghållaren. 
7 kap.Särskilda bestämmelser 
99 §.Beslutsfattande. Paragrafen innehåller bestämmelser om den myndighet som godkänner utredningsplaner och vägplaner. Enligt den gällande lagen godkänner kommunikationsministeriet vägplaner som gäller indragning av en landsväg utan samtidigt byggande av en landsväg. Övriga vägplaner samt alla utredningsplaner godkänns av Trafikverket. Till kommunikationsministeriets uppgifter hör dock att svara för det allmänna utvecklandet av förvaltningsområdet och för de riktlinjer som gäller trafikpolitiken, och egentligen inte att fatta enskilda förvaltningsbeslut som berör landsvägar. I 10 § föreslås det att Trafikverket i egenskap av väghållare ska vara väghållare för landsvägarna med ansvar för landsvägsnätet. Att svara för landsvägsnätet innebär också att fatta beslut om landsvägsnätets omfattning genom att utvidga eller inskränka det. Därför föreslås det att Trafikverket som väghållare i princip ska ha behörighet att besluta om alla utredningsplaner och vägplaner. Det föreslås att Trafikverkets skyldighet ska bibehållas när det gäller överföring av ett planbeslut till kommunikationsministeriet i sådana fall då en kommun, ett landskap eller Statens tillstånds- och tillsynsmyndighet inte med Trafikverket kan enas om väsentliga punkter i planen. Med landskap avses då andra landskap än det samarbetsområde för väghållningen som utarbetat planen. Trafikverket ska dock fortsättningsvis av särskilda skäl ha möjlighet att överföra godkännandet av en plan till kommunikationsministeriet. En sådan överföring är emellertid en exceptionell åtgärd, som kommer i fråga bara när det gäller vägprojekt som är av mycket stor samhällelig betydelse. 
99 a §.Avgifter. Det föreslås att paragrafen ändras med en informativ hänvisning till lagen om grunderna för avgifter till staten (150/1992). Också paragrafens förordningsbemyndigande stryks såsom obehövligt eftersom de bemyndiganden som behövs ingår i lagen om grunderna för avgifter till staten. Hänvisningen till väghållningsmyndigheten stryks och ordet beslut med anledning av en anmälan ändras till ordet meddelande.  
99 b §.Överföring av biträdande uppgifter. Enligt 124 § i grundlagen kan offentliga förvaltningsuppgifter anförtros andra än myndigheter endast genom lag eller med stöd av lag, om det behövs för en ändamålsenlig skötsel av uppgifterna och det inte äventyrar de grundläggande fri- och rättigheterna, rättssäkerheten eller andra krav på god förvaltning. Enligt motiveringen till grundlagen ska begreppet offentliga förvaltningsuppgifter i samband med grundlagens 124 § förstås i en relativt vidsträckt bemärkelse, så att det omfattar uppgifter som till exempel hänför sig till verkställigheten av lagar samt beslutsfattande om enskilda personers och sammanslutningars rättigheter, skyldigheter och förmåner (RP1/1998 rd, s. 61 och 179).  
Myndighetsuppgifterna när det gäller väghållning har systematiskt centraliserats och kännedomen om de regionala förhållandena har i praktiken så långt som möjligt säkerställts genom att operativa terrängarabeten av teknisk natur har upphandlats. Också exempelvis företrädandet av väghållningsmyndigheten vid terränginspektioner i anslutning till tillståndsförfaranden enligt landsvägslagen upphandlas för närvarande från enskilda tjänsteproducenter. Sådana terränginspektioner kan betraktas som sådan biträdande verksamhet av teknisk natur, som inte innebär utövning av offentlig makt. Enligt en mycket extensiv tolkning av begreppet offentlig förvaltningsuppgift kan det omfatta sådana inspektioner och utredningar i terräng som myndigheten använder som beslutsunderlag. Som åtgärder i samband med beredning av förvaltningsbeslut kan de således i vissa avseenden betraktas som skötsel av offentliga förvaltningsuppgifter. Därför föreslås det att landsvägslagens reglering kompletteras genom att enligt föreslagna 99 b § ge Trafikverket möjlighet att genom avtal till en privat eller offentlig tjänsteleverantör överföra biträdande terränguppgifter i anslutning till tillstånds uppgifter som enligt denna lag hör till verket. I samband med sådana terrängtjänster produceras information och tekniskt material som myndigheten självständigt ska tolka i samband med sitt beslutsfattande. Med tanke på organiseringen av väghållningen och ett effektivt resursutnyttjande är det ändamålsenligt att skötseln av biträdande uppgifter i terräng kan överföras. De har redan nu skötts som köpta tjänster och en ändring i detta avseende skulle kräva avsevärda tilläggsresurser för tillståndsuppgifterna. 
Tillståndsuppgifterna kan utöver biträdande uppgifter i terräng förutsätta rådgivning som inte nödvändigtvis behöver tillhandahållas av den myndighet som fattar tillståndsbesluten. Med tanke på ett effektivt utnyttjande av resurserna kan det vara ändamålsenligt att genom avtal överföra också denna biträdande rådgivningsuppgift i anslutning till tillståndsförfarandet på någon annan serviceproducent. Rådgivningen ingår i myndighetens förpliktelser, men den innebär inte utövande av offentlig makt. Det finns således inget hinder för att överföra sådana uppgifter till en annan serviceproducent. Enligt den föreslagna paragrafen ska således också rådgivningsuppgifter i anslutning till tillståndsuppgifter kunna överföras. 
Paragrafen uppfyller kravet i 124 § i grundlagen (731/1999), dvs. att offentliga förvaltningsuppgifter kan anförtros andra än myndigheter endast genom lag eller med stöd av lag, om det behövs för en ändamålsenlig skötsel av uppgifterna och det inte äventyrar de grundläggande fri- och rättigheterna, rättssäkerheten eller andra krav på god förvaltning. Grundlagsutskottet har ansett att uppgiften att bistå en myndighet genom avtal kan överföras på andra än myndigheter (GrUU 11/2006 rd, s. 2). Med uttrycket offentlig serviceproducent avses till exempel ett ämbetsverk eller en inrättning. Grundlagsutskottet har konstaterat att det inte är oproblematiskt att genom avtal överföra en myndighets förvaltningsuppgifter till en annan myndighet. Enligt grundlagens 21 § har var och en rätt att få sin sak behandlad av en myndighet som är behörig enligt lag. Enligt grundlagens 2 § 3 mom. ska all utövning av offentlig makt bygga på lag. I all offentlig verksamhet ska lag noggrant iakttas. Då det är fråga om en tjänst som närmast kan jämföras med en offentlig förvaltningsuppgift har det inte funnits något hinder för överföring. (GrUU 11/2004 rd, s. 2). 
I paragrafens 2 mom. föreskrivs att tjänsteleverantören ska ha tillräckliga tekniska förutsättningar samt tillräckliga kunskaper för skötseln av de uppgifter som avses i 1 mom. Vidare föreskrivs i momentet att på de personer som sköter uppgifterna ska tillämpas bestämmelserna om straffrättsligt tjänsteansvar. I momentet hänvisas också till skadeståndslagen. I skadeståndslagens 3 kap. 2 § föreskrivs att ett offentligt samfund är skyldigt att ersätta skada som förorsakats genom fel eller försummelse vid myndighetsutövning. Samma skadeståndsskyldighet åligger andra samfund som på grund av lag, förordning eller bemyndigande i lag handhar offentliga uppgifter. Då offentliga förvaltningsuppgifter i enlighet med grundlagens 124 § genom lag eller med stöd av lag anförtros andra än myndigheter brukar man i informativt syfte hänvisa till skadeståndslagen. Dessutom ska allmänna förvaltningslagar tillämpas vid skötseln av de uppgifter som avses i bestämmelsen. 
100 §.Förberedelser för störningar och undantagsförhållanden. Det föreslås att till lagen fogas en bestämmelse om beredskap för väghållning, som ålägger väghållaren att i samarbete med landskapen inom väghållningsområdet ha beredskap för störningar i normala förhållanden och för undantagsförhållanden. Här avses beredskapsplanering och förberedelser för verksamhet vid störningar i normala förhållanden och under undantagsförhållanden. I det sammanhanget ska beaktas en landsvägs trafikmässiga betydelse och väglaget samt förväntade förändringar och övriga förhållanden. En bestämmelse om förberedelser inom ramen för samarbetet med väghållaren och väghållningsområdets landskap behövs på grund av eventuella förändringar som berör aktörerna inom väghållningen, i synnerhet för säkerställande av enhetliga förberedelser i hela landet.  
I paragrafens 2 mom. föreskrivs om Trafiksäkerhetsverkets behörighet att utfärda närmare föreskrifter om väghållarens och landskapens beredskapsplanering för att säkerställa att förberedelserna är enhetliga i hela landet och tillgodoser de behov som hänför sig till undantagsförhållanden och störningar i de normala förhållandena på landsvägarna. Bemyndigandet behövs för att precisera beredskapsskyldigheten enligt 1 mom. och för att säkerställa att Trafiksäkerhetsverket tillsynsuppgift enligt 100 b § genomförs på ett effektivt sätt.  
100 a §.Trafikverkets säkerhetsstyrningssystem för väghållningen. I denna paragraf föreslås bestämmelser om Trafikverkets säkerhetsstyrningssystem för väghållningen. Sedan länge har det förts en diskussion om att införa ett sådant system inom trafikförvaltningen, men ärendet har inte framskridit eftersom det inte haft stöd i lag. Trafikverket har redan för järnvägsverksamheten tillgång till ett säkerhetsstyrningssystem. Genomförandet av systemet övervakas av Trafiksäkerhetsverket. Utöver Trafiksäkerhetsverkets tillsyn förutsätts aktörerna inom järnvägstrafiken ha egenkontroll. 
Genom Trafikverkets säkerhetsstyrningssystem ska hanteringen av alla risker som hänför sig till väghållningen på riks- och stamvägarna samt livligt trafikerade regionvägar säkerställas. Avsikten är att på systemnivå se till att säkerhetsaspekten har tagits i beaktande inom Trafikverkets styrningssystem i fråga om vägtrafikfunktionerna och att verket handlar i enlighet med detta.  
Enligt paragrafens 2 mom. ska säkerhetsstyrningssystemet upprättas skriftligt och det ska godkännas av Trafikverkets ledning och meddelas hela personalen. Säkerhetsstyrningssystemet ska innehålla en säkerhetspolitik, kvalitativa och kvantitativa mål för upprätthållande och förbättring av säkerheten samt planer och förfaranden för uppnående av dessa mål.  
Enligt 3 mom. ska man i säkerhetsstyrningssystemet särskilt beakta ansvarsfördelningen inom organisationen, att organisationen bedriver övervakning på samtliga nivåer, att personalen deltar i beslutsfattandet om styrningssystemet samt att systemet kontinuerligt förbättras.  
Enligt bemyndigandet i 4 mom. får Trafiksäkerhetsverket utfärda närmare föreskrifter om innehållet i säkerhetsstyrningssystemet. Trafiksäkerhetsverket ska enligt 100 b § dessutom utöva tillsyn över att de krav som föreskrivs i denna paragraf uppfylls. Utöver säkerhetsstyrningssystemet är det möjligt att genom föreskrifter om de krav som ställs på väghållningen styra Trafikverkets och landskapens verksamhet när det gäller väghållningen. I enlighet med 100 b § ska Trafiksäkerhetsverket utöva tillsyn över att förpliktelserna enligt denna paragraf uppfylls. Tillsynsuppgiften omfattar också skötsel av uppgifter som gäller landsvägstunnlar samt processen för utfärdande av tekniska anvisningar gällande väghållning. 
Säkerhetsstyrningssystemets verkningar sträcker sig givetvis också till väghållningen inom landskapens väghållningsområden. Målsättningarna inom säkerhetsstyrningssystemet och de krav som ställs i samband med Trafiksäkerhetsverkets tillsyn eller i verkets föreskrifter kan komma att inverka också på målsättningarna i fråga om väghållningsavtalen. Trafikverket är inom väghållningen inte en sådan operativ aktör som inom järnvägsverksamheten. När det gäller uppnåendet av målsättningarna spelar landskapens väghållningsområden en central roll för skötseln av beställaruppgifterna och andra operativa uppgifter inom väghållningen. Dessutom kan det vara skäl att dels Trafikverket och dels landskapens väghållningsområden deltar i eventuella auditeringar. När det gäller utarbetandet av säkerhetsstyrningssystemet och tillsynen över det samt utarbetandet av föreskrifter om systemet är det således med beaktande av helheten skäl att observera att Trafikverket inte är den enda centrala aktören inom väghållningen och att operativa uppgifter sköts inom landskapens väghållningsområden. Det finns givetvis också flera andra aktörer och faktorer som påverkar trafiksäkerheten.  
100 b §.Myndighetstillsyn över väghållningen. I nya 100 b § föreskrivs om Trafiksäkerhetsverkets tillsynsuppgift med avseende på förpliktelserna enligt 13, 13 a, 33, 100 och 100 a § samt iakttagandet av bestämmelser och beslut som utfärdats med stöd av nämnda paragrafer. I fortsättningen väghållningen och de allmänna krav som ställs på den samt den säkerhetsnivå, servicenivå och underhållsnivå som uppnåtts inom väghållningen och likaså skötseln av beredskapsskyldigheten följaktligen övervakas dels genom Trafikverkets nuvarande egenkontroll och dels genom extern tillsyn. Avsikten är att Trafiksäkerhetsverket ska övervaka och bedöma uppnåendet av de mål och krav som föreskrivs i de ovan nämnda paragraferna samt de förändringar som konstateras i det sammanhanget. Trafiksäkerhetsverket ska så ändamålsenligt som möjligt sköta sin tillsynsuppgift på ett effektivt sätt och utifrån riskbedömning. 
De iakttagelser som gjorts i samband med egenkontrollen av Trafikverkets och landskapens väghållningsområden är ett viktigt utgångsmaterial för genomförandet av tillsynen och de är sin del förutsättningar för en riskbaserad tillsyn och således för identifieringen av riskfaktorer. I samband med tillsynen är det också möjligt att utnyttja till exempel riksomfattande enkäter som riktar sig till väganvändare. I samband med tillsynen är det också i övrigt möjligt att beakta kundåterkopplingen i fråga om den övervakade helheten. De metoder som ska användas vid tillsynen ska utöver kraven på riskbasering och ändamålsenlighet inte närmare definieras i paragrafen. Vid tillsynen kan man sålunda smidigt utnyttja metoder som möjliggörs av digitaliseringen, exempelvis leverans av mätnings- och bildmaterial bland annat genom förmedling av mjölk- och postbilar, machine vision -applikationer och bildtolkning samt vid behov också med mera traditionella tillsynsmetoder. 
Avsikten är således att inrikta tillsynen på uppnådda resultat och landsvägarnas tillstånd samt på användarnas synpunkter i fråga om dessa helheter, snarare än på de förfaranden och tekniska lösningar som man valt att tillämpa. De brister som eventuellt konstateras vid tillsynen ska emellertid naturligtvis få den konsekvensen att väghållaren och landskapens väghållningsområden omprövar de valda tillvägagångssätten. Med beaktande av Trafiksäkerhetsverkets verksamhetsområde och det nya säkerhetsstyrningssystemet för väghållningen är trafiksäkerheten av en central betydelse för tillsynen, men tillsynen begränsar sig inte till detta utan den omfattar i stor utsträckning också övervakning av den uppnådda kvalitetsnivån i andra avseenden. I samband med tillsynen är det också möjligt att bedöma vilka konsekvenser förändringar i finansieringsnivån får för landsvägarna och väghållningen. 
Trafiksäkerhetsverkets tillsyn inriktas i praktiken på väghållarens, dvs. Trafikverkets och väghållningsområdenas verksamhet. I fråga om Trafikverket ska tillsynen framför allt inriktas på riksomfattande verksamhet samt på beredningen och uppföljningen av väghållningsavtal. Verksamheten inom landskapens väghållningsområden ska övervakas med inriktning på skötseln av väghållningens beställaruppgifter.  
Enligt paragrafens 2 mom. kan Trafiksäkerhetsverket ge en anmärkning med anledning av brister som konstaterats vid tillsynen samt ålägga den som gjort sig skyldig till en försummelse att inom en skälig tidsfrist avhjälpa sitt fel eller sin försummelse. Beslutet kan förenas med vite eller med hot om att verksamheten helt eller delvis avbryts eller att den försummade åtgärden vidtas på den försumliges bekostnad. De nämnda tvångsmedlen kan användas då det i och för sig varit möjligt att iaktta lagen men man av någon anledning handlat på något annat sätt. Trafiksäkerhetsverket övervakar inte egentligen iakttagandet av väghållningsavtalen mellan Trafikverket och landskapens väghållningsområden, utan endast slutresultatet av väghållningen. Om väghållningsavtalet inte omfattar en nödvändig åtgärd ska detta kunna betraktas som en försummelse både när det gäller landskapen inom väghållningsområdet och Trafikverket. Om däremot någondera av dessa underlåter att iaktta avtalet i något avseende som är nödvändigt med tanke på bestämmelserna om lagens allmänna krav, servicenivån, underhållet och beredskapen, kan det i allvarliga fall bli aktuellt att förelägga vite. 
Enligt viteslagens 7 § 1 mom. får vite riktas endast mot en part som har rättslig och faktisk möjlighet att uppfylla huvudförpliktelsen. Sådana situationer där orsaken till bristerna i den nivå som uppnåtts är otillräcklig finansiering och exceptionella situationer eller förhållanden, är det viktigt att vid tillsynen identifiera och lyfta fram till exempel behovet av tilläggsfinansiering. I dessa situationer kan det emellertid inte i enlighet med den nämnda bestämmelsen i viteslagen komma i fråga att påföra Trafikverket eller landskapet vite, om det anses att dessa till följd av otillräcklig finansiering inte haft någon faktisk möjlighet att uppfylla sin förpliktelse. 
I paragrafens 3 mom. föreskrivs att Trafiksäkerhetsverket ska ha rätt att få den information som det behöver för att fullgöra sina uppgifter.  
Utöver Trafiksäkerhetsverkets tillsyn över väghållningen ska Statens tillstånds- och tillsynsmyndighet (Luova), som föreslås bli inrättad, med stöd av landskapslagen övervaka landskapen i egenskap av allmän laglighetsövervakare. Denna tillsyn är emellertid baserad endast på klagomål som gäller landskapens verksamhet och inom ramen för den är det inte möjligt att använda administrativa tvångsmedel. Trots den överlappande tillsynsbehörigheten på denna nivå är det inom den praktiska tillsynsverksamheten ändamålsenligt att sådana funktioner som med stöd av speciallagstiftning om landskapen övervakas separat inte ska övervakas inom ramen för Luovas allmänna behörighet. Luova kan sålunda med stöd av förvaltningslagens bestämmelser om klagomål hänskjuta till verket inkomna klagomål gällande trafikverksamheten till Trafiksäkerhetsverket i dess egenskap av särskild övervakare. 
101 §.Administrativa tvångsmedel. I paragrafens 1-3 mom. ändras ordet väghållningsmyndigheten till ”väghållaren och landskapet”, eftersom dessa i fortsättningen ska vara de myndigheter som svarar för väghållningen. Tillståndsuppgifterna i samband med väghållningen ska i fortsättningen skötas genom väghållarens (Trafikverkets) försorg, vilket innebär att det är ändamålsenligt att väghållaren får den behörighet som avses i denna paragraf. Inom ramen för väghållningsområdena ska landskapet i fortsättningen vara den regionala myndighet som sköter väghållningsuppgifterna. I 3 mom. nämns handräckning från polisen, vilket nu kompletteras med en hänvisning till polislagen. 
102 §. Indrivning av kostnader. I 1 mom. ändras ordet väghållningsmyndighet till ”samarbetsområdet för väghållning eller väghållaren”. 
103 §.Delgivning och delfående av beslut. I 1 mom. ändras ordet Trafikverket till väghållare och väghållningsmyndighet till samarbetsområdet för väghållning. Dessutom föreslås det att 1 mom. ändras så att det inte är kommunen som i enlighet med kommunallagen ska se till att handlingarna är framlagda, utan i stället ska samarbetsområdet för väghållning underrätta om att handlingarna är framlagda i enlighet med 95 § i den föreslagna landskapslagen. Beslutet och handlingarna ska vara offentligt framlagda i de landskap som hör till samarbetsområdet i stället för i kommunen. Dessutom korrigeras skrivsättet för ordparet utredningsplan och vägplan i 1 mom. i den finska versionen. 
104 §.Meddelande om beslut till dem som gjort en anmärkning och till myndigheterna. I 1 mom. ändras ordet väghållningsmyndighet till väghållare. Dessutom ändras Trafikverket i 2 mom. till väghållare samt närings-, trafik och miljöcentralen och landskapsförbundet till landskapet och Statens tillstånds- och tillsynsmyndighet. Dessutom korrigeras skrivsättet för ordparet utredningsplan och vägplan i 1 och 2 mom. i den finska versionen. 
105 §.Ändringssökande. I 4 mom. ändras ordet väghållningsmyndighet till väghållare. Dessutom får paragrafen ett nytt 3 mom. enligt vilket bestämmelser om sökande av ändring i landskapens beslut finns i 18 kap. i landskapslagen. Vidare ändras närings-, trafik och miljöcentralen och landskapsförbundet i det gällande 5 mom. till landskapet och Statens tillstånds- och tillsynsmyndighet. Dessutom föreslås att i 1 mom. stryks det onödiga omnämnandet av Trafiksäkerhetsverket, eftersom det följer direkt av förvaltningslagen att en skriftlig begäran om omprövning ska riktas till den myndighet som fattat beslutet eller till någon annan som sköter en offentlig förvaltningsuppgift och som fattat beslutet. Och skrivsättet för ordparet utredningsplan och vägplan korrigeras i 6–8 mom. i den finska versionen. 
Ovan föreslås att statsrådet ska bemyndigas att besluta om väghållningsområden och väghållningsavtal, i sådana fall då avtal annars inte fås till stånd eller då avtalen inte uppfyller lagens krav. Också dessa statsrådsbeslut är normalt överklagbara så som föreskrivs i denna paragrafs 1 mom.  
107 §.Omedelbar verkställighet av beslut. Det föreslås också ett nytt 1 mom. Enligt det ska ett beslut av statsrådet trots ändringssökande iakttas tills avgörandet i ärendet har vunnit laga kraft. Ovan föreslås en bestämmelse om statsrådets behörighet att fatta beslut om väghållningsområden och väghållningsavtal, om avtal annars inte fås till stånd eller om avtalen inte uppfyller lagens krav. Också dessa statsrådsbeslut är normalt överklagbara såsom föreskrivs i denna paragrafs 1 mom. För tryggande av kontinuiteten i väghållningen och för undvikande av ett avtalslöst tillstånd ska statsrådets beslut dock kunna iakttas trots ändringssökande till dess att avgörandet i ärendet har vunnit laga kraft. 
I det gällande 1 mom. ändras ordet väghållningsmyndighet till väghållare. Dessutom korrigeras skrivsättet för ordparet utredningsplan och vägplan i den finska versionen. De nuvarande 1 och 2 mom. blir enligt förslaget 2 och 3 mom. 
108 §.Kungörelse. Justitieministeriet bereder en proposition varmed den föråldrade lagen om offentliga kungörelser upphävs och till förvaltningslagen fogas en allmän bestämmelse om offentlig kungörelse. Kungörelser publiceras på myndighetens webbsidor. Vid behov ska en kungörelse också offentliggöras i en tidning med allmän spridning inom verksamhetsrådet eller på något annat sätt som myndigheten bestämmer.  
Det föreslås att på sådana kungörelser som avses i denna paragraf ska tillämpas förfarandet enligt förvaltningslagens 62 a § om offentliga kungörelser. Samtidigt stryks den bestämmelse som överlappar förvaltningslagens 62 a §. Den gällande kungörelsetiden på 30 dagar föreslås inte bli ändrad. Dessutom föreslås att ordet väghållningsmyndigheten ersätts med uttrycket den behöriga myndigheten. 
Enligt grundlagens 20 § 2 mom. ska det allmänna verka för att alla tillförsäkras en sund miljö och att var och en har möjlighet att påverka beslut i frågor som gäller den egna livsmiljön. Att information om ett ärende ges endast via det allmänna datanätet räcker från grundlagens synpunkt inte alltid för att säkerställa sådana personers tillgång till information och påverkansmöjligheter som inte har tillgång till dator och internetförbindelse. Enligt motiveringen till förvaltningslagens nya 62 a § kan ett behov att offentliggöra ett meddelande i en dagstidning eller på något annat sätt som myndigheten bestämt bero bland annat på att det enligt myndighetens prövning föreligger ett mera omfattande informationsbehov. Enligt motiveringen ska myndigheten när den väljer kungörelsesätt beakta informationsbehovet och kundorienteringen. Kungörelsens omfattning blir beroende av myndighetens prövning.  
108 a §.Landsvägsregister. Det föreslås att i lagen tas in en ny 108 a § till vilken från landsvägsförordningen överförs bestämmelsen om skyldigheten att registrera landsvägar. Det är skäl att en sådan grundläggande bestämmelse om en myndighets skyldighet utfärdas på lagnivå. Avsikten är inte att förändra rättsläget i detta avseende. 
109 a §.Dispens. I landsvägslagens gällande 42 § 7 mom., 42 a § 4 mom., 42 b § 4 mom. och 52 b § föreskrivs om Trafikverkets bemyndigande att utfärda föreskrifter.  
I synnerhet tekniska föreskrifter är ofta detaljerade till sin karaktär. Det går inte att förutse och beakta alla förhållanden som kan uppkomma i praktiken. Redan nu har man identifierat situationer där man behöver eller till och med måste avvika från Trafikverkets föreskrifter. Behovet att avvika från föreskrifter är ofta kopplat till lokala förhållanden såsom markbeskaffenhet, som innebär att åtgärden i praktiken blir omöjlig eller åtminstone oskäligt dyr om man följer föreskrifterna. Därför föreslås lagen få en ny 109 a § som ger Trafikverket rätt att på ansökan av särskilda skäl bevilja någon tillstånd att avvika från föreskrifterna. När behörigheten att meddela föreskrifter utvidgas behöver det finnas en möjlighet till undantag i enskilda fall, i synnerhet för oförutsedda situationer. 
Enligt 1 mom. ska det finnas särskilda skäl för att tillstånd till undantag ska beviljas. Lagen anger inte i vilka fall särskilda skäl föreligger, utan i stället prövas detta från fall till fall. Bedömningen ska vara objektiv. 
Dessutom innehåller 1 mom. bestämmelser om villkoren för undantag. Ett beviljat tillstånd får dock under inga omständigheter äventyra trafiksäkerheten eller vägens trafikmässiga eller tekniska funktion. Beslut om tillstånd till undantag hänger dels samman med en rättslig prövning, dels också med en ändamålsenlighetsprövning, som emellertid begränsas av allmänna förvaltningsrättsliga principer. Tillstånd ska sökas innan åtgärder vidtas, och den sökande måste invänta ett beslut om undantag innan den genomför undantagsåtgärden. 
Enligt det föreslagna 2 mom. ska den som ansöker om tillstånd till undantag lägga fram en redogörelse för de risker som avvikandet medför och för metoderna för att hantera dessa. Tillstånden i fråga är av sådan natur att de kan behöva innefatta villkor och begränsningar för att säkerställa trafiksäkerheten och vägens trafikmässiga eller tekniska funktion. Därför föreslås det att Trafikverket får rätt att förena beslutet med behövliga villkor i syfte att säkerställa dessa saker. Tillstånd ska inte få beviljas om undantaget har någon av de nämnda negativa effekterna och denna inte går att förhindra genom tillståndsvillkor och riskhanteringsåtgärder enligt villkoren.  
1.2
Lagen om Trafikverket 862/2009
2 §.Uppgifter. Det föreslås att paragrafens 1 mom. 4–6 punkten ändras i överensstämmelse med Trafikverkets ansvarsförhållanden som ändras i och med landskapsreformen. I momentets 4 punkt stryks Trafikverkets styrningsuppgift i fråga om NTM-centralerna. I punkten konstateras det att Trafikverkets uppgift är att svara för styrningen av väghållningen samt för samarbetet och avtalsarrangemang med landskapen. I momentets 5 punkt föreslås ett tillägg enligt vilket Trafikverket ska svara för den särskilda finansieringen av trafik- och transporttjänster i skärgården, inom ramen för statsbudgeten. Enligt 6 punkten ska Trafikverket svara för samarbetet i fråga om trafikuppgifter och för avtalsarrangemang med landskapen. I momentets 7 punkt läggs till deltagande i förberedningen av trafiksystemsplanen och främjandet av samordningen av trafik och markanvändning. 
1.3
Lagen om Trafiksäkerhetsverket 863/2009
2 §.Uppgifter. Ändringarna i paragrafens 1 mom. 5 punkt har samband med bestämmelserna i 1 a kap. i förslaget till ändring av landsvägslagen (503/2005), i synnerhet 15 d § om Trafiksäkerhetsverkets uppgifter. Det föreslås att verket ska delta i den strategiska och funktionella beredningen av en riksomfattande trafiksystemplan samt i upprättandet av trafiksystemplaner på landskapsnivå i samråd med landskapen och övriga aktörer. Verket ska biträda kommunikationsministeriet vid samordningen av målsättningarna för de riksomfattande och på landskapsnivå upprättade trafiksystemplanerna. Verket har också i uppgift att övervaka att reglerna och föreskrifterna om trafiksystemet iakttas. Övervakningen sker genom myndighetstillsyn och rapportering samt genom beviljande av tillstånd och intyg.  
I paragrafens andra moment görs inte ändringar i denna proposition. 
1.4
Lagen om flyttning av fordon
4 §. Skyldigheten att flytta fordon från olycksplatser. Det föreslås att ordet väghållningsmyndighet i denna paragrafs 2 mom. ändras till ”landsvägens väghållare” och ”kommunen”. Genom denna skrivning förtydligas de myndigheters behörighet som avses i paragrafen. 
5 §. Flyttning med stöd av parkeringsbestämmelser. Det föreslås att ordet väghållningsmyndighet i paragrafens 1 och 4 mom. ändras till ”landsvägens väghållare” och ”kommunen”. Genom denna skrivning förtydligas de myndigheters behörighet som avses i paragrafen.  
6 §.Flyttning på grund av arbete som utförs eller evenemang som ordnas inom vägområdet. I paragrafens 1 mom. ändras ordet väghållningsmyndighet till väghållare.  
7 §. Flyttning av ett övergivet fordon. I denna paragraf ändras ordet väghållningsmyndighet till landsvägens väghållare. 
9 §. Meddelande om flyttning av fordon och flyttningsbeslut. Justitieministeriet bereder en proposition med förslag till upphävande av den föråldrade lagen om offentliga kungörelser. Det föreslås att en allmän bestämmelse om offentliga kungörelser fogas till förvaltningslagen (propositionsutkastet är på remiss till den 9 mars 2018). I denna paragraf stryks hänvisningen till kungörelselagen som ska upphävas. Att ägaren till ett fordon och ägarens adress inte är känd motsvarar den situationen att offentlig delgivning används i enlighet med förvaltningslagens 55 § 1 mom. och därför kan i en sådan situation tillämpas det offentliga delgivningsförfarandet enligt förvaltningslagens 62 §. I den nämnda propositionen föreslås det att i förvaltningslagens 62 § tas in bestämmelser som i sak motsvarar kommunallagens 140 § 1 mom. om offentlig delgivning i det allmänna datanätet.  
14 §.Verkställighet och närmare bestämmelser. Det föreslås att i paragrafens 2 mom. i stället för NTM-centralen nämns Trafikverket och landskap.  
1.5
Luftfartlagen 864/2014
76 §.Användning av flygplatser och andra områden. Det föreslås att i paragrafens 4 mom. nämns landskapet i stället för NTM-centralen. Trafiksäkerhetsverket ska höra landskapet om skälet till ett förbud eller begränsning är något annat än flygsäkerhet eller att trafiken ska kunna löpa smidigt. Momentet ska tillämpas på NTM-centralerna till dess att lagen om närings-, trafik- och miljöcentralerna är upphävd. 
I paragrafens 5 moment stiftas om stöd som delas av landskapen. Enligt momentet ska landskapen ha en möjlighet att rikta stödet till trafikflygplatser eller flygplatser som är belägna utanför statens flygplatsnätbolag (Finavia Oyj). Stödet skulle gälla byggandet, verksamhet och upprätthållandet av flygplatserna. När landskapslagen träder i kraft kommer denna uppgift att överföras från staten (kommunikationsministeriet) till landskapen och anslaget förändras till allmänna medel för landskapen. Förbruket av medlen skulle överföras till landskapen. Nuförtiden har anslaget varit 1 miljon euro per år. När man överväger stödet ska man lägga märke till att man tillämpar Europeiska unionens riktlinjer för statligt stöd till flygplatser och flygbolag (2014/C 99/03) samt enligt EU kommissionens för-ordning (EU) nr 651/2014 av den 17 juni 2014 genom vilken vissa kategorier av stöd förklaras för-enliga med den inre marknaden enligt artiklarna 107 och 108 i fördraget och dess förändringar. I riktlinjerna motiverar man att genom att bevilja investeringsstöd åt flygplatser främjar man nåendet av mål som har allmän nytta ifall stödet främjar medborgarnas fria rörligheten i unionen och regionala förbindelser genom att skapa förutsättningar för flyg inom EU eller hjälper att avvärja rusning i unionens centrala flygplatser eller främjar regional utveckling. Genom stödåtgärderna bör man åstadkomma en betydande förbättring som inte kan nås enligt marknadens egna åtgärder. Speciellt kan mindre flygplatser (årliga mängden passagerare högst 200 000) vara i behov av offentligt stöd för deras investeringar och verksamhet. 
I paragrafens 5 moment stiftas även om bedömningen av understödsanslagets tillräcklighet. I be-dömningen ska utföras enligt landskapens fullmäktigeperioder. I bedömningen ska granskas trafikflygplatsers och flygplatsers behov av statsunderstöd, verkningarna som bidraget har åstadkommit, den uppskattade utvecklingen samt förhållandet till utvecklingen av den offentliga ekonomin. 
80 §.Hörande i samband med behandlingen av ärenden som gäller byggnadstillstånd. Det föreslås att ordet landskap nämns i paragrafens 1 mom. i stället för NTM-centralen. Till momenten fogas ett omnämnande om Statens tillstånds- och tillsynsmyndighet.  
1.6
Gruvlagen 621/2011
9 §.Tillståndsplikt för malmletning. Hänvisningen till landsvägslagen i paragrafens 4 mom. föreslås i överensstämmelse med den lagens nya rubrik bli ändrad till lagen om trafiksystem och landsvägar. 
1.7
Fastighetsregisterlagen 392/1985
2 §. Hänvisningen till landsvägslagen i paragrafens 2 mom. föreslås i överensstämmelse med den lagens nya rubrik bli ändrad till lagen om trafiksystem och landsvägar. 
1.8
Lagen om transportservice 320/2017
AVDELNING III TJÄNSTER 
3 kap.Upphandlingsförfarandet och beviljande av ensamrätt 
11 §. Allmän trafikplikt inom luftfarten. I artikel 16 i EU:s flygtrafikförordning 1008/2008 föreskrivs om allmän trafikplikt inom luftfarten. En nationell bestämmelse som kompletterar förordningen har hittills ingått i luftfartslagens 65 §. Eftersom det är fråga om en bestämmelse om tillträde till marknaden föreslås det i detta sammanhang att bestämmelsen överförs från luftfartslagen till lagen om transportservice. I enlighet med riktlinjerna för landskapsreformen föreslås det att besluten om allmän trafikplikt överförs från Trafikverket till landskapen. Landskapen ska också ordna offerttävlingar för rutter som omfattas av allmän trafikplikt och för vilka ett flygbolag utifrån en offerttävling ska väljas att bedriva trafik med ensamrätt. Landskapet ska dock höra och inhämta utlåtanden från Trafikverket och Trafiksäkerhetsverket innan allmän trafikplikt införs. Trafikverkets uppgift är att följa upp efterfrågan och utbudet på mobilitetstjänster och samordna utvecklingen av tjänsterna. Trafiksäkerhetsverket sköter uppgifter som hänger samman med flygoperatörerna.  
Köp av flygtrafik finansieras med anslag under Trafikverkets moment. Verket ska ingå ett avtal om inriktning av anslaget med landskap som infört allmän trafikplikt. På avtalsarrangemang som ingåtts före landskapslagens ikraftträdande tillämpas övergångsbestämmelser som innebär att avtal övergår på landskapens ansvar om de inte säger upp avtalen.  
4 kap.:Offentligt stöd för trafiktjänster 
Ändringsförslaget gällande 4 kap. i avdelning III avser korrigering av en felaktig formulering.  
1 §.Statsfinansieringens användningsändamål. Det föreslås att ordet landskap fogas till förteckningen i paragrafens 1 mom. 3 punkten. Dessutom föreslås i punkten en ändring som gör att den stämmer överens med formuleringen i den gällande lagen om kollektivtrafik samt ett tillägg enligt vilket andra än trafikidkare har rätt att få stöd för utveckling, planering och forskning som gäller trafiktjänster. Avsikten var att lagen om transportservice i det första skedet ska ändras endast i fråga om formuleringen av bestämmelserna, men med oförändrat innehåll. I det sammanhanget skedde emellertid ett sådant fel att företag, dvs. andra än trafikidkare, inte nämndes som mottagare av ersättningar för utvecklings-, planerings- och forskningsarbete. Avsikten var att ersättningar också i fortsättningen med stöd av denna bestämmelse skulle betalas till alla andra aktörer än trafikidkare.  
I fortsättningen ska till den kategori som eventuellt kan få ersättningar räknas också landskapen, eftersom de jämställs med kommuner, samkommuner och allmännyttiga sammanslutningar, och kan driva projekt som finansieringen lämpar sig för.  
De anslag i statsbudgeten som anvisats för köp och utveckling av tjänster enligt denna lag ska också kunna användas för att finansiera Kvarkentrafiken. 
AVDELNING IV MYNDIGHETER OCH TILLSYN 
1 kap.:Myndigheternas verksamhet 
4 §.Behöriga vägtrafikmyndigheter enligt trafikavtalsförordningen. Det föreslås att 1 mom. ändras så att uttrycket behöriga närings-, trafik- och miljöcentraler ersätts med ordet landskap. Genom den ändringen genomförs 2 kap. 6 § 2 mom. 1 punkten i landskapslagen, där det föreskrivs att landskapet kan sköta planering och ordnande av offentlig trafik. Det är fråga om en frivillig uppgift, inte en lagstadgad. I momentet föreskrivs vidare att landskapen kan bedriva samarbete över landskapsgränserna när de ordnar offentlig persontrafik.  
5 §.Behöriga vägtrafikmyndigheter enligt trafikavtalsförordningen. Det föreslås att till paragrafens 1 mom. fogas ett omnämnande om att landskapen är behöriga myndigheter i fråga om järnvägstrafik. Detta tillägg motsvarar den ändrade ordalydelsen i landskapslagens 6 § 2 mom. Avsikten är att landskapen ska vara behöriga också i fråga om järnvägstrafiken medan kommunikationsministeriet fortfarande ska svara för fjärrtrafiken. Dessutom föreslås en sådan ändring i paragrafens 1 mom. att också landskapet ska kunna vara behörig myndighet i fråga om annan spårtrafik än järnvägstrafik (spårvagnar och metro). För närvarande finns spårbunden stadstrafik (metro och spårvagn) ännu endast i huvudstadsregionen. 
1.9
1.9 Markanvändnings- och bygglagen 132/1999
93 §. Överföring av ett vägområde för en landsväg till kommunen. Det föreslås att paragrafens hänvisning till landsvägslagen i överensstämmelse med den lagens nya rubrik ändras så att den avser lagen om trafiksystem och landsvägar. 
1.10
Sjölagen 674/1994
12 kap.Begränsningsfond och begränsningsmål 
3 §.Ansökan om upprättande av en fond och därtill ansluten utredning. Enligt paragrafens 1 mom. ska uttrycket länsstyrelsen på domstolsorten ändras till Statens tillstånds- och tillsynsmyndighet och till momentet fogas ett omnämnande om att i fråga om landskapet Åland ska penningbelopp deponeras eller säkerställas hos Statens ämbetsverk på Åland. 
1.11
Miljöskyddslagen för sjöfarten 1672/2009
9 kap.Avlämning av avfall i hamn 
4 §.Godkännande av avfallshanteringsplanen. Omnämnandet av närings-, trafik- och miljöcentralen och landskapsförbundet i gällande 1 och 4 mom. ändras till landskapet och Statens tillstånds- och tillsynsmyndighet.  
5 §.Tillfälle att bli hörd och informering om en hamns avfallshanteringsplan. Omnämnandet av närings-, trafik- och miljöcentralen och landskapsförbundet i gällande 1 och 2 mom. ändras till landskapet och Statens tillstånds- och tillsynsmyndighet. 
7 §.Rapportering. Omnämnandet av närings-, trafik- och miljöcentralen ändras till Statens tillstånds- och tillsynsmyndighet. 
12 kap. Tillsyn och administrativt tvång 
1 §.Tillsynsmyndigheter. Omnämnandet av närings-, trafik- och miljöcentralen i paragrafens 1 mom. ändras till Statens tillstånds- och tillsynsmyndighet.  
4 §.Närings-, trafik- och miljöcentralernas tillsynsuppgifter. Omnämnandet av närings-, trafik- och miljöcentralerna i rubriken och i paragrafens 1 mom. ändras till Statens tillstånds- och tillsynsmyndighet.  
9 §.Handräckning. Omnämnandet av regionförvaltningsverket i paragrafens 1 mom. ersätts med Statens tillstånds- och tillsynsmyndighet .  
15 §.Administrativt tvång. Omnämnandet av närings-, trafik- och miljöcentralerna ändras till Statens tillstånds- och tillsynsmyndighet.  
16 §.Vite, hot om tvångsutförande och hot om avbrytande. Omnämnandet av närings-, trafik- och miljöcentralerna ändras till Statens tillstånds- och tillsynsmyndighet.  
18 §.Närmare bestämmelser. Omnämnandet av närings-, trafik- och miljöcentralerna ändras till Statens tillstånds- och tillsynsmyndighet.  
1.12
Postlagen 415/2011
45 §. Placering av anordningar och konstruktioner som behövs för postutdelning. Det föreslås att hänvisningen till landsvägslagen i paragrafens 3 mom. ändras i överensstämmelse med den lagens nya rubrik så att den avser lagen om trafiksystem och landsvägar. 
1.13
Banlagen 110/2007
3 §. Definitioner. Det föreslås att hänvisningen till landsvägslagen i paragrafens 1 mom. 11 punkten i överensstämmelse med den lagens nya rubrik ändras så att den avser lagen om trafiksystem och landsvägar. 
4 §.Klassificering av järnvägar. I paragrafen föreskrivs om klassificering av järnvägar och i synnerhet om stornätet för järnvägar. Stomnätet för järnvägar består enligt 1 mom. av banor för snabb persontrafik och tung godstrafik vilka är att nationell betydelse och dessutom betjänar långväga trafik mellan landskapen. Stomnätet ska erbjuda möjlighet till både snabb persontrafik och effektiv godstrafik. Detta kan anses vara den grundläggande bestämmelsen om stomnätets servicenivå. Det övriga bannätet består enligt 2 mom. av banor för person- och godstrafik, vilka kompletterar stomnätet.  
I paragrafens 3 mom. föreskrivs om beslutsfattande som avser stomnätet. Det föreslås att momentet ändras genom att beslutsfattandet formellt förtydligas så att genom förordning av kommunikationsministeriet föreskrivs vilka banor som hör till stomnätet för järnvägar. Den nuvarande ordalydelsen i paragrafens 3 mom. motsvarar inte den gällande grundlagens krav och har varit otydlig när det är frågan om huruvida kommunikationsministeriets behörighet avser utfärdande av normbeslut eller förvaltningsbeslut. Hittills har det inte getts något beslut om definition av stomnätet för järnvägar.  
Kommunikationsministeriets beslut skulle vara en förvaltningsintern föreskrift som gäller endast det egna förvaltningsområdet. Med anledning av den gällande grundlagen rekommenderas det att man förhåller sig reserverat till sådana föreskrifter, om deras verkningar går längre än så. Materiella rättsbestämmelser ska numera alltid ingå i en lag eller förordning. Eftersom definitionen av begreppet stomnät avser en fråga vars betydelse sträcker sig till och varmed man också uttryckligen försöker påverka bland annat näringslivets konkurrenskraft och områdesanvändning, är det således skäl att i stället för en administrativ föreskrift utfärda en rättslig bestämmelse om saken.  
Genom förordning av kommunikationsministeriet kan dessutom utfärdas närmare bestämmelser om stomnätets servicenivå i fråga om förmedlingskapacitet, funktion, hastighet och axellaster samt andra faktorer som påverkar servicenivån. Med stöd av detta bemyndigande kan genom förordning utfärdas kompletterande bestämmelser om de utgångspunkter för stomnätets servicenivå som ställs upp i 1 mom. Bannätets servicenivå granskas utgående från dess trafikprofil (godstrafik och persontrafik). När det gäller att bestämma bannätets servicenivå har synpunkter på bandelarnas förmedlingskapacitet och järnvägstrafikens funktion en central betydelse. Också den hastighet och de axellaster som banan möjliggör är viktiga faktorer när det gäller servicenivån.  
Utöver den klassificering som anges i landsvägslagen gäller för landsvägarna också den klas-sificering som ingår i den s.k. TEN-T-förordningen (Europaparlamentets och rådets förordning (EU) nr 1315/2013 av den 11 december 2013 om unionens riktlinjer för utbyggnad av det transeuropeiska transportnätet och om upphävande av beslut nr 661/2010/EU), vilket innebär att vissa landsvägar också ingår i stomnätet enligt bilaga I till förordningen. Åtminstone de järnvägar som hör till TEN-stomnätet ska till följd av stomnätets serviceändamål höra också till stomnätet enligt definitionen i 3 mom. I förordningen där stomnäten definieras ska också i övrigt beaktas TEN-T-förordningen och de krav som ställs på järnvägar som hör till TEN-nätet. 
5 §.Allmänna krav på banhållningen. I denna paragraf sammanslås gällande 5 § om utveckling och underhåll av bannätet samt 6 § om byggande av järnväg. Dessutom föreslås att i paragrafen nämns vissa nya krav och att Trafiksäkerhetsverket bemyndigas att utfärda närmare föreskrifter för att trygga de krav som bemyndigandet att utfärda föreskrifter innebär.  
Samtidigt ändras paragrafens rubrik för att bättre motsvara det nya innehållet, och kraven kompletteras i vissa avseenden. Med banhållning avses enligt banlagens 3 § 7 punkten planering, förvärv, byggande, förvaltning och underhållande av järnväg och fast egendom som hänför sig till den samt förbättring av en befintlig järnväg. De föreslagna ändringarna motsvarar långt de ändringar som föreslås i landsvägslagens 13 §.  
I paragrafens 1 mom. sammanställs kraven i fråga om främjande av de centrala målsättningarna för utveckling och underhåll av bannätet, vilka styr också investeringarna i bannätet. Det är meningen att förtydliga målsättningarna för banhållningen samt att understryka vikten av att de beaktas vid tillämpningen av denna lag. Som ett nytt krav nämns i 1 punkten förpliktelsen att främja målsättningarna för den riksomfattande trafiksystemplaneringen. I 1a kap. i den föreslagna lagen om trafiksystem och landsvägar föreskrivs om den riksomfattande trafiksystemplaneringen. Också för närvarande förutsätts exempelvis i 5 § 2 mom. att trafiksystemet ska beaktas som en helhet. I fortsättningen ska den helhet som trafiksystemet utgör behandlas i den nämnda riksomfattande planen och därför ska bestämmelserna om beaktande av trafiksystemet som en helhet sammankopplas med främjandet av den riksomfattande trafiksystemplanen. 
Enligt 2 punkten ska vidare främjas uppnåendet av de riksomfattande målsättningarna för områdesanvändningen och utvecklingen av områdena samt i samband med planeringen av markanvändningen målsättningarna för samhällsstrukturen och miljön. De riksomfattande målsättningarna för områdesanvändningen utgör en del av det planeringssystem för områdesanvändningen som avses i markanvändnings- och bygglagen och syftet med dem är att säkerställa att frågor som har en riksomfattande betydelse beaktas i landskapens och kommunernas planläggning och i de statliga myndigheternas verksamhet. Till områdesutvecklingen hör bland annat regionutvecklingsbeslutet och de mål som ställs upp i det. Bestämmelser om regionutvecklingsbeslutet kommer att finnas i en lag om regionutveckling och tillväxttjänster som ingår i en proposition som arbets- och näringsministeriet bereder. Vid banhållningen ska en hållbar markanvändning och samhällsstruktur främjas med beaktande av miljön. Vidare ska bannätet utvecklas så att förutsättningarna för en planerad utveckling av områdes- och samhällsstrukturen bevaras med beaktande av klimatmålen och den ekonomiska effektiviteten. Omnämnandet att kravet på beaktande av en ekonomisk områdes- och samhällsstruktur innebär att bannätet och enskilda järnvägar ska planeras och byggas så att förutsättningarna för en planerad utveckling av områdes- och samhällsstrukturen bevaras, med beaktande av den samhällsekonomiska effektiviteten.  
Det föreslås att till momentets 3 punkt fogas skyldigheten att minska trafikutsläppen. Järnvägstrafiken är en viktig del av resekedjorna och också själva bannätet har betydelse för uppkomsten av trafikutsläpp och inverkar bland annat på valet av färdsätt. Bannätet betjänar för sin del det trafikbehov som orsakas av olika funktioner, och dess omfattning, egenskaper och tillgänglighet har betydelse för lokaliseringen av funktionerna och sålunda också för valet av färdsätt, efterfrågan på trafik och trafikprestationerna i fråga om olika trafikformer. I synnerhet på förbindelsesträckor där efterfrågan är störst är det skäl att göra järnvägstrafiken till ett attraktivt alternativ till personbilstrafik. Järnvägarnas andel av persontrafiken är för närvarande cirka 5 %. Järnvägarnas marknadsandel av godstrafiken är cirka 25 % av alla transporter. 
Enligt det nya krav som föreslås i momentets 4 punkt ska möjligheterna att utnyttja data och digitalisering, automatisering av trafiken och förutsättningarna för utveckling av trafiktjänsterna främjas. Nya digitala lösningar kan också sänka kostnaderna för infrastruktur och förbättra spårtrafikens konkurrenskraft. Data är en grundläggande förutsättning för digitalisering. Data är råmaterial för nya digitala tjänster. Omfattande data och förbindelser för dataöverföring samt byggande av förbindelser är en viktig förutsättning för utvecklingen av digitala trafiktjänster samt också för annan digitalisering och automatisering. Banhållningen har betydelse för frågan om möjligheterna till automatisering kan utnyttjas. Automatiseringen av järnvägstrafiken kan i anslutning till underhållet av bannätet inriktas bland annat på optimeringsmöjligheterna i anslutning till styrningen av järnvägstrafiken samt infrastrukturen.  
I paragrafens 2 mom. sammanställs de centrala krav som gäller banhållning. Kraven gäller de för banhållningen ansvariga aktörernas verksamhet i samband med alla funktioner inom banhållningen. Momentets krav är förpliktande men de ska tolkas med beaktande av den järnvägs trafikmässiga betydelse som det är fråga om i det enskilda fallet. 
Till momentets 1 punkt överförs enligt förslaget de krav som nämns i gällande 5 § 1 mom. första meningen och 6 § 4 mom. Enligt punkten ska bannätet erbjuda förbindelser för trygg och fungerande trafik och transporter mellan olika regioner i landet, med beaktande av tillgängliga förbindelser, olika befolkningsgruppers trafikbehov och olika näringsgrenars transportbehov. Fungerande järnvägstrafik, förbindelser och övrig trafik främjar näringslivets konkurrenskraft, medborgarnas mobilitet och områdesutvecklingen. Tillgängligheten är viktig framför allt vid trafikknutpunkter och perronger. Man ska enkelt och säkert kunna flytta från ett trafikmedel till ett annat.  
I 2 punkten föreskrivs som ett nytt krav att bannätet ska skapa förutsättningar för utveckling av en miljö med många aktörer så att de som bedriver järnvägstrafik har likvärdiga förutsättningar att tillhandahålla tjänster på bannätet. Järnvägstrafiken öppnas stegvis för konkurrens. Kommunikationsministeriet har beviljat fyra järnvägsföretag koncession för järnvägstrafik. VR-Group Ab har koncession för person- och godstransporter på hela bannätet, Fenniarail Oy har koncession för godstransporter på hela bannätet, Ratarahti Oy har koncession för lokala godstransporter och Aurora Drive Oy har koncession för växelarbete på bangårdar inom Finlands bannät. Kategorin idkande av järnvägstrafik omfattar utöver järnvägsföretagen också underhållsföretag inom banhållningen samt idkare av museitrafik.  
EU:s fjärde järnvägspaket förutsätter att utöver godstrafiken och den internationella persontrafiken inom EU också den inhemska persontrafiken ska öppnas för konkurrens så att öppet tillträde till marknaden för persontrafik tryggas från och med den 3 december 2019. Kommunikationsminister Anne Berner offentliggjorde den 9 augusti 2017 en plan för hur den inhemska persontrafiken ska öppnas för konkurrens och för hur persontrafikarrangemangen enligt de regionala koncessionsavtalen ska konkurrensutsättas. Då de järnvägsföretag som bedriver järnvägstrafik blir flera och målet är att i framtiden öka järnvägstrafikens färdsättsandel och trafikmängder, förutsätter detta att man satsar också på bannätet och dess kapacitet. 
Till momentets 3 punkt ska enligt förslaget överföras de krav som nämns i gällande 5 § 1 mom. andra meningen, dvs. att de olägenheter som bannätet och järnvägstrafiken förorsakar miljön blir så små som möjligt och att naturresurserna används sparsamt. I banhållningen ska göras val som är ansvarsfulla från miljöns synpunkt.  
Till 4 punkten överförs det för närvarande i 6 § 3 mom. ingående kravet gällande byggande av järnväg enligt vilket banhållningen inte får leda till att någon tillfogas större skada eller olägenhet än nödvändigt. Bestämmelsen ger uttryck för principen om minimering av olägenheterna i förhållande till behovet (det allmänna behovet), dvs. den avvägning mellan skadliga konsekvenser och samhällsekonomisk effektivitet som krävs i samband med banprojekt. Järnvägar och banhållning förorsakar till exempel bullerolägenheter i närområdena.  
I 5 punkten föreskrivs att järnvägarna trafikmässigt och teknisk ska vara så funktionella som möjligt och från järnvägstrafikens och den övriga trafikens synpunkt så säkra som möjligt samt att syftet med dem ska uppnås så förmånligt som möjligt. Dessa omständigheter beaktas för närvarande i 6 § 3 mom. där det föreskrivs om byggande av järnväg. Banhållningen ska på lång sikt baseras på kostnadseffektiva lösningar. I fortsättningen ska järnvägsinfrastrukturens funktion i allt större utsträckning bedömas utifrån de möjligheter och andra sidan utifrån de förutsättningar som digitaliseringen och automatiseringen innebär. På bedömningen av förmånligheten inverkar för sin del också de övriga i detta moment nämnda kraven, exempelvis kravet att inte orsaka större skada eller olägenhet än nödvändigt. I avgöranden som gäller banhållning ska de krav som ställs i detta moment också i övrigt betraktas som en helhet och avvägas i förhållande till varandra. 
I 6 punkten föreskrivs om kravet att områdets nuvarande och planerade markanvändning ska beaktas. Också detta krav ingår för närvarande i 6 § 3 mom.  
Enligt 7 punkten ska informationen om järnvägarna och deras underhåll uppdateras och vara tillgänglig. Sådan information kan avse bland annat bannätets skick, banarbeten samt till exempel om störningssituationer. Informationen ska vara allmänt tillgänglig via öppna gränssnitt, om något annat alternativ inte är motiverat. 
Till 8 punkten fogas kravet att järnvägarna och den digitala infrastrukturen i anslutning till dem ska vara kompatibla med det övriga trafiknätet och den digitala infrastrukturen i anslutning därtill. Med kompabilitet avses till exempel att systemen och infrastrukturen i anslutning till järnvägarna möjliggör överföring från statens bannät till privata bannät. Kompatibiliteten kan exempelvis säkerställas med sådana föreskrifter om järnvägsutrustning och trafiktekniska lösningar som Trafiksäkerhetsverket kan utfärda med stöd av 4 mom.  
Till paragrafens 3 mom. överförs från gällande 6 § 1 och 2 mom. bestämmelserna om förutsättningarna för byggande av järnväg och för byggande av ny järnväg.  
I 4 mom. föreskrivs att Trafiksäkerhetsverket med tanke på de krav som avses i 2 mom. kan utfärda bestämmelser om banstrukturen och utrustning samt om användningen av trafikanordningar vid plankorsningar.  
6 §.Byggande av järnväg. Det föreslås att denna paragraf upphävs och att dess innehåll överförs till ovan föreslagna 5 §.  
8 §.Allmänt om planering av järnväg. I paragrafens 2 mom. ska omnämnandet av närings-, trafik- och miljöcentralerna ändras till landskapet. Nuvarande 3 mom. upphävs och bestämmelsen om planering avseende utvecklingen av trafiksystemet ska ersättas med ett omnämnande av riksomfattande trafiksystemplanering och trafiksystemplanering på landskapsnivå. Bestämmelser om riksomfattande trafiksystemplanering och trafiksystemplanering på landskapsnivå ska i fortsättningen ingå i lagen om trafiksystem och landsvägar i den proposition med förslag till ändring av landsvägslagen som ingår i denna proposition.  
9 §. Rätt till utredning. I paragrafens 2 mom. föreslås en ändring enligt vilken i fortsättningen ska tillämpas förfarandet som innebär att landskapets meddelanden ska offentliggöras med kungörelse om att en plan utarbetas samt om att utredningar som har samband med den inleds. På motsvarande sätt ska landskapet genom växelverkan enligt 22 § kungöra att en plan lagts fram, så som landskapets meddelanden offentliggörs i enlighet med landskapslagen. 
10 §.Planering av järnvägsområde och områdesplanering. Omnämnandet av landskapsförbund och NTM-centralen i paragrafens 3 mom. ska enligt förslaget ändras till landskapet. Det föreslås att hänvisningen till NTM-centralen i paragrafens 4 mom. stryks . Till landskapen överförs inte NTM-centralernas tidigare uppgifter som gick ut på att styra och övervaka kommunernas områdesanvändning. I lagen behöver därför inte föreskrivas att landskapets förordande krävs utöver kommunens i sådana fall som avses i momentet.  
12 §.Utredningsplanens innehåll. I denna paragraf föreskrivs om utredningsplanens innehåll. Det föreslås att kraven på utredningsplanens innehåll ska utökas så att den beaktar också den riksomfattande trafiksystemplan som avses i nya 15 e § i lagen om trafiksystem och landsvägar samt den trafiksystemplan på landskapsnivå som avses i 15 f § i den lagen. En bestämmelse om saken ingår i nya 2 mom. 
15 §. Planering av järnvägsområden och områdesanvändning. Det föreslås att kraven på en järnvägsplans innehåll ska utökas så att i den inte ska beaktas också den riksomfattande trafiksystemplanen enligt nya 15 b § i lagen om trafiksystem och landsvägar samt landskapets trafiksystemplan enligt 15 c §. I järnvägsplanen behöver emellertid inte läggas fram en utredning om beaktande av målen för den riksomfattande trafiksystemplanen och trafiksystemplanen på landskapsnivå i sådana fall då den nämnda utredningen redan lagts fram i utredningsplanen för samma projekt och då järnvägsplanen utarbetas i överensstämmelse med utredningsplanen. Också då ska i järnvägsplanen emellertid tas in en utredning om beaktande av trafiksystemplanen till den del som denna på grund av sin allmänna karaktär inte har kunnat beaktas i utredningsplanen. Om man i samband med utarbetandet av järnvägsplanen blir tvungen att avvika från utredningsplanen på så sätt att en i samband med utredningsplanen gjord utredning om beaktandet av målsättningarna i trafiksystemplanen på riksnivå och trafiksystemplanen på landskapsnivå inte helt och hållet eller till någon del länge kan anses vara tillräcklig, måste en ny utredning göras till denna del. Om någon utredningsplan inte över huvud taget har upprättats ska i samband med upprättandet av järnvägsplanen göras en utredning om hur trafiksystemplanerna beaktats. Utredningen ska fogas till järnvägsplanen. I det nya 4 mom. föreskrivs om saken. 
Hänvisningen om skydds- och frisiktsområden i paragrafens 2 mom. utökas med hänvisningar till paragraferna i fråga. 
22 §.Växelverkan. I paragrafens 1 mom. fogas ordet kommunen till förteckningen över sakägare som ska ges möjlighet att delta i beredningen av planen, bedöma verkningarna av planen och skriftligen eller muntligen framföra sin åsikt i saken. Ändringen behövs framför allt till följd av den ändring som föreslås i 2 mom. och som innebär att man från förfarandet med kommunala meddelanden övergår till ett förfarande som innebär att landskapen ska lägga fram planerna.  
I paragrafens 2 mom. föreslås en sådan mot 27 § 3 mom. i landsvägslagen svarande ändring i syfte att göra förfarandena smidigare. På framläggande av planer ska i fortsättningen tillämpas ett sådant förfarande i fråga om landskapets meddelanden som avses i den föreslagna landskapslagen, i stället för det förfarande som avses i kommunallagen. Då förfarandet förändras föreskrivs i momentet att landskapen ska ge de kommuner vilkas områden berörs av en plan tillfälle att framföra sina åsikter om anmärkningar mot en plan. Enligt den gällande lagen skulle anmärkningar tillställas kommunen som såg till att planen lades fram, och kommunen skulle till banhållaren sända sitt utlåtande om planen som varit framlagd och om anmärkningarna mot den samt de anmärkningsskrifter som lämnats in.  
I paragrafens 3 mom. föreslås en ändring som motsvarar det förtydligande som föreslås ovan i landsvägslagens 27 § 3 mom. Det föreslås att momentet förtydligas så att banhållaren ska meddela sitt motiverande ställningstagande till de anmärkningar som gjorts mot planen. Banhållaren ska underrätta dels dem som gjort anmärkningar och dels också kommunerna inom området.  
I paragrafens 4 mom. föreslås att NTM-centralen och landskapsförbundet ändras till Statens tillstånds- och tillsynsmyndighet och landskapet. Dessutom föreslås en språklig korrigering.  
25 §.Ändring av planerna och mindre avvikelser. Det föreslås att hänvisningarna till utredningsplanen och järnvägsplanen i paragrafens första moment justeras. Dessutom föreslås i enlighet med de gällande anvisningarna om författningsberedning att uttrycket ”gäller i tillämpliga delar” stryks.  
I samband med ändring av en redan godkänd utredningsplan och järnvägsplan ska iakttas bestämmelserna om utarbetande av en ny plan. Med avvikelse från denna huvudregel kan enligt väghållningsmyndighetens prövning göras smärre ändringar i en järnvägsplan utan att ett egentligt ändringsförfarande behöver inledas. Smärre ändringar kan göras i situationer där det under byggnadsarbetets gång sker oförutsedda händelser som förutsätter att man gör ändringar i en godkänd järnvägsplan.  
I praktiken görs i en godkänd järnvägsplan inga anteckningar om sådana smärre ändringar som beskrivs ovan. Det är de facto inte fråga om att ändra järnvägsplanen utan om smärre avvikelser som till sina verkningar är obetydliga och som banhållaren i samband med byggandet prövar vara nödvändiga och ändamålsenliga. Av denna anledning föreslås att ordalydelsen i paragrafens andra moment ändras så att det i stället för en smärre ändring ska vara fråga om smärre avvikelser som till sina verkningar är obetydliga. Avsikten med ändringen är inte att ändra det nuvarande rättsläget och bestämmelsen om förutsättningarna för avvikelsen gäller fortfarande i fråga om en smärre avvikelse. Det föreslås att bestämmelsen om smärre avvikelser med obetydliga verkningar blir ett separat 2 mom. och att samtidigt paragrafens rubrik ändras i överensstämmelse med paragrafens innehåll. 
25 a §.Järnvägsplaner som berör plankorsningar. Det föreslås att denna paragraf upphävs som obehövlig. Trafikverket kommer enligt förslaget att vara banhållare. Det föreslås emellertid att i övergångsbestämmelserna föreskrivs att utöver Trafikverket också NTM-centralerna ska vara behöriga att till den 31 december 2019 utarbeta sådana i 20 § 2 mom. avsedda järnvägsplaner som berör plankorsningar och att då ska tillämpas vad som i 2 kap. föreskrivs om banhållare. 
28 §.Godkännande av planer. Omnämnandet av landskapsförbund och NTM-centraler ska enligt förslaget ändras till landskap.  
28 a §.Tillstånd för byggande och flyttande av en plankorsning. I denna paragraf föreskrivs om plankorsningstillstånd. Genom lagen 567/2016 (RP 49/2016 rd) ändrades bestämmelserna om på vilka delar av bannätet i princip inte får byggas permanenta plankorsningar. Före den nämnda lagändringen var det möjligt att bygga nya bestående plankorsningar endast på lågtrafikerade banavsnitt inom det bannät som inte hörde till stomnätet. Genom lagen 567/2016 ändrades regleringen så att det numera inte är stomnätet utan i stället TEN-banorna som utgör den del av bannätet där det inte är tillåtet att bygga nya plankorsningar. Med TEN-nätet avses de järnvägar som hör till ett sådant stomnät eller övergripande nät som avses i Europaparlamentets och rådets förordning nr 1315/2013 om unionens riktlinjer för utbyggnad av det transeuropeiska transportnätet och om upphävande av beslut nr 661/2010/EU. Ändringen motiverades med att stomnätets omfattning inte har bestämts. Målsättningarna för den ursprungliga regleringen gällande begränsning av antalet plankorsningar har sålunda inte förverkligats.  
Beslutsfattandet i fråga om definitionen av järnvägarnas stomnät förtydligas genom de förslag som föreslås ovan i 4 §. För att syftet med stomnätet enligt 4 § ska kunna förverkligas på avsett sätt i samband med beslut om stomnätet, bör det vara möjligt att begränsa byggandet av plankorsningar också inom stomnätet. Stomnätet kommer sannolikt enligt förslaget att till stor del sammanfalla med TEN-nätet, men det kan också vara mera omfattande. Därför föreslås det att stomnätet åter jämställs med TEN-nätet när det gäller att definiera den del av bannätet inom vilken nya plankorsningar i princip inte får byggas. Det föreslås att i paragrafens 1 mom. görs de ändringar som behövs i detta avseende. I paragrafens 2–5 mom. föreslås inga ändringar.  
28 c §.Tillstånd att korsa en järnväg. I denna paragraf föreskrivs om tillstånd att korsa en järnväg vid en plankorsning med en snöskoter eller något annat terrängfordon. Liksom i fråga om plankorsningar har TEN-nätet numera definierats som den del av bannätet inom vilken tillstånd att korsa en järnväg i regel inte kan beviljas. I paragrafen föreslås ändringar som motsvarar dem som föreslås ovan i 28 a § i fråga om jämställande av stomnätet med TEN-nätet så att banhållaren kan bevilja tillstånd att korsa en järnväg endast på bandelar som inte hör till stomnätet eller TEN-nätet. I paragrafens 1 mom. föreslås ändringar i detta avseende. I paragrafens 2–4 mom. föreslås inga ändringar. 
43 a §. Rätt att föra talan vid en järnvägsförrättning. Det föreslås att denna paragraf upphävs som obehövlig. Som banhållare ska enligt förslaget verka Trafikverket. I övergångsbestämmelserna föreskrivs emellertid att NTM-centralerna på motsvarande sätt ska ha behörighet till utgången av år 2019. 
69 §.Utbetalning av ersättning samt ränta. Det föreslås att omnämnandet av närings-, trafik- och miljöcentralerna samt arbets- och näringsbyråernas utvecklings- och förvaltningscenter ändras till banhållare.  
79 §.Nedläggning av järnväg i andra sammanhang. Det föreslås att omnämnandet av landskapsförbund i paragrafens 3 mom. ändras till landskap.  
89 a §.Vissa skadeståndsärenden. Det föreslås att denna paragraf upphävs som obehövlig eftersom det inte finns något behov av en särskild bestämmelse om behörighet. I övergångsbestämmelserna föreskrivs emellertid att NTM-centralerna på motsvarande sätt ska ha behörighet till utgången av år 2019. 
91 §.Meddelande om beslut till dem som gjort en anmärkning och till myndigheterna. Det föreslås att omnämnandet av närings-, trafik- och miljöcentralen och landskapsförbundet i paragrafens 2 mom. ändras till landskapet.  
92 §.Ändringssökande. Det föreslås att omnämnandet av närings-, trafik- och miljöcentralen och landskapsförbundet i paragrafens 3 mom. ändras till landskapet.  
95 §.Kungörelse. Justitieministeriet bereder en proposition med förslag till upphävande av den föråldrade lagen om offentliga kungörelser. Det föreslås att en allmän bestämmelse om offentliga kungörelser fogas till förvaltningslagen (propositionsutkastet på remiss till den 9 mars 2018). Kungörelser och handlingar som ska kungöras publiceras på myndighetens webbsidor i det allmänna datanätet. Vid behov publiceras en kungörelse också i en tidning med allmän spridning inom verkningsområdet eller på något annat sätt som myndigheten bestämt. 
Det föreslås att på kungörelser som avses i denna lag ska tillämpas det förfarande som avses i den 62 a § om offentliga kungörelser som föreslås bli fogad till förvaltningslagen. Samtidigt stryks i paragrafen bestämmelsen som överlappar 62 a § i förvaltningslagen. Den gällande kungörelsestiden på 30 dagar föreslås inte bli ändrad. 
1.14
Lagen om sättande i kraft av de bestämmelser som hör till området för lagstiftningen i fördraget med Ryssland om utarrendering av den del av Saima kanal som tillhör Ryssland och av det därtill hörande området till republiken Finland samt om fartygstrafiken genom Saima kanal och om tillämpning av fördraget 104/2011
3 §. Det föreslås att till paragrafens 1 mom. fogas ett omnämnande om att landskapet Södra Karelen ska vara medlem i kommissionen och ansvara för räddningsväsendet och den prehospitala akutsjukvården då landskapslagen träder i kraft den 1 januari 2020. Dessutom föreslås att benämningen tullstyrelsen ersätts med Tullen.  
1.15
Lagen om tjänster inom elektronisk kommunikation 917/2014
234 §. Förutsättningar för placering. Det föreslås att hänvisningen till landsvägslagen i paragrafens 3 mom. ändras till motsvarande hänvisning till den nya lagrubriken, dvs. lagen om trafiksystem och landsvägar. 
318 §.Utlämnande av information från myndigheter. Det föreslås att omnämnandet av närings-, trafik- och miljöcentralen i paragrafens 2 mom. ändras till landskapet. Rätten att få information gäller NTM-centralerna till dess att lagen om närings-, trafik- och miljöcentralerna upphävs den 31 december 2019. 
1.16
Lagen om säkerhetsutredning av olyckor och vissa andra händelser 525/2011
16 §.Anmälningsplikt. Det föreslås att omnämnandet av regionförvaltningsverket i paragrafens 2 mom. 3 punkten ändras till Statens tillstånds- och tillsynsmyndighet.  
1.17
Lagen om transport av farliga ämnen 719/1994
12 §.Transport och tillfällig förvaring i transportkedjan. Det föreslås att omnämnandet av närings-, trafik- och miljöcentralen i paragrafens 4 mom. ändras till landskapet.  
1.18
Vattenlagen 587/2011
5 kap. Dikning 
6 §. Anmälan om dikning. Det föreslås att hänvisningen till landsvägslagen i paragrafens 1 mom. ska ändras till lagen om trafiksystem och landsvägar 
1.19
Sjötrafiklagen 463/1996
15 §.Regionala förbud och begränsningar. Det föreslås att omnämnandet av NTM-centralen i paragrafens 2 mom. ändras till Statens tillstånds- och tillsynsmyndighet. Trafikverket ska besluta om förbud och begränsningar som gäller allmänna farleder, medan Statens tillstånds- och tillsynsmyndighet ska besluta om förbud och begränsningar som gäller andra vattenområden.  
16 §.Förbud och begränsningar som gäller farkosttyper. Det föreslås att omnämnandet av NTM-centralen ändras till Statens tillstånds- och tillsynsmyndighet. Vidare föreslås i 3 mom. en sådan ändring att Försvarsmakten skrivs med stod begynnelsebokstav.  
17 §.Behandlingen av förbuds- och begränsningsärenden. Förteckningen i paragrafens 1 mom. föreslås bli utökad med landskapet, vilket innebär att också landskapet kan göra en framställan om att förbud eller begränsningar som avses i 15 och 16 § ska utfärdas. Till förteckningen i paragrafens 2 mom. ska enligt förslaget fogas landskapet vilket innebär att också landskapet kan ges tillfälle att bli hört i ärenden som gäller det.  
18 §. Ikraftträdande av förbud och begränsningar. Det föreslås att omnämnandet av NTM-centralen ändras till Statens tillstånds- och tillsynsmyndighet.  
21 §.Tillstånd till tävlingar och övningar. Till paragrafens 2 mom. fogas en bestämmelse enligt vilken kommunen ges rätt att ta ut en avgift för tillstånd som avser återkommande eller permanent anordnande av tävlingar eller övningar med motordrivna farkoster på ett och samma vattenområde enligt 1 mom. samt för anordnande av ett enskilt evenemang, om evenemanget förväntas orsaka betydande olägenheter för miljön enligt 2 mom.  
I paragrafens 3 mom. föreslås att omnämnandet av närings-, trafik- och miljöcentralen ändras till Statens tillstånds- och tillsynsmyndighet. I paragrafens 5 mom. föreslås att Försvarsmakten och Gränsbevakningsväsendet skrivs med stora begynnelsebokstäver.  
22 §.Ändringssökande. Det föreslås att omnämnandet av närings-, trafik- och miljöcentralen i paragrafens 1 mom. ändras till Statens tillstånds- och tillsynsmyndighet.  
23 §.Tillsyn. Det föreslås att omnämnandet av närings-, trafik- och miljöcentralen ändras till Statens tillstånds- och tillsynsmyndighet. Det föreslås att Gränsbevakningsväsendet skrivs med stor begynnelsebokstav och att tullverket ändras till Tullen. 
1.20
Lagen om ersättning för miljöskador 737/1994
12 §. Tillämpning av lagen vid förfaranden enligt vissa andra lagar. Det föreslås att paragrafens hänvisning till landsvägslagen ändras till den nya lagrubriken, dvs. lagen om trafiksystem och landsvägar. 
1.21
Lag om införande av lagen om ändring av landsvägslagen och vissa andra lagar
Denna lag innehåller sådana bestämmelser om genomförande av landskapsreformen som har samband med uppgifter som från staten överförs till landskapen, med behörighet, med personalens ställning, med överföring av avtal och egendom samt med skötsel av anhängiga ärenden. Genom denna lag förverkligas också de överföringar från NTM-centralerna till Trafikverket som ska göras i samband med landskapsreformen. Dessutom föreskrivs i lagen om landskapsfullmäktiges beslut som gäller egendom och avtal som överförs från staten till landskapen. Lagen innehåller också bestämmelser om meddelanden till borgenärer och avtalsparter samt om tillämpning av bestämmelserna om temporär förvaltning. Den föreslagna lagens bestämmelser motsvarar bestämmelserna i den föreslagna lagen om införande av lagstiftningen om genomförande av landskapsreformen och lagstiftningen om omorganisering av statens tillstånds-, styrnings- och tillsynsuppgifter. Avsikten är att regeringen i februari 2018 ska överlämna en proposition om lagen till riksdagen. Bestämmelserna om personalen samt om överföringen av avtal har en central betydelse i fråga om de uppgifter som överförs genom denna lag.  
Genom denna lag genomförs också överföringen av NTM-centralernas nuvarande uppgifter i samband med trafiktelematik och trafikens kundservicecentral till det aktiebolag som avses i 1 § 1 mom. i lagen om ombildning av Trafikverkets trafikstyrnings- och trafikledningstjänster till aktiebolag (RP 34/2018 rd).  
1 kap.Allmänna bestämmelser 
1 §. Författningar som träder i kraft. I denna paragraf föreskrivs om lagar som träder i kraft. Genom den föreslagna lagen ska 14 lagar träda i kraft. Avsikten är att lagarna träder i kraft den 1 januari 2020. I 2 mom. föreslås en bestämmelse enligt vilken vissa bestämmelser i lagen om ändring av landsvägslagen och i lagen om ändring av banlagen dock ska träda i kraft tidigare, så snart som möjligt efter att de stadfästs. Dessa bestämmelser gäller trafiksystemplanering, sådana allmänna krav gällande väghållning och banhållning som ska fogas till lagarna samt landsvägarnas servicenivå och underhåll.  
2 §.Tillämpningsområde. I denna paragraf föreskrivs om tillämpningsområdet för den föreslagna lagen. I lagen föreskrivs om överföring av uppgifter som avses i de lagar som nämns i 1 §. De uppgiftsöverföringar som avses i lagens 1 § gäller dels av landskapsreformen föranledda uppgiftsöverföringar från staten och landskapsförbunden till landskapen och dels från NTM-centralerna till Trafikverket. I lagen föreslås dessutom bestämmelser om överföring av vissa uppgifter som för närvarande ska skötas vid NTM-centralerna till det aktiebolag som avses i 1 § 1 om. I lagen om ombildning av Trafikverkets trafikstyrnings- och trafikledningstjänster till aktiebolag.  
Genom de lagar som nämns i den föreslagna lagens 1 § genomförs överföringen av de uppgifter som avses i 6 § 1 mom. 14 punkten och 6 § 2 mom. 1 punkten samt de statsunderstödsuppgifter gällande mobilitetsstyrning som avses i 6 § 1 mom. 15 punkten i den föreslagna landskapslagen (RP 15/2007 rd). I fråga om de uppgifter som ska överföras till landskapen gäller införandelagen sålunda regleringen i fråga om överföringen av de uppgifter till landskapen som avses i den föreslagna landskapslagens 6 § 1 mom. 14 punkten, dvs. bestämmelsen om landskapens uppgiftsområden: trafiksystemens funktion, trafiksäkerhet, väg- och trafikförhållanden, regional väghållning, samarbete inom markanvändningen och produktion av information om verksamhetsmiljön för den riksomfattande trafiksystemplaneringen. I fråga om 6 § 1 mom. 15 punkten i den föreslagna landskapslagen gäller denna lag införande- och överföringsregleringen av de statsunderstödsuppgifter till landskapen som avser mobilitetsstyrning. I den föreslagna landskapslagens 6 § 1 mom. 15 punkten ingår också statsunderstödsuppgifterna gällande enskilda vägar, men införande- och överföringsbestämmelserna i fråga om dem är det meningen att ta in i en proposition som ska avlåtas hösten 2018 och varmed den nya lagen om enskilda vägar ändras i de avseenden som landskapsreformen förutsätter. (RP 147/2017 rd och RP 11/2018 rd). Denna införandelag gäller också införande- och överföringsreglering av uppgifter som avser utveckling och ordnande av trafiktjänster på landskapsnivå samt planering och ordnande av offentlig persontrafik i enlighet med den föreslagna landskapslagens 6 § 2 mom. 1 punkten.  
Eftersom staten fortfarande ska verka som väghållare och i egenskap av ägare ansvara för landsvägsnätet, ska vissa riksomfattande väghållningsuppgifter som upphör i samband med landskapsreformen överföras från NTM-centralerna till Trafikverket, vilket verkar som väghållare. I denna lag ingår också införande- och överföringsbestämmelser i anslutning till dessa överföringar.  
I en proposition som beretts vid kommunikationsministeriet föreslås att Trafikverkets trafiklednings- och trafikstyrningstjänster ska ombildas till ett aktiebolag (RP 34/2018 rd). De telematikuppgifter som sköts vid Sydöstra Finlands NTM-central är fast förknippade med Trafikverkets trafikstyrnings- och trafikledningstjänster och därför föreslås det att expertuppgifterna i samband med trafikledningen ska överföras till nämnda bolag. Också Trafikens kundservicecentrals uppgifter som för närvarande är förlagda till Birkalands NTM-central kan lämpligen skötas av det nämnda aktiebolaget och det föreslås således att de överförs till det. Överföringarna av uppgifter från NTM-centralerna är det skäl att göra i samband med att de upphör då landskapsreformen genomförs. Eftersom avsikten är att grunda bolaget och genomföra överföringarna från Trafikverket den 1 januari 2019 ska bestämmelser om överföringarna av uppgifter inom trafiktelematiken och kundservicecentralens uppgifter tas in i denna lag och inte i lagen om ombildning av Trafikverkets trafikstyrnings- och trafikledningstjänster.  
Den föreslagna lagens övergångsbestämmelser är inte uttömmande. I fråga om omständigheterna kring uppgiftsöverföringen gäller dessutom vad som föreskrivs särskilt. Särskilda övergångsbestämmelser kan ingå också i andra lagar genom vilka uppgiftsöverföringar till landskapen genomförs, från NTM-centralerna till Trafikverket och från NTM-centralerna till styrnings- och ledningsbolaget för trafiken.  
2 kap.Bestämmelser om överföringar till landskapen 
3 §.Övergångsbestämmelser om landskapens uppgifter och behörighet. Denna paragraf innehåller övergångsbestämmelser om landskapens uppgifter och behörighet till den del som det föreslås att till landskapen i enlighet med denna proposition ska överföras uppgifter som hör till deras uppgiftsområden. Avsikten med propositionen är att göra behövliga ändringar i de speciallagar som gäller de uppgiftsområden som avses i 6 § 1 mom. 14 och 15 punkten samt i 6 § 2 mom. 1 punkten i den föreslagna landskapslagen. I lagen föreslås emellertid dessutom bestämmelser enligt vilka en behörig myndighet kan göra en utredning inom de uppgiftsområden som nämns i landskapslagen i sådana fall då en enskild specialbestämmelse om en viss uppgift inte har ändrats. Det regionalt behöriga landskapet bestäms i enlighet med 5 § i lagen om genomförande av social- och hälsovårdsreformen eller i enlighet med en specialbestämmelse om den regionala behörigheten i anslutning till uppgifterna. Den föreslagna lagen ska tillämpas också på överföring av sådana uppgifter.  
De uppgifter som från NTM-centralernas L-ansvarsområden överförs till landskapen behandlas närmare i den allmänna motiveringens avsnitt 3.3 De viktigaste förslagen och avsnitt 4.2 Konsekvenser för myndigheterna.  
4 §.Övergångsbestämmelser om anhängiga ärenden samt om uppgiftsrelaterade rättigheter och skyldigheter. I denna paragraf föreskrivs om behandling av ärenden som är anhängiga när lagen träder i kraft. De ärenden som är anhängiga vid närings-, trafik- och miljöcentralernas samt arbets- och näringsbyråernas utvecklings- och förvaltningscenter samt vid landskapsförbunden och som ska överföras enligt denna lag samt ingångna avtal och förbindelser och de rättigheter och skyldigheter som följer av dem ska den 1 januari 2020 överföras till landskapen. Det behöriga landskapet bestäms på basis av annan lagstiftning. Det regionalt behöriga landskapet bestäms i enlighet med landskapsindelningen i 5 § i den föreslagna lagen om genomförande av social- och hälsovårdsreformen eller i enlighet med en specialbestämmelse om den regionala behörigheten i anslutning till uppgiften. I 8–17 § i denna lag föreskrivs om landskapens egendomsarrangemang.  
5 §.Ställningen för den personal som övergår från staten. I denna paragraf föreskrivs i överensstämmelse med lagen om införande av lagstiftningen om genomförande av landskapsreformen och lagstiftningen om omorganisering av statens tillstånds-, styrnings- och tillsynsuppgifter (RP 14/2018 rd) om den personals ställning som i enlighet med denna lag överförs till landskapen eller till landskapens nationella servicecenter som avses i landskapslagens 118 § från staten, från NTM-centralerna samt från NTM-centralernas och arbets- och näringsbyråernas utvecklings- och förvaltningscenter. I statstjänstemannalagen (750/1994) föreskrivs om de statsanställdas ställning i samband med omorganiseringen av verksamheten och uppgifterna, och i arbetsavtalslagen (55/2001) om dem som är anställda i arbetsavtalsförhållande. På omorganisering av uppgifterna och verksamheten tillämpas också EG:s direktiv om företagsöverlåtelser (2001/23/EG). 
I samband med byte av arbetsgivare tillämpas i tjänstemanna- och arbetsrätten den så kallade rörelseöverlåtelseprincipen. Med överlåtelse av arbetsgivarens rörelse avses i statstjänstemannalagens 5 e § överlåtelse av en funktionell del av den statliga verksamheten till en annan arbetsgivare, om den del som överlåts förblir oförändrad eller likartad efter överlåtelsen. Med överlåtelse av arbetsgivarens rörelse avses enligt arbetsavtalslagens 1 kap. 10 § överlåtelse av ett företag, en rörelse, en sammanslutning eller en stiftelse eller en funktionell del därav till en annan arbetsgivare, om den rörelse som överlåts och som bedrivits som huvud- eller sidoverksamhet eller den överlåtna delen efter överlåtelsen förblir oförändrad eller likartad. Vid överlåtelsen övergår de rättigheter och skyldigheter som vid överlåtelsetidpunkten sammanhänger med arbetsgivarens arbetsavtals- eller tjänsteförhållanden till den nya arbetsgivaren.  
I det föreslagna 1 mom. föreskrivs att enligt den föreslagna lagen ska överföringen av uppgifter från staten till landskapen och de stödtjänstuppgifter som har samband med dem samt överföringen av den personal som sköter dessa uppgifter från närings-, trafik- och miljöcentralen samt från närings-, trafik- och miljöcentralernas och arbets- och näringsbyråernas utvecklings- och förvaltningscenter till landskapen och till landskapens nationella servicecenter, betraktas som direkt överlåtelse av rörelse. I fråga om statstjänstemän som överförs ska statstjänstemannalagen och i fråga om statsanställda arbetstagare som överförs ska arbetsavtalslagens bestämmelser om rörelseöverlåtelse tillämpas på alla ändringar som genomförs genom dessa lagändringar och innebär att arbetsgivaren byts, oberoende av om kännetecknen på rörelseöverlåtelse enligt statstjänstemannalagen respektive arbetsavtalslagen uppfylls i samband därmed. Denna lösning är förenlig med sådana andra förändringar som innebär byte av arbetsgivare i samband med landskapsreformen.  
Enligt principen om rörelseöverlåtelse överförs personalen med sina uppgifter till anställning hos en ny organisation. Personal som sköter uppgifter vid NTM-centralerna och KEHA-centret övergår i samband med landskapsreformen till en anställning hos det landskap eller det nationella servicecentret till vilket de uppgifter överförs som personen i fråga skötte före överföringen. Personal i tidsbegränsat anställningsförhållande överförs till ett landskap för den tid som anställningsförhållandet gäller.  
I samband med en rörelseöverlåtelse bli mottagaren bunden av det tjänste- och arbetskollektivavtal som gällde hos den föregående arbetsgivaren till dess att kollektivavtalet upphör att gälla, trots att förvärvaren inte är medlem i arbetsgivarförbundet i fråga (5 § i lagen om kollektivavtal (436/1946) och 5 f § i statstjänstemannalagen). Därefter börjar det kollektivavtal tillämpas som är bindande för efterträdaren. Den princip som nämns ovan gäller också alla lokala tjänste- och arbetskollektivavtal. Om ett lokalt tjänste- eller arbetskollektivavtal är i kraft tills vidare är det bindande för förvärvaren om inte överlåtaren eller förvärvaren har sagt upp avtalet.  
I enlighet med statstjänstemannalagens och arbetsavtalslagens principer om rörelseöverlåtelse övergår personalen direkt med stöd av denna införandelag till anställning hos landskapen som så kallade gamla arbetstagare och behåller de rättigheter och skyldigheter i anslutning till tjänste- eller arbetsförhållandet som gällde vid tidpunkten för överföringen. Detta gäller emellertid inte sådana rättigheter och skyldigheter som uttryckligen beror på ett tjänsteförhållande och inte är typiska för ett anställningsförhållande då en tjänsteman övergår till ett arbetsavtalsförhållande hos förvärvaren.  
Efter överlåtelsen ska den nya arbetsgivaren svara för de med tjänste- eller arbetsförhållandena sammanhängande rättigheter och skyldigheter samt till dem anslutna förmåner som var i kraft vid den tidpunkt då arbetsgivaren överlät rörelsen. Överlåtaren och förvärvaren är solidariskt ansvariga för sådana löne- och andra anställningsrelaterade fordringar som förfallit till betalning före överlåtelsen. Överlåtaren ansvarar emellertid gentemot förvärvaren för fordringar som förfallit före överlåtelsen, om inte något annat har avtalats.  
Förvärvaren av en rörelse får inte säga upp ett tjänste- eller arbetsavtalsförhållande enbart på grund av överlåtelsen. Tjänstemän och arbetstagare har med stöd av statstjänstemannalagens 29 a § respektive arbetsavtalslagens 7 kap. 5 § rätt att utan iakttagande av uppsägningstid säga upp anställningsförhållandet att upphöra på dagen för överlåtelsen eller senare, dock senast inom en månad från underrättelsen.  
Uppgifterna för vissa anställda inom NTM-centralernas trafikansvarsområden kommer i samband med landskapsreformen att fördelas mellan landskapen och Trafikverket. Enligt 2 mom. ska de övergå i landskapets tjänst av vilkas faktiska arbetsuppgifter åtminstone hälften ska överföras. Det är fråga om en gräns som är avsedd för denna situation och inte om en gräns i anslutning till kriterierna för rörelseöverlåtelse. Uppgifterna i anslutning till de trafiktjänster som avses i landskapslagens 6 § 2 mom. 1 punkten hör till landskapets allmänna verksamhetsområde, trots att landskapet fritt får besluta om skötseln av dem. Behörigheten att sköta dessa uppgifter övergår från staten till landskapen, vilket innebär att också den personal som sköter uppgifterna övergår till landskapen. Landskapens temporära förvaltning och de statliga verken ska i god tid före den 31 december 2019 utreda det exakta antalet årsverken i fråga om de uppgifter som överförs. Det är viktigt att i samband med förberedelserna inför personalöverföringen försäkra sig om att den nödvändiga tjänsteproduktionen tryggas i övergångsfasen och att personalresurserna även i övrigt samordnas så att både landskapen och de statliga myndigheterna också i fortsättningen har tillräckligt med kompetent personal. Före överföringen ska verkens nuvarande ledning organisera uppgifterna så att de berörda personernas uppgifter i så stor utsträckning som möjligt överförs till den nya aktören som helheter.  
Principen om överlåtelse av rörelse ska tillämpas oberoende av i vilken ordning landskapens organisationer inrättas. Med andra ord kan en person enligt principen om överlåtelse av rörelse övergå direkt från en statlig myndighet till ett landskap eller en sammanslutning som hör till landskapskoncernen eller där landskapet har bestämmande inflytande. Om en sammanslutning som hör till landskapskoncernen eller där landskapet har bestämmande inflytande bildas först efter det att landskapet har inlett sin verksamhet, ska personalen först övergå i anställning hos landskapet och först därefter till sammanslutningen. 
Enligt statstjänstemannalagens 5 f § och arbetsavtalslagens 1 kap. 10 § är överlåtaren ansvarig gentemot förvärvaren för en fordran som förfallit till betalning före överlåtelsen, om inte något annat har avtalats. Enligt riktlinjerna för landskapsreformen ska staten inte separat till landskapen betala semesterlöneskuld som har förfallit till betalning vid årsskiftet 2019–2020. Landskapen svarar för semesterlönen och den ingår i den finansiering som överförs till landskapen. I 3 mom. föreslås en bestämmelse om saken.  
I 4 mom. föreskrivs om överföring av personal till en sammanslutning som hör till landskapskoncernen eller där landskapet har bestämmande inflytande samt anges den övergångstid under vilken överföringen av uppgifter vidare till sammanslutningen likaså ska betraktas som överlåtelse av rörelse. Begreppet landskapskoncern definieras i den föreslagna landskapslagens 4 § 1 mom. Landskapet och dess dottersammanslutningar bildar en landskapskoncern. Landskapets dottersammanslutning är en sammanslutning där landskapet har sådant bestämmande inflytande som avses i 1 kap. 5 § i bokföringslagen (1336/1997). Vad som föreskrivs om landskapets dottersammanslutning ska tillämpas också på en stiftelse som omfattas av landskapets bestämmande inflytande. Landskapen kan på så sätt bolagisera sin service före den 31 december 2021 och personalen övergår då genom vidareöverlåtelse också enligt principen för överlåtelse av rörelse. På så sätt kan personalen först överföras till landskapet och sedan till landskapets dottersammanslutning. Båda överföringarna betraktas då som överlåtelse av rörelse. Bestämmelsen tryggar personalens ställning och innebär i praktiken en övergångstid för bolagiseringen. Bolagiseringen kan då ske kontrollerat och under ledning av valda landskapsfullmäktige. Personer av vilkas faktiska arbetsuppgifter åtminstone hälften ska överföras övergår i tjänst hos en sammanslutning som ingår i landskapskoncernen eller där landskapet har bestämmande inflytande.  
6 §.Tilläggspensionsskydd. I paragrafens 1 mom. föreslås bestämmelser om skyldigheterna för sammanslutningar som hör till landskapskoncernen eller där landskapen har bestämmande inflytande, när det gäller att trygga förmånerna på nivån för lagstadgade tilläggspensioner inom offentliga sektorn för de anställda som med anledning av landskapsreformen övergår från staten till ett bolag som inrättas. Begreppet landskapskoncern definieras i den föreslagna landskapslagens 4 § 1 mom. Landskapet och dess dottersammanslutningar bildar en landskapskoncern. Landskapets dottersammanslutning är en sammanslutning där landskapet har sådant bestämmande inflytande som avses i bokföringslagens 1 kap. 5 §. Vad som föreskrivs om landskapets dottersammanslutningar tillämpas också på stiftelser som omfattas av landskapets bestämmande inflytande. Sammanslutningar där landskapen har bestämmande inflytande är deras nationella servicecenter och andra sammanslutningar där landskapen tillsammans har sådant bestämmande inflytande som avses i 1 kap. 5 § i bokföringslagen.  
Personalen ska övergå som gamla arbetstagare till de landskap som inrättas eller till sammanslutningar som hör till landskapskoncernen eller där landskapen har bestämmande inflytande och bevara de rättigheter och skyldigheter som hör till arbets- eller tjänsteförhållandet vid tidpunkten för övergången. Vid bolagiseringen av tjänster inom statsförvaltningen har tilläggspensionerna för den personal som övergår tryggats. Motsvarande förfaringssätt har också tillämpats då kommunerna uppfyllt skyldigheten att bolagisera funktioner.  
Reglerna för pensionstillväxten är i nuläget desamma inom den offentliga och inom den privata sektorn. De som före 1993 anställts inom den offentliga sektorn har emellertid haft ett pensionsskydd med bättre tillväxt än anställda inom den privata sektorn. Deras pensionstillväxt var 2,2 procent per år till utgången av 1994. Den som fortsätter arbeta hos ett medlemssamfund i Keva eller hos staten till sin individuella eller yrkesbaserade pensionsålder får den tilläggspension som intjänats under anställningen hos en kommun, en samkommun eller staten. Arbetstagare som är födda 1960 eller därefter får tilläggspension om anställningen fortsätter oavbrutet till den lägsta åldern för ålderspension enligt pensionslagen för den offentliga sektorn (81/2016). Också den som blir arbetsoförmögen medan anställningsförhållandet pågår får tilläggsskyddet. I 8 och 9 § i lagen om införande av pensionslagen för den offentliga sektorn (82/2016) regleras från ingången av 2017 intjänandet av pension inom den offentliga sektorn före 1995 och villkoren för att en anställning fortgår oavbrutet.  
I samband med beredningen av regeringens proposition med förslag till lagstiftning om genomförande av landskapsreformen och om omorganisering av statens tillstånds-, styrnings- och tillsynsuppgifter föreslås det att lagen om Keva (66/2016) ändras så att landskapen samt Kommun och landskapsarbetsgivarna KT direkt med stöd av lagen blir medlemssamfund i Keva. Utifrån den föreslagna ändringen omfattas de anställda som övergår till landskapen från medlemssamfunden i Keva fortfarande av pensionsskyddet enligt pensionslagen för den offentliga sektorn och bevarar därmed också sin eventuella tilläggspension. För de statsanställdas del ska det i 10 § 2 mom. i lagen om genomförande av landskapsreformen anges att den personal som överförts till landskapen ska få behålla sitt tilläggspensionsskydd. Enligt de ändringar som föreslås i lagen om Keva kan de bolag som landskapen äger eller har bestämmande inflytande över bli medlemssamfund i Keva på samma sätt som de bolag som kommunerna och samkommunerna äger eller har bestämmande inflytande över. Ett landskapsägt bolag kan således ansöka om att bli medlemssamfund i Keva eller som ett andra alternativ försäkra sin personal enligt lagen om pension för arbetstagare. Om bolaget är medlemssamfund i Keva omfattas de anställda också i fortsättningen av pensionsskyddet för den offentliga sektorn. Om bolaget tecknar pensionsförsäkringen i ett arbetspensionsbolag förlorar de anställda sin lagstadgade tilläggspension och de lägre pensionsåldrarna.  
I paragrafen föreskrivs om skyldigheterna för de sammanslutningar som hör till landskapskoncerner eller där landskapet har bestämmande inflytande när det gäller att trygga förmånerna på nivån för lagstadgade tilläggspensioner inom den offentliga sektorn för de anställda som med anledning av arrangemangen kring landskapsreformen övergår från staten till ett bolag. Ett villkor är dessutom att den anställdas anställningsförhållande utan avbrott fortsätter till pensionsfallet i det bolag som han eller hon har övergått till. 
Tilläggspensionsförmånerna inom den offentliga sektorn kan tryggas genom att arbetsgivaren blir medlemssamfund i Keva eller tecknar en privat tilläggspensionsförsäkring. Omkring en tredjedel av den personal som överförs har rätt till tilläggspensionsskydd och dess inverkan på pensionen är cirka 50 euro i månaden. 
Enligt föreslagna 2 mom. ska de som övergår från staten till ett landskap eller en sammanslutning som hör till landskapskoncernen eller där landskapet har bestämmande inflytande behålla sitt tilläggspensionsskydd. Rätten till tilläggspensionsskydd kvarstår om den som överförs har denna rätt när överföringen sker och om kravet på kontinuitet och den anställning som krävs för tilläggspensionsskydd efter överföringen blir uppfyllt i anställningen hos ett medlemssamfund i Keva, dvs. i en sammanslutning som hör till landskapskoncernen eller där landskapet har bestämmande inflytande. Om sammanslutningen inte blir medlemssamfund i Keva gäller 1 mom.  
7 §.Överföring till landskapen av statens lösa egendom samt av avtal och ansvarsförbindelser. Enligt 1 mom. övergår sådan lös statlig egendom, de rättigheter som gäller ägande, besittning och användning av den lösa egendom samt de immateriella rättigheter och tillstånd som omfattas av landskapens organiseringsansvar enligt lagen till landskapen den 1 januari 2020. Staten och landskapen kan också komma överens om något annat i fråga om överföringen av lös egendom. 
Enligt 2 mom. ska staten till landskapen överföra avtalen om organisering av de uppgifter som ska överföras från NTM-centralerna. Överföringen ska ske den 1 januari 2020. Det rör sig framför allt om avtal som gäller vägunderhåll, däribland fleråriga avtal om regionala skötselentreprenader. Andra avtal som överförs är till exempel med kommunerna ingångna samarbetsavtal och gemensamma upphandlingsavtal gällande planering och genomförande av väghållningsprojekt. Från NTM-centralernas trafikansvarsområden överförs enligt förslaget avtal i anslutning till ordnande av offentlig persontrafik.  
Om det inte är möjligt att överföra eller dela upp ett avtal, ska staten och landskapet avtala om fördelningen av det ansvar som avtalet medför. I samband med den utredning som avses i 8 § ska staten lägga fram ett förslag till fördelning av det ansvar som avtalet medför. De statliga funktioner som i dagens läge har organiseringsansvar för de uppgifter som ska överföras till landskapen har bara hyrda lokaler. Detta gäller NTM-centralerna och AN-byråerna samt deras utvecklings- och förvaltningsfunktion KEHA-centret. Merparten av lokalerna hyrs av det statliga affärsverket Senatfastigheter. Exempelvis dessa hyresavtal övertas av landskapen. Landskapet ska också överta andra avtal som gäller organisering och skötsel av uppgifterna, exempelvis avtal om köptjänster och upphandling samt leasing av maskiner och anordningar. 
I 3 mom. preciseras arrangemangen kring överföring av avtalen. Enligt momentet får landskapen fram till den 31 december 2023 utnyttja upphandlingsavtal som Senatfastigheter, Hansel Ab, Statens center för informations- och kommunikationsteknik (Valtori), Servicecentret för statens ekonomi- och personalförvaltning (Palkeet), NTM-centralerna samt NTM-centralernas och AN-byråernas utvecklings- och förvaltningscenter har ingått samt ramavtal och upphandlingsavtal som Hansel Ab upphandlat. Ramavtalen innebär att upphandlingslagen och tillämpningspraxis för den ska iakttas. Om inte för landskapen i samband med upphandlingen redan har reserverats en möjlighet att senare ansluta sig till upphandlingsavtalet eller ramavtalet, kommer en anslutning till avtalen att innebära ett förfarande som strider mot upphandlingslagen och rättspraxis. Av denna anledning ska vid framtida upphandlingar också beaktas landskapens möjlighet att ansluta sig till avtalet. 
8 §.Sammanställning över egendom och avtal som överförs från staten. Paragrafen motsvarar 17 § i lagen om införande av lagstiftningen av genomförande av landskapsreformen och omorganisering av statens tillstånds-, styrnings- och tillsynsuppgifter, som till sina principer motsvarar 23 i lagen om införande av landskapslagen, lagen om ordnande av social- och hälsovård och lagen om ordnande av räddningsväsendet.  
I paragrafen förskrivs det om sammanställningar som staten ska lägga fram för landskapen över den lösa egendom som överförs och om tillstånd och avtal. Enligt paragrafens 1 mom. ska staten för landskapen lägga fram en detaljerad sammanställning över den lösa egendom och de avtal som avses i 7 §. Sammanställningarna ska lämnas senast den 28 februari 2019. De ska omfatta också de avtal, licenser och andra rättigheter samt anläggningstillgångar som enligt 13§ överförs vidare till landskapens IKT-center. Sammanställningarna ska läggas fram av NTM-centralerna. Informationen kan också tas emot direkt av servicecentret för lokal- och fastighetsförvaltning eller IKT-centret. 
Sammanställningarna ska så detaljerat som möjligt specificera och förteckna de avtal som landskapet får ansvaret för. Detta gäller avtal om lokaler och andra avtal. Om avtalet är sådant att det inte går att överföra eller dela och om det inte heller är motiverat att säga upp avtalet av ekonomiska eller andra skäl, ska staten i samband med sammanställningen föreslå hur ansvaret enligt avtalet ska fördelas och skötas i praktiken mellan staten och landskapet. Vid behov ska staten och landskapet förhandla om saken.  
Det behövs inte nödvändigtvis någon detaljerad förteckning över den lösa egendom som övergår från staten. I princip övergår den lösa egendom som finns i lokalerna och hör till verksamheten i landskapet. Till den delen är det motiverat att i mån av möjlighet använda bokföringen av användningstillgångar som underlag för sammanställningen. Lös egendom för vilken äganderätten måste registreras, exempelvis bilar, ska emellertid listas separat. Till denna del har sammanställningen samband med 14 § enligt vilken landskapets beslut som grundar sig på sammanställningen motsvarar en åtkomsthandling för egendom.  
Enligt paragrafens 2 mom. har landskapet eller på uppdrag av landskapet också servicecentret för lokal- och fastighetsförvaltning samt IKT-centret rätt att be staten om kompletterande utredningar och dokument som det anser sig behöva. Landskapet ska enligt förslaget också inleda förhandlingar med staten om det, efter att av staten ha fått en sammanställning som avses i 1 mom., anser att lokalerna, övrig egendom, tillstånden och avtalet som enligt kommunens eller statens sammanställning övergår i landskapets besittning inte tryggar ordnandet av de tjänster och uppgifter som enligt lagen övergår från staten till landskapet på landskapets område. Det är i praktiken motiverat och rekommendabelt att staten och landskapet förhandlar i samband med att sammanställningen utarbetas och i mån av möjlighet utarbetar den i samarbete.  
Enligt 3 mom. ska staten senast den 30 juni 2020 komplettera den sammanställning som avses i 1 mom. om det har skett väsentliga förändringar i de lokaler, den övriga egendom eller de avtal som avses i 1 mom. efter det att sammanställningen har lämnats och om landskapet anser att sammanställningen behöver kompletteras. Det kan ske sådana förändringar i omständigheter från det att sammanställningen lämnas till det att landskapet inleder sin verksamhet, som kan ha betydelse också för landskapets verksamhet. Staten kan till exempel har ingått avtal som ska överföras till landskapet.  
9 §.Landskapens beslut. Paragrafen innehåller bestämmelser om beslut som landskapen ska fatta utifrån statens sammanställning enligt 8 §. Landskapsfullmäktige ska behandla sammanställningen och utifrån den fatta beslut om överföring i enlighet med 7 § till landskapen av rättigheter, immateriella rättigheter samt tillstånd gällande statsägd lös egendom, avtal om ägande, innehav och användning av lös egendom . Landskapsfullmäktige ska fatta sitt beslut i god tid före överföringen den 1 januari 2020.  
I paragrafen hänvisas till avtal enligt 7§, i synnerhet till avtal som gäller vägunderhåll, bland annat fleråriga avtal om regionala skötselentreprenader.  
10 §.Nyttjanderätt till lokalerna under tiden för sökande av ändring. I denna paragraf föreskrivs om sådana besluts verkställbarhet som gäller landskapsfullmäktiges egendom. Enligt paragrafens 1 mom. får landskapets beslut verkställas innan det har vunnit laga kraft om inte förvaltningsdomstolen till någon del förbjuder verkställighet. Det är då kommunikationsministeriet som för statens talan. Även om staten har överklagat landskapsfullmäktiges beslut ska landskapet i enlighet med 2 mom. ha rätt att i lokaler som staten äger och förvaltar ordna de tjänster som landskapet ansvarar för och som har överförts från staten samt att använda den lösa egendom som staten äger eller besitter och som behövs för att ordna tjänsterna innan att förvaltningsdomstolens beslut har vunnit laga kraft. Den lösa egendomen ska vara i statens besittning då besittningen grundar sig på exempelvis leasingavtal eller något annat avtal. Syftet med bestämmelsen är att säkerställa att servicen fortsätter störningsfritt. 
11 §.Statsborgen. I paragrafen föreslås bestämmelser om statsrådets behörighet att ställa statsborgen för vissa förbindelser som övergår till landskapen. Principerna i bestämmelsen motsvarar 28 § i lagen om införande av landskapslagen, lagen om ordnande av social- och hälsovård och lagen om ordnande av räddningsväsendet. Avsikten är att riskklassificeringen för de förbindelser som landskapen övertar från staten inte ska ändras i kreditinstitutens kapitaltäckningsanalys. Landskapet har ingen beskattningsrätt, vilket innebär att dess ställning inte i alla avseenden motsvarar kommunens eller statens.  
I paragrafens 2 mom. preciseras borgensförfarandet i fråga om säkerheter för lån. Om säkerhet har ställts för lån som överförs är det med tanke på statens riskhantering motiverat att statsborgen ställs som fyllnadsborgen med avseende på denna säkerhet. Samtidigt är det skäl att säkerställa att statsrådet har möjlighet att bevilja statsborgen också för de lån och andra avtal för vilka inte har ställts säkerhet. Statsborgen beviljas då i enlighet med den ursprungliga framställan utan krav på motsäkerhet.  
Enligt grundlagens 82 § ska statens upplåning vara grundad på riksdagens samtycke, varav de nya lånens eller statsskuldens maximibelopp framgår. Statsborgen och statsgaranti får beviljas med riksdagen samtycke. Genom beviljande av statsborgen skapar man klarhet i borgenärens ställning när situationen förändras och dessutom säkerställer man kontinuiteten i finansieringsarrangemangen. Statsborgen kan också ställas för betydande leasingavtal som överförs i enlighet med den sammanställning som avses i 8 §. Det noggrant angivna maximibeloppet när det gäller borgensförbindelserna ska enligt 3 mom. bestämmas i samband med behandlingen av statsbudgeten. Statsborgen kan beviljas utan krav på sådan motsäkerhet som avses i 14 § i lagen om statens långivning samt statsborgen och statsgaranti (449/1988). Statsrådet beslutar om borgensavgifter och andra villkor.  
12 §.Anmälan till borgenärer och avtalsparter. I paragrafen föreslås bestämmelser om landskapets meddelanden till parterna i de avtal som överförs från staten till landskapet. Enligt 1 mom. ska landskapet senast den 31 oktober 2019 sända ett skriftligt meddelande till avtalsparterna för de ansvarsförbindelser och avtal som överförs på landskapets ansvar. Av meddelandet ska framgå om ansvarsförbindelsen eller avtalet överförs vidare från landskapet till ett sådant servicecenter som avses i landskapslagens 16 kap.  
13 §.Överföring av landskapets hyresavtal till servicecentret. I denna paragraf föreskrivs om överföring till det nationella servicecentret av avtal och ansvar som övergått på landskapen. Bestämmelsen motsvarar i princip 31 § i den införandelag som föreslagits i samband med landskapsreformen och reformen av social- och hälsovården, med de justeringar som föreslagits i samband med riksdagsbehandlingen.  
Det föreslås att landskapet ska överföra de tidigare överförda hyresavtalen för lokaler till servicecentret för lokal- och fastighetsförvaltning. Bestämmelser om servicecentret finns i landskapslagens 118 §. 
I paragrafen föreskrivs om överföring av produktionsfaktorer till landskapens IKT-center. IKT-centret behöver för att inleda sin verksamhet sådana avtal gällande IT- och datatekniktjänster som kommit i dess ägo och programlicenser som berättigar till användning av de datasystem som dessa avtal avser och motsvarande rättigheter samt i viss utsträckning eventuellt också anläggningstillgångar.  
Landskapet ska besluta om överföringen så att avtalen överförs i servicecentrets besittning den 1 januari 2020.  
14 §.Förvärv av egendom. Enligt paragrafen ska sammanställningen enligt 8 § och landskapets beslut enligt 9 och 13 § jämställas med åtkomsthandlingar för egendom. Principerna i bestämmelsen motsvarar 32 § i lagen om införande av landskapslagen, lagen om ordnande av social- och hälsovård och lagen om ordnande av räddningsväsendet. Landskapen kommer eventuellt att överta sådan egendom av kommuner, samkommuner eller staten som till exempel kräver registrering av ägandet. Att upprätta särskilda åtkomsthandlingar kan innebära mycket arbete som kan anses onödigt med tanke på rättssäkerheten, när man beaktar att egendomen övergår till landskapet som universalsuccession.  
15 §.Notering av egendomsarrangemang i landskapens bokföring. Paragrafen innehåller bestämmelser om notering av egendomsarrangemang i landskapens bokföring. Till sina principer motsvarar paragrafen 34 § i lagen om införande av landskapslagen lagen om ordnande av social- och hälsovård och lagen om ordnande av räddningsväsendet.  
3 kap.Bestämmelser om överföringar till Trafikverket 
16 §.Övergångsbestämmelser som gäller Trafikverkets uppgifter och behörighet. I denna paragraf ingår övergångsbestämmelser om Trafikverkets uppgifter och behörighet till den del som enligt förslaget ska överföras uppgifter från NTM-centralerna och Keha-centret. Dessutom föreslås emellertid att i lagen tas in bestämmelser som innebär att frågan om den behöriga myndigheten kan utredas i sådana fall där en enskild uppgiftsrelaterad specialbestämmelse inte har ändrats. Också i fråga om sådana uppgiftsöverföringar ska den föreslagna lagen tillämpas.  
17 §.Övergångsbestämmelser som gäller anhängiga ärenden samt rättigheter och skyldigheter i anslutning till uppgifter. I denna paragraf föreskrivs om hantering av ärenden som är anhängiga när lagen träder i kraft. De ärenden som är anhängiga vid närings-, trafik- och miljöcentralerna, närings-, trafik- och miljöcentralernas och arbets- och näringsbyråernas utvecklings- och förvaltningscenter samt ingångna avtal och förbindelser, liksom de rättigheter och skyldigheter som följer av dem, överförs enligt 1 mom. till Trafikverket den 1 januari 2020. Från NTM-centralerna och Keha-centren överförs till exempel uppgifterna i anslutning till väghållningstillstånd och markförvärv samt datasystemen som används i samband med dem.  
18 §.Ställningen för den personal som övergår till Trafikverket. I denna paragraf ingår en hänvisning till statstjänstemannalagen (750/1994) vars bestämmelser ska tillämpas på den personal som övergår till Trafikverket. Personalöverföringar inom staten ska genomföras i enlighet med 5 a–c § i statstjänstemannalagen. Tjänstemän i tidsbegränsade tjänsteförhållanden ska överföras till verket för den tid som det tidsbegränsade tjänsteförhållandet fortgår. I 5 a § i statstjänstemannalagen föreskrivs att i samband med omstrukturering av funktioner inom statsförvaltningen överförs tjänsterna och förflyttas de tjänstemän som utnämnts till tjänsterna till samma ämbetsverk som uppgifterna överförs till. Om det råder oklarhet om den personal som överförs tillsammans med uppgifterna med stöd av 5 a § i statstjänstemannalagen, ska uppgifterna i samband med att förändringen genomförs ordnas som helheter så att det är möjligt att fastställa den personal som överförs.  
4 kap.Bestämmelser om överföringar till trafikstyrnings- och trafikledningsbolaget 
19 §. Uppgifter som överförs. I denna paragraf föreskrivs om överföring av trafiktelematikenhetens och kundservicecentrets uppgifter till det aktiebolag som avses i 1 § 1 mom. i lagen om ombildning av Trafikverkets trafikstyrnings- och trafikledningstjänster till aktiebolag (RP / ). 
Det nämnda bolagets verksamhetsområde kommer enligt propositionen om inrättandet av bolaget (RP / ) att vara sjö-, järnvägs- och trafikstyrningstjänster och därtill att gälla anslutna trafikledningstjänster samt i anslutning till dem insamling, hantering och utnyttjande av information. Bolagets primära uppgift ska vara att säkerställa en smidig och säker sjö-, järnvägs- och vägtrafik. Detta ska ske genom tillhandahållande av trafikstyrningsrelaterade tjänster. Bolagets uppgift är framför allt att svara för att säkerhets- och farledsmyndigheternas tillhandahålls fartygstrafiktjänster samt styrningstjänster för järnvägstrafiken och för vägtrafiken i en utsträckning som är motiverad för skötseln av dessa lagstadgade tjänsteuppgifter. Bolaget har också i uppgift att samla in och öppna information och att skapa möjligheter för sådan ny affärsverksamhet på marknaden som bygger på automatisering och effektivare utnyttjande av information. Avsikten med bolagets verksamhet är att främja utvecklingen av den marknad som bygger på digitalisering och automatisering av trafiken på ett sätt som så övergripande som möjligt betjänar Finlands näringsliv samt transporter och medborgarnas mobilitet. Bolaget kan ha verksamhet också i utlandet. 
Till det trafikstyrningsbolag som ska bildas överförs den 1 januari 2020 från NTM-centralerna trafiktelematikenhetens och kundservicecentrets uppgifter.  
Trafiktelematikenheten vid Sydöstra Finlands NTM-central har åtta anställda. Från trafiktelematikenheten ska expertuppgifterna i anslutning till trafikledning och telematik samt den personal som sköter uppgifterna (6 årsverken) överföras till det trafikstyrningsbolag som ska grundas. Utvecklingen av upphandlingar som ska skötas av trafiktelematikenheten, utvecklingen av intelligenta transportsystem, planeringen av verksamhetsmodeller, det internationella samarbetet samt deltagandet i det internationella samarbetet för utveckling av vägvädersystem och -tjänster kommer däremot, liksom koordineringen av det nationella samarbetet, att vara sådana riksomfattande väghållningsuppgifter som i samband med landskapsreformen överförs till Trafikverket. Också expertuppgifterna i anslutning till tunnelsäkerheten är sådana riksomfattande väghållningsuppgifter som i samband med landskapsreformen överförs till Trafikverket. Från trafiktelematikenheten överförs sålunda två årsverken till Trafikverket.  
Trafikens kundservicecenter vid Birkalands NTM-central är en accesstjänst för landsvägs-, ban- och farledsärenden som hör till Trafikverkets och NTM-centralernas verksamhetsområde. Rådgivningstjänsterna i anslutning till Trafikverkets och NTM-centralernas trafikleder har i fråga om hela landet centraliserats till Trafikens kundservicecenter. Centrets kundrådgivare svarar på frågor, behandlar återkoppling och handleder kunderna. Kundservicecentrets samtliga uppgifter och den personal som sköter dem (12 årsverken) överförs till det trafikstyrningsbolag som ska grundas.  
20 §.Överlåtelsefullmakt. Enligt denna paragraf berättigas statsrådet att överlåta egendom, immateriella rättigheter och affärsverksamhet som har samband med trafiktelematikenhetens och kundervicecentrets uppgifter och är i NTM-centralernas besittning till det aktiebolag som avses i 1 § 1 mom. i lagen om ombildning av Trafikverkets trafikstyrnings- och trafikledningstjänster till aktiebolag . Överlåtelsefullmakten omfattar sålunda uppgifterna i samband med NTM-centralernas kundserviceuppgifter och trafiktelematik som en helhet, inklusive tillgångar och skulder. Statsrådet ska i enlighet härmed befullmäktiga kommunikationsministeriet att sköta överlåtelsearrangemangen.  
21 §. Överlåtelsevillkor. Enligt paragrafens 1 mom. bestämmer statsrådet vilken egendom som ska överlåtas och värdet på egendomen samt villkoren för överlåtelsen. För överlåtelsen upprättas i enlighet med statsrådets fullmakt en särskild överlåtelsebehandling där de tillgångar som ska överlåtas preciseras. Statsrådet bestämmer också om andra arrangemang i anslutning till överlåtelse av egendom och bildande av aktiebolag.  
Enligt paragrafens 2 mom. bestämmer statsrådet vilken del av egendomen som ska överlåtas mot aktier i aktiebolaget. Rapportegendom kan överförs då bolaget inleder sin verksamhet efter att lagen trätt i kraft.  
Enligt paragrafens 3 mom. kan statens lån till bolaget stå utan säkerhet upp till det kapitalbelopp som motsvarar statens lån för egendom som vid tidpunkten för överlåtelsen har samband med trafiktelematikenhetens och kundservicecentrets funktioner vid NTM-centralerna.  
22 §. Beskattning. I 1 mom. föreskrivs det om de värden på anläggningstillgångar och andra tillgångar som utgör avskrivningsgrund för det övertagande bolaget. Bolagiseringen jämställs i sak med den verksamhetsöverlåtelse som avses i 52 d § i lagen om beskattning av inkomst av näringsverksamhet. Den verksamhet med trafikstyrnings- och trafikledningstjänster som nu föreslås bli bolagiserad har inte varit skattepliktig näringsverksamhet inom Trafikverkets verksamhet, och därför behöver det inte särskilt anges att den nämnda bestämmelsen ska tillämpas på bolagiseringen. Vid bolagiseringen ska dock principerna om rörelseöverlåtelse iakttas i tillämpliga delar och kontinuitetsprincipen ska tillämpas. 
Inte heller 52 d § 3 mom. i lagen om beskattning av inkomst av näringsverksamhet ska vara direkt tillämpligt på bolagiseringen. Enligt det momentet gäller att vid beskattningen av det övertagande bolaget räknas som avdragbar anskaffningsutgift för den överförda egendomen den vid beskattningen av det överlåtande bolaget oavskrivna delen av anskaffningsutgiften. Enligt förslaget föreskrivs det därför separat om de värden som det övertagande aktiebolaget kan göra avskrivningar på. Det aktiebolag till vilket funktionerna överförs är precis som alla andra aktiebolag skyldigt att betala skatt på alla sina inkomster. Eftersom det inte är motiverat att det övertagande aktiebolaget kan börja göra avskrivningar exempelvis till gängse värden, föreslås det att när medel som hänfört sig till den skattskyldiges tidigare skattefria verksamhet överförs till den beskattningsbara verksamheten ska bokföringsvärdet för finansierings-, omsättnings- eller anläggningstillgångar betraktas som anskaffningsutgift. Detta gäller all egendom som överförs till aktiebolaget, eftersom det inte går att påvisa tidigare oavskrivna anskaffningsutgifter i beskattningen för den egendom som överförs.  
Till det övertagande bolaget överförs i samband med arrangemanget alla tillgångar, skulder och ansvarsförbindelser med anknytning till de funktioner som bolagiseras samt anställda. 
I 2 mom. föreskrivs det om överlåtelseskatt som rör aktiebolaget under bildning. Enligt momentet ska aktiebolaget inte vara skyldigt att betala överlåtelseskatt på överlåtelse av fastighet eller värdepapper i samband med överlåtelse som avses i 1 och 2 §. Den föreslagna skattefriheten motsvarar till sin omfattning skattefriheten enligt 43 § 1 mom. i lagen om överlåtelseskatt. Något ansökningsförfarande enligt bestämmelsen behövs dock inte, eftersom det kan anses vara klart att villkoren för skattefrihet är uppfyllda i detta fall. 
23 §. Ansvar för förbindelser. I paragrafens 1 mom. föreskrivs att bolaget svarar för låne-, borgens-, upphandlings- och leveransavtal samt för övriga förbindelser som NTM-centralerna i samband med trafiktelematikenhetens och kundservicecentrets uppgifter under sin verksamhet har ingått eller åtagit sig och som gäller egendom och affärsverksamhet som har överlåtits till aktiebolaget. I de avtal som ingås om uppgiftsöverföringar före bolagiseringen ska nämnas den förestående bolagiseringen.  
I paragrafens 2 mom. föreskrivs att eftersom gäldenären kan bytas endast med borgenärens samtycke ska staten fortfarande vara sekundärt ansvarig för sådana förpliktelser som uppkommit före grundandet och om vilka det inte avtalas något annat. Genom bestämmelsen säkerställs kontinuiteten i verksamheten och tjänsterna i samband med bolagiseringen.  
24 §.Verksamhetens kontinuitet i förvaltningsärenden. Enligt paragrafens 1 mom. är förvaltningsbeslut och förvaltningsprocessuella beslut om rättigheter, förmåner och skyldigheter som hänför sig till egendom och affärsverksamhet som NTM-centralerna överlåtit till aktiebolaget i kraft på så sätt att de utan något särskilt beslut avser egendom och affärsverksamhet som överlåts till det aktiebolag som ska grundas. Aktiebolaget är således i samma ställning som den helhet som överlåts från NTM-centralerna skulle ha varit.  
Enligt paragrafens 2 mom. ska aktiebolaget i anhängiga förvaltningsärenden, i ett förvaltningsförfarande och ett förvaltningsprocessuellt förfarande utan något särskilt beslut träda in i stället för NTM-centralerna. Momentet innebär att kontinuiteten i förvaltningsförfarandet och det förvaltningsprocessuella förfarandet för tydlighetens skull är tryggad också i anhängiga ärenden. 
25 §.Ställningen för den personal som övergår till trafikstyrnings- och trafikledningsbolaget. I denna paragraf föreskrivs om ordnande av personalens ställning i samband med överföringen till bolaget.  
Bestämmelser om personalens ställning i samband med överlåtelse av rörelse finns för personal i tjänsteförhållande i 2 kap. i statstjänstemannalagen (750/1994) och för personal i arbetsavtalsförhållande i 1 kap. i lagen om arbetsavtal (55/2001).  
När det är fråga om överlåtelse av rörelse ska den personal i tjänste- och arbetsavtalsförhållande som sköter de uppgifter som överförs övergå till ett arbetsavtalsförhållande hos det statliga trafikstyrningsbolag som ska bildas. Visstidsanställda kommer att överföras till bolaget för den tid som anställningen varar. I fråga om bestämmandet av förmåner i arbetsförhållandet anses arbetsförhållandet hos staten ha fortgått utan avbrott.  
På arbetstagarna och anställningsvillkoren i bolaget tillämpas vad som föreskrivs i lagen eller föreskrivs eller bestäms med stöd av den och vad som avtalas i arbetskollektivavtal och arbetsavtal som är bindande för bolaget.  
Enligt statstjänstemannalagens 5 f § 3 mom. är förvärvaren skyldig att iaktta det tjänstekollektivavtal som gäller vid tidpunkten för överlåtelsen, så som bestäms i 5 § i lagen om kollektivavtal (436/1946).  
Enligt 5 e och 5 f § i statstjänstemannalagen (750/1994) överförs de rättigheter och skyldigheter som följer av ett tjänsteförhållande till förvärvaren. Detta gäller emellertid inte de rättigheter och skyldigheter som uttryckligen följer av tjänsteförhållande och inte är utmärkande för ett arbetsavtalsförhållande när en tjänsteman övergår i arbetsförhållande hos förvärvaren. Den personal som överförs är huvudsakligen anställd i tjänsteförhållande. Till den del som det är fråga om personal som är anställd i arbetsavtalsförhållande ska arbetsavtalslagens (55/2001) bestämmelser om överlåtelse av rörelser tillämpas.  
En person som sköter en uppgift som överförs får utan den uppsägningstid som annars ska iakttas eller oberoende av hur länge uppgiften varat säga upp sitt tjänste- eller arbetsavtalsförhållande vid den tidpunkt då överföringen sker. 
De tjänster vid NTM-centralerna som tillhör tjänstemän som övergår i aktiebolagets anställning dras in när denna lag träder i kraft. Då tjänsten dras in upphör tjänstemannens tjänsteförhållande utan uppsägning. 
5 kap. Särskilda bestämmelser 
26 §.Tillämpning av bestämmelserna om temporär förvaltning. I 1 mom. föreslås en bestämmelse som hänvisar till lagen om införande av landskapslagen, lagen om ordnande av social- och hälsovård och lagen om ordnande av räddningsväsendet och gäller tillämpning av bestämmelserna om landskapets temporära förvaltning. Momentet förtydligar att bestämmelserna i 7–9 § i den lagen också ska tillämpas på den lagstiftning som verkställs genom den nu föreslagna lagen. Enligt 6 § 1 mom. i den nämnda införandelagen ska landskapets temporära beredningsorgan svara för beredningen av inledandet av landskapets verksamhet och förvaltning tills landskapsfullmäktige har valts och landskapsstyrelsen som tillsätts har inlett sin verksamhet. Därmed inbegriper det temporära beredningsorganets uppdrag med stöd av införandelagen redan hela beredningen av inledandet av landskapets verksamhet och förvaltning, inklusive beredningen av uppgifterna enligt lagen om enskilda vägar. Paragrafen avses ändå innehålla en klarläggande hänvisning om att beredningsorganets uppgifter och befogenheter enligt 7 § i införandelagen också omfattar uppgiftsöverföringarna till landskapen enligt den föreslagna lagen. På samma sätt ska även skyldigheten att delta i beredning och rätten att få uppgifter gälla uppgiftsöverföringarna till landskapen enligt den föreslagna lagen. 
I 2 mom. föreslås en utvidgning av rätten att få uppgifter enligt 9 § i lagen om införande av landskapslagen, lagen om ordnande av social- och hälsovård och lagen om ordnande av räddningsväsendet. De överföringar av uppgifter som genom den föreslagna lagen görs till landskapen ska också gälla uppgifter som landskapen övertar av utvecklings- och förvaltningscentret (KEHA). Uppgifter kan behövas dels av kommunikationsministeriet, dels också av Trafikverket. Enligt föreslagna 2 mom. ska det temporära organets rätt till information enligt 9 § i införandelagen också gälla uppgifter som innehas av dessa statliga myndigheter.  
27 §.Övergångsbestämmelser som gäller ändringssökande. Denna paragraf innehåller övergångsbestämmelser om ändringssökande. Ändring i ett beslut som har fattats före lagens ikraftträdande kan sökas enligt de bestämmelser som gällde vid ikraftträdandet. Med beslut avses förvaltningsbeslut, beslut med anledning av rättelseyrkande samt beslut som en besvärsmyndighet har fattat i ett ärende. Ändring i beslut som har fattats innan reformen trädde i kraft ska således sökas enligt rättsläget före ändringen, trots att till exempel besvär anförs först år 2020.  
På motsvarande sätt ska på sökande av ändring i ärenden som är anhängiga vid domstol när lagen träder i kraft tillämpas de bestämmelser som gällde vid ikraftträdandet. Detta innebär att också dessa bestämmelser fortfarande ska tillämpas när ändring söks i beslut som är baserade på upphävda bestämmelser.  
Om en domstol däremot upphäver ett beslut som har fattats före lagens ikraftträdande och återförvisar ärendet att i sin helhet behandlas på nytt, ska ärendet behandlas och avgöras enligt denna lag. Sålunda ska till exempel en kommuns beslut som gäller en uppgift som överförts till landskapet behandlas på nytt i landskapet, i enlighet med den lagstiftning som trädde i kraft år 2020. 
28 §.Beredningen av samarbetet mellan landskapen. Ett avtal enligt 15 f § i den föreslagna lagen ska ha börjat gälla och kunna börja tillämpas första gången den 1 januari 2020, då landskapen övertar ansvaret för de väghållningsuppgifter som enligt lagen överförs till dem. Kommunikationsministeriet ska innan uppgifterna överförs kunna försäkra sig om att ett avtal om samarbete över landskapsgränserna finns och att det uppfyller de krav på skötsel av väghållningsuppgifter som avses i 15 f § 2 mom. Dessutom måste landskapen ha tillräckligt med tid att organisera uppgifterna efter det att avtalet godkänts eller, om landskapen inte lyckas nå någon överenskommelse, efter det att statsrådets beslut och det kompletterande avtalet mellan landskapen godkänts. I paragrafen föreskrivs därför att landskapen ska delge kommunikationsministeriet det första samarbetsavtalet senast den 30 juni 2019. På avtal om väghållningsområden ska till övriga delar tillämpas vad som föreskrivs i 1 b kap. i lagen om trafiksystemet och landsvägar. Detta betyder bland annat att landskapen ska bereda ministeriet och Trafikverket i egenskap av väghållare tillfälle att yttra sig om avtalet senast åtta veckor innan det godkänns. Den tidtabell som föreslås i paragrafen ska tillämpas endast på de första avtalen om väghållningsområden. På ändringar i avtal om väghållningsområden och på nya avtal som eventuellt ersätter gamla ska tillämpas den tidtabell som föreskrivs i 1 b kap. i lagen om trafiksystem och landsvägar.  
Enligt regeringens riktlinjer ska de nya landskapen inrättas den 1 juni 2018. Då ska i varje landskap tillsättas ett temporärt beredningsorgan om svarar för beredningen av inledandet av landskapets verksamhet och förvaltning och utöva beslutanderätt till dess att landskapsfullmäktige inleder sin verksamhet. De första landskapsvalen ordnas i oktober 2018. Landskapen skulle sålunda efter att landskapsfullmäktige inlett sin verksamhet ha cirka ett halvt år för beredning och godkännande av avtalet om samarbete i fråga om väghållningen.  
För att det ska kunna säkerställas att avtalen ingås och uppgifterna organiseras inom den tidtabell som nämns ovan bör beredningen av avtalen i de temporära beredningsorganen inledas så snart som möjligt efter det att den föreslagna lagen om trafiksystem och landsvägar har stadfästs och dess slutliga innehåll är känt. Resultaten av denna beredning överförs enligt förslaget på landskapens beredningsansvar efter att de inlett sin verksamhet. 
29 §.Ikraftträdande. I denna paragraf föreskrivs om lagens ikraftträdande. Avsikten är att denna ikraftträdandelag ska träda i kraft så snart som möjligt efter att den godkänts och stadfästs. Dessutom föreskrivs i lagens 1 § att de lagar som nämns där träder i kraft först den 1 januari 2020, dock med undantag av vissa i 1 § 2 mom. nämnda bestämmelser i lagen om ändring av landsvägslagen och lagen om ändring av banlagen. Uppgiftsöverföringarna, personalöverföringarna och egendomsarrangemangen ska enligt förslaget genomföras den 1 januari 2020.  
2
Närmare bestämmelser och föreskrifter
Det föreslås i 1 a kap. 15 e § i lagen om trafiksystem och landsvägar att genom förordning av statsrådet ska kunna utfärdas närmare bestämmelser om förfarandet för utarbetandet och för uppföljningen av den riksomfattande trafiksystemplanen och landskapets trafiksystemplan. 
Enligt landsvägslagens 4 § föreskrivs genom förordning av kommunikationsministeriet om klassificering av landsvägar som riksvägar, stamvägar, regionala vägar och förbindelsevägar och likaså vilka landsvägar som är nationellt viktiga stomvägar. Enligt förslaget till 13 a § 5 mom. får genom förordning av kommunikationsministeriet utfärdas närmare bestämmelser om servicenivån på resor och transporter på landsvägar. I banlagens 4 § 3 mom. föreskrivs på motsvarande sätt att det genom förordning av kommunikationsministeriet bestäms vilka banor som hör till stomnätet för järnvägar. Genom förordning av kommunikationsministeriet kan också utfärdas närmare bestämmelser om stomnätets servicenivå i fråga om förmedlingskapacitet, funktion, hastighet och axellaster samt andra faktorer som påverkar servicenivån. Kommunikationsministeriet inledde i december 2017 en tjänstemannaberedning för bestämmande av stomnätet för landsvägar och järnvägar. 
Enligt 33 § 5 mom. i lagen om trafiksystem och landsvägar ska närmare bestämmelser om nivån på underhållet av landsvägar och underhållsklasserna utfärdas genom förordning av kommunikationsministeriet.  
Enligt 13 § 4 mom. i lagen om trafiksystem och landsvägar får Trafiksäkerhetsverket utfärda föreskrifter om vägkonstruktion, utrustning och trafiktekniska lösningar samt om användning av trafikstyrningsanordningar på landsvägar. 
I 100 § om förberedelser föreskrivs att Trafiksäkerhetsverket bemyndigas att utfärda föreskrifter om väghållarens och landskapens beredskapsplanering. Enligt 100 a § i lagen om trafiksystem och landsvägar föreskrivs att Trafiksäkerhetsverket får utfärda närmare föreskrifter också om innehållet i säkerhetsstyrningssystemet. 
Med stöd av landsvägslagen har tidigare utfärdats statsrådets förordning om landsvägar (924/2005) och kommunikationsministeriets förordning om landsvägsfärjor (20/2006). Med anledning av ändringsförslagen i denna proposition samt för att också i övrigt göra regleringen klarare föreslås det att båda förordningarna justeras. Med stöd av landsvägslagen och banlagen har dessutom utfärdats kommunikationsministeriets förordning om frisiktsområden (65/2011). I den förordningen har inte konstaterats några ändringsbehov till följd av denna proposition eller i övrigt.  
3
Ikraftträdande
Det föreslås att den införandelag som ingår i denna proposition ska träda i kraft så snart som möjligt. I införandelagen föreskrivs huvudsakligen om de övriga lagarnas ikraftträdande, och enligt den ska de träda i kraft den 1 januari 2020.  
Dessutom föreslås övergångsbestämmelser enligt vilka landsvägslagens bestämmelser om klassificering av landsvägar, de allmänna kraven på väghållningen, servicenivån, underhåll, trafiksystemplanering samt ändringen av lagens rubrik ska träda i kraft så snart som möjligt. Också banlagens bestämmelser om de allmänna krav som gäller klassificering av järnvägar och banhållningen ska enligt förslaget träda i kraft så snart som möjligt. De övriga lagarna, i vilka görs endast hänvisningsändringar med anledning av landskapslagens nya rubrik, föreslås träda i kraft samtidigt som den nya rubriken. 
4
Förhållande till grundlagen samt lagstiftningsordning
Demokrati 
Enligt grundlagens 2 § hör principen om demokrati till statsskickets grunder. Enligt den principen ska all offentlig maktutövning ha demokratisk grund (GrUU 67/2014 rd). Bestämmelserna om demokrati i grundlagens 2 § hänger samman med grundlagens 14 §. I den paragrafen föreskrivs om rösträtt och rätt till inflytande. När det gäller landskapens uppgifter kommer demokratin att förverkligas genom direkta val, dvs. landskapsval. I fortsättningen kommer landskapens uppgifter att inbegripa trafiksystemplanering och landskapen kommer att delta i väghållningsbesluten genom planen för väghållning och trafik, avtalet om väghållning och väghållningen inom samarbetsområdena för väghållning. På så sätt förstärks demokratin inom trafiksystemplaneringen och väghållningen. Också möjligheterna till inflytande ökar, särskilt genom möjligheten att påverka den riksomfattande trafiksystemplaneringen. Det har inte tidigare funnits några bestämmelser i lag om beslut som gäller det rikstäckande trafiksystemet och det tillhörande förfarandet.  
Rättsstatsprincipen och förvaltningens lagbundenhet 
Enligt 2 § 3 mom. i grundlagen ska all utövning av offentlig makt bygga på lag och lag ska noggrant iakttas i all offentlig verksamhet. Iakttagandet av rättsstatsprincipen förutsätter att den som utövar offentlig makt alltid ska ha en behörighetsgrund som i sista hand återgår på en av riksdagen stiftad lag (RP 1/1998 rd, s. 75 och GrUU 29/2013 rd, s. 2/I). En myndighet kan således inte ha behörighet att utöva offentlig makt om behörigheten saknar uttryckligt stöd i rättsordningen.  
Utgångspunkten är att det alltid ska framgå av lag vilken myndighet som är behörig (GrUU 67/2010 rd, s. 5). Grundlagsutskottet har i praktiken förhållit sig återhållsamt till möjligheten att avvika från bestämmelserna om behörig myndighet. Utskottet har särskilt när det gäller bestämmelser som har kopplingar till de grundläggande fri- och rättigheterna ansett att den behöriga myndigheten entydigt eller annars exakt ska framgå av lagen eller att åtminstone utgångspunkterna för myndigheternas behörighetsförhållanden och villkoren för att delegera behörighet framgå tillräckligt exakt av lagen (GrUU 49/2014 rd, s. 4/II, GrUU 32/2012 rd, s. 6, GrUU 21/2009 rd, s. 4–5, GrUU 19/2009 rd, s. 3–4, GrUU 3/2009 rd, s. 4, GrUU 51/2006 rd, s. 9, GrUU 24/2006 rd, s. 2–3, GrUU 18/2004 rd, s. 2, GrUU 17/2004 rd, s. 2, GrUU 65/2002 rd, s. 4, GrUU 47/2001 rd, s. 3, GrUU 45/2001 rd, s. 5, GrUU 21/2001 rd, s. 4, GrUU 7/2001 rd, s. 4). En myndighet kan sålunda inte genom lag ges helt gränslösa befogenheter att överföra sina uppgifter eller behörigheter till en annan myndighet (GrUU 9/2014 rd, s. 3; GrUU 61/2010 rd, s. 5 – jfr GrUU 11/2002 rd, s. 6–7; GrUU 35/2008 rd, s. 3, GrUU 14/2008 rd, s. 3, GrUU 8/2006 rd, s. 4, GrUU 19/2005 rd, s. 8, GrUU 11/2004 rd, s. 2, GrUU 14/2003 rd, s. 3, GrUU 72/2002 rd, s. 2–3, GrUU 52/2001 rd, s. 5, GrUU 29/2013 rd, s. 2, GrUU 55/2005 rd, s. 3, GrUU 47/2005 rd, s. 5–6).).  
I denna proposition föreslås att de väghållningsuppgifter som landskapen tilldelas delvis ska organiseras genom avtalsarrangemang mellan staten och landskapens samarbetsområde. I lagen ska emellertid föreskrivas om de grundläggande lösningarna när det gäller uppgiftsfördelningen mellan staten och landskapen. Med andra ord kommer befogenheterna att sköta uppgifter inte enbart att följa av avtal. Dessutom innehåller den föreslagna lagen bestämmelser om vad avtalet mellan staten och landskapen ska innehålla. De föreslagna avtalsarrangemangen och den utövning av offentlig makt som de innebär bygger således på lag, och lagen innehåller från grundlagens synpunkt tillräckligt exakta bestämmelser om avtalsförfarandet, vilka myndigheter som ansvarar för uppgifterna och om innehållet i avtalen.  
I lagen föreskrivs om flera av landskapens uppgifter som ska skötas i samarbete inom väghållningsområdena. Väghållningsområdena utgör emellertid inte separata juridiska personer, vilket innebär att det i sista hand är landskapen som kommer att ansvara för uppgifterna i fråga. Landskapen kan enligt förslaget inom ramen för de samarbetsformer som avses i den föreslagna landskapslagens 8 kap. avtala om ansvarsfördelningen mellan landskapen i samarbetsavtalen om väghållningsområdena. Arrangemanget kan anses vara tillräckligt exakt från grundlagens synpunkt.  
De grundläggande fri- och rättigheterna 
Enligt grundlagens 21 § 2 mom. ska garantierna för god förvaltning tryggas genom lag. Begreppet god förvaltning får sin innebörd av 21 § i dess helhet. Därmed avses dels de i paragrafens 1 mom. nämnda kraven att ärenden ska behandlas utan ogrundat dröjsmål och av en behörig myndighet och dels också den förteckning över delmomenten i en god förvaltning som framgår av 2 mom. I bestämmelsen räknas upp de viktigaste delmomenten i en god förvaltning, dvs. offentligheten vid handläggningen, rätten att bli hörd, rätten att få motiverade beslut och rätten att söka ändring. Enligt grundlagens 14 § 4 mom. ska det allmänna främja den enskildes möjligheter att delta i samhällelig verksamhet och att påverka beslut som gäller honom eller henne själv.  
Många av propositionens förslag kommer att öka öppenheten och offentligheten när det gäller förfarandena för väghållning och utvecklingen av trafiksystemet samt individens möjligheter att påverka dessa förfaranden. Enligt bestämmelserna om den riksomfattande trafiksystemplanen ska viljebildningen på statlig nivå när det gäller utvecklingen av trafiksystemet öppet skrivas ut i ett beslut på statsrådsnivå, och beredningen av den riksomfattande trafiksystemplanen måste ske öppet i samarbete med alla landskap och andra myndigheter till vars ansvarsområde trafiksystemet har en koppling samt med näringslivet. Beredningen kommer dessutom att ge alla möjligheter att uttrycka sin åsikt om planutkast. Också i fråga om landskapens trafiksystemplanering ska alla beredas tillfälle att komma med synpunkter på utkastet. På samma sätt synliggörs riktlinjerna för och finansieringen av väghållningen samt de valda prioriteringarna inom dessa i större utsträckning till följd av förfarandet som gäller väghållningsavtalet samt planen för väghållning och trafik. Detta bidrar till att främja en god förvaltning. 
Landsvägslagen innehåller flera bestämmelser som gäller egendomsskyddet enligt grundlagens 15 § och tryggandet av detta. Propositionen innehåller emellertid inga förslag om ändring av de bestämmelserna.  
Delegering av lagstiftningsbehörighet 
Enligt grundlagens 18 § 1 mom. kan kommunerna åläggas uppgifter genom lag. Förordningar kan utfärdas av presidenten, statsrådet och ministerierna. En förutsättning för utfärdande av förordning är att det i lag finns både grundläggande bestämmelser om saken och ett bemyndigande. När det gäller ärenden som hör till lagstiftningens område kan genom förordningen endast utfärdas närmare bestämmelser. Genom förordning kan utfärdas bestämmelser också om annat, om det i lag föreskrivs om ett bemyndigande att utfärda förordning. På grund av det parlamentariska ansvaret ska en sådan förordning utfärdas av statsrådet, om inte något annat särskilt föreskrivs i lag. Utgångspunkten är den att statsrådets allmänna sammanträde utfärdar förordningar om vittbärande och principiellt viktiga ärenden samt om andra ärenden vilkas betydelse kräver det. Ministerierna kan bemyndigas att utfärda förordning i fråga om ärenden av en mera teknisk karaktär samt i ärenden som har en mindre samhällelig och politisk betydelse (Regeringens proposition till riksdagen med förslag till ny Regeringsform för Finland, RP 1/1998 rd).  
Enligt den princip som framgår av grundlagens 80 § kan lagstiftningsbehörighet i allmänhet inte delegeras till en lägre myndighetsnivå än ett ministerium. Endast i undantagsfall kan behörighet att utfärda rättsnormer delegeras till en annan myndighet. I grundlagen föreskrivs om denna möjlighet att bemyndiga en annan myndighet att utfärda rättsnormer genom lag i särskilda ärenden (Grundlagsutskottets betänkande om revidering av grundlagen, GrUB 10/1998 rd). Enligt grundlagens 80 § 2 mom. kan myndigheter genom lag bemyndigas att utfärda rättsnormer i bestämda frågor, om det med hänsyn till föremålet för regleringen finns särskilda skäl och regleringens betydelse i sak inte kräver att den sker genom lag eller förordning. Dessutom ska tillämpningsområdet för ett sådant bemyndigande enligt grundlagen vara exakt avgränsat. Ett särskilt skäl föreligger bland annat i samband med frågor av mindre betydelse (GrUU 52/2001 rd och GrUU 46/2001 rd) och frågor utan större prövningsrätt (GrUU 43/2000 rd). Ett sådant bemyndigande ska kunna ges endast genom en lag och det ska vara exakt avgränsat i fråga om tillämpningsområdet (RP 1/1998 rd). 
I propositionen ingår flera bestämmelser om bemyndiganden. En del av dem gäller sådana närmare bestämmelser som utfärdas genom förordning av statsrådet eller kommunikationsministeriet. Genom Trafiksäkerhetsverkets föreskrifter regleras dessutom vissa detaljerade omständigheter av teknisk karaktär. Enligt grundlagens 80 § ska genom lag utfärdas bestämmelser om grunderna för individens rättigheter och skyldigheter samt om frågor som enligt grundlagen i övrigt hör till området för lag. Genom de bemyndiganden att utfärda förordningar och föreskrifter som föreslås i propositionen regleras inte grunderna för individens rättigheter, skyldigheter eller grundläggande rättigheter.  
I 4 § i den föreslagna lagen om trafiksystem och landsvägar föreskrivs om kommunikationsministeriets behörighet att utfärda förordning om klassificering av landsvägar. Enligt 4 § i den gällande lagen föreskrivs att kommunikationsministeriet bestämmer vilka landsvägar som är riksvägar och vilka som är stamvägar samt till vilken del de är nationellt viktiga stomvägar, medan Trafikverket bestämmer vilka landsvägar som är regionala vägar och vilka som är förbindelsevägar. Den gällande lagens 4 § är otydlig och har inte ansetts innebära bemyndigande att utfärda föreskrifter. I propositionen föreslås en sådan ändring att i paragrafen föreskrivs om bemyndigande att utfärda förordning så att grundlagens krav på exakthet och noggrann avgränsning uppfylls.  
Enligt förslaget ska genom förordning av kommunikationsministeriet i fortsättningen föreskrivas som indelning av landsvägarna i riksvägar, stamvägar, regionala vägar och förbindelsevägar. Indelningen i riksvägar, stamvägar, regionala vägar och förbindelsevägar har redan i decennier varit vedertagen praxis. Både i den gällande landsvägslagen och i propositionen föreskrivs om denna indelning av landsvägarna. Bemyndigandet att utfärda förordning föreslås bli avgränsat till klassificering av landsvägarna i de ovannämnda fyra kategorierna. Därmed kan normgivningsbemyndigandet anses uppfylla grundlagens krav på exakt avgränsning. Genom förordning av kommunikationsministeriet ska närmare föreskrivas också till vilka delar landsvägarna hör till det nationellt viktiga stomnätet. Vidare föreslås att till lagen fogas en allmän definition av landsvägarnas stomnät. I lagen föreskrivs sålunda om grunderna för definitionen av begreppet stomnät. Den lagstadgade definitionen ska enligt förslaget preciseras genom en mera detaljerad statsrådsförordning där det föreskrivs till vilka delar landsvägarna hör till stomnätet. Förordningsbemyndigandet ska enligt förslaget begränsas till att gälla vilka landsvägar som hör till det nationellt viktiga stomnätet. Därmed kan bemyndigandet anses uppfylla grundlagens krav på exakt avgränsning. De nämnda förordningsbemyndigandena kan lämpligen ges ministerierna eftersom det är fråga om ärenden av teknisk karaktär. Från helhetssynpunkt är det dessutom rationellt att samma myndighet bestämmer om klassificeringen av vägarna. I banlagens 4 § om klassificering av stomnätet för järnvägar föreslås motsvarande ändring och ett nytt förordningsbemyndigande för kommunikationsministeriet. Också detta måste på ovan nämnda grunder anses vara förenligt med grundlagen.  
Enligt 13 § i den föreslagna lagen om trafiksystem och landsvägar ska Trafiksäkerhetsverket bemyndigas att utfärda föreskrifter som i syfte att trygga de krav som avses i 13 § 2 mom. preciserar de bestämmelser som gäller vägkonstruktion, utrustning och trafiktekniska lösningar samt användning av landsvägar och begränsningar i samband med dem. Grundläggande bestämmelser om dessa krav finns i 13 § 2 mom. Förordningsbemyndigandet avgränsas enligt förslaget för det första endast till säkerställande av vissa målsättningar. För det andra avgränsas normgivningsbemyndigandet i fråga om vilken typ av föreskrifter som kan komma i fråga och för vilka ändamål föreskrifter kan utfärdas. För det tredje begränsas normgivningsbemyndigandet i fråga om de ärenden som föreskrifterna kan gälla. Tillämpningsområdet begränsas till väghållningsfrågor. Därmed kan det normgivningsbemyndigandet anses uppfylla grundlagens krav på exakt avgränsning. Det är huvudsakligen fråga om bestämmelser av teknisk karaktär som det varken är skäl eller ändamålsenligt att ta in i en lag eller förordning. Det finns sålunda särskilda skäl för normgivningsbemyndigandet. Det föreslås att Trafiksäkerhetsverket får motsvarade normgivningsbemyndigande enligt banlagens 5 §, vars utformning och delvis också innehåll motsvarar 13 § i lagen om trafiksystem och landsvägar. Också banlagens nämnda normgivningsbemyndigande måste på de grunder som nämns ovan anses vara förenligt med grundlagen.  
I den föreslagna lagen om trafiksystem och landsvägar ingår nya bestämmelser om servicenivån när det gäller resor och transporter på landsvägar samt nivån på underhållet av landsvägar. Enligt lagens 13 a § 5 mom. kan genom förordning av kommunikationsministeriet utfärdas närmare bestämmelser om servicenivån på resor och transporter. Också enligt 33 § 5 mom. kan genom förordning av kommunikationsministeriet utfärdas närmare bestämmelser om nivån på landsvägarnas underhåll och närmare klassificering av underhållet. I fråga om båda bestämmelserna ska enligt förslaget genom lag utfärdas grundläggande bestämmelser om vilka ärenden som kan preciseras genom förordningsbemyndiganden. I lagen definieras också begreppen underhåll och servicenivå, vilket för sin del preciserar förordningsbemyndigandena. Båda förordningsbemyndigandena innebär dessutom avgränsning till nivårelaterade preciserande bestämmelser, vilket betyder att de inte ger möjlighet att föreskriva om väghållningsmetoder för uppnående av den nivå som förutsätts. De nämnda förordningsfullmakterna kan sålunda anses uppfylla grundlagens krav på noggrann avgränsning. Det är fråga om en sådan närmare teknisk reglering av kravnivåerna, som det är sakligt och ändamålsenligt att utfärda genom förordning av kommunikationsministeriet.  
Också i banlagens 4 § föreskrivs att kommunikationsministeriet bemyndigas att utfärda förordning med närmare bestämmelser om stomnätets servicenivå i fråga om förmedlingskapacitet, funktion, hastighet och axellaster samt andra faktorer som påverkar servicenivån. Detta förordningsbemyndigande gäller endast stomnätets servicenivå. Genom bemyndigandet preciseras dessutom vilka på servicenivån inverkande faktorer som kan regleras genom närmare bestämmelser. I banlagens 4 § föreslås dessutom grundläggande bestämmelser om stomnätets servicesyfte och ställning, som kunde preciseras genom en förordning. På motsvarande sätt som förordningsbemyndigandet i fråga om landsvägarnas servicenivå skulle begränsas till preciserande bestämmelser om nivån, skulle genom dem sålunda inte kunna föreskrivas om de väghållningsmetoder som väljs för att uppnå den förutsatta nivån. Förordningsbemyndigandet kan sålunda anses uppfylla grundlagens krav på exakt avgränsning. Det är fråga om en närmare teknisk reglering av kravnivåerna och det skulle i sak vara ändamålsenligt att utfärda bestämmelserna genom en förordning av kommunikationsministeriet.  
I 100 § i den föreslagna lagen om trafiksystem och landsvägar föreskrivs att Trafiksäkerhetsverket ska bemyndigas att utfärda förordning om väghållarens och landskapens skyldighet att upprätta en beredskapsplan för att säkerställa att förberedelserna är enhetliga i hela landet samt motsvarar behoven som gäller undantagsförhållanden och störningar i de normala förhållandena på landsvägar. I 100 § föreslås vidare bestämmelser om grunderna för väghållarens och landskapens beredskapsplanering. I paragrafens 1 mom. föreskrivs om omständigheter som ska beaktas vid förberedelserna. I och med normgivningsbemyndigandet kan Trafiksäkerhetsverket utfärda närmare bestämmelser om beredskapsplaneringen, vilket innebär detaljerad, teknisk och preciserande reglering utöver vad som föreskrivs i lagen. Trafiksäkerhetsverket är ett sakkunnigämbetsverk när det gäller förberedelse- och beredskapsärenden inom trafikförvaltningen. Det är förenligt med dess verksamhetsområde att utfärda närmare föreskrifter om beredskapsplanering. Normgivningsbemyndigandet är också i fråga om tillämpningsområdet avgränsat till att gälla beredskapsplanering som ankommer på väghållaren och landskapen. Bemyndigandet är också begränsat till situationer där det behövs närmare föreskrifter för säkerställande av förberedelsernas enhetlighet i hela landet och behoven i på landsvägarna. Normgivningsbemyndigandet kan sålunda anses uppfylla de krav på exakt avgränsning som grundlagen ställer.  
I 100 a § i den föreslagna lagen om trafiksystem och landsvägar föreskrivs om Trafikverkets säkerhetsstyrningssystem. Enligt paragrafens 4 mom. får Trafiksäkerhetsverket utfärda närmare föreskrifter om innehållet i säkerhetsstyrningssystemet. Till verksamhetsområdet för Trafiksäkerhetsverket hör säkerheten inom alla trafikformer, vilket innebär att det råder ett fast samband mellan å ena sidan normgivningsbemyndigandet och å andra sidan ämbetsverkets roll och verksamhetsområde inom trafikförvaltningen. Paragrafen innehåller grundläggande bestämmelser om målsättningarna för och upprättandet av säkerhetsstyrningssystemet samt om frågor som gäller dess innehåll. Normgivningsbemyndigandet gör det sålunda möjligt att precisera dessa bestämmelser och bemyndigandet avgränsas så exakt att det gäller endast innehållet i säkerhetsstyrningssystemet.  
Regional självstyrelse 
De centrala elementen i den kommunala självstyrelsen är enligt grundlagens 121 § självstyrelse för kommunens invånare, genom lag utfärdade bestämmelser om de allmänna grunderna för kommunernas förvaltning och kommunernas uppgifter samt beskattningsrätten. I grundlagens 121 § 4 mom., som gäller självstyrelse på större förvaltningsområden än kommuner, föreskrivs inte om de centrala elementen i självstyrelsen på samma sätt som i fråga om den kommunala självstyrelsen. Enligt grundlagen ska bestämmelser om de centrala elementen i självstyrelsen utfärdas genom lag. Elementen i landskapens självstyrelse kan granskas utifrån den kommunala självstyrelsen.  
Grundlagens 121 § är baserad på grundlagsutskottets etablerade praxis som utformades redan då regeringsformen var i kraft. Enligt den praxisen innebär den kommunala självstyrelsen att kommuninvånarna har rätt att besluta om sin kommuns förvaltning och ekonomi (statsandelssystemet och den kommunala självstyrelsen, bland annat GrUU 16/2014 rd och GrUU 40/2014 rd). Självstyrelsen innebär vidare att kommuninvånarna har rätt till förvaltningsorgan som de själva valt (RP 1/1998 rd, s. 175/II och GrUU 63/2014 rd, s. 2/II). Det går inte att genom vanliga lagar göra sådana ingrepp i självstyrelsens mest centrala särdrag att den urholkas i sak (GrUU 20/2013 rd, s. 5–7, GrUU 22/2006 rd, s. 2/II och GrUU 31/1996 rd, s. 1/I).  
Grundlagsutskottet har ändå i sin praxis ansett det vara möjligt att genom vanlig lag föreskriva om tvångssamkommuner och motsvarande kommunala samarbetsorgan, även om det i någon mån inskränker kommunernas självstyrelse att de genom lag förpliktas att medverka i en samkommun. När utskottet har bedömt arrangemangen för ett påtvingat kommunalt samarbete har det exempelvis tagit fasta på samverkansuppgifternas överkommunala karaktär, en rationell organisering av uppgifterna och det faktum att beslutsmekanismen inte ger någon enskild kommun möjlighet att få ensidig bestämmanderätt (GrUU 22/2006 rd, s. 2/II och s. 3–4, GrUU 65/2002 rd, s. 2–3 och GrUU 32/2001 rd, s. 2/II). En annan sak som har tillmätts betydelse är om arrangemanget väsentligt har inskränkt de deltagande kommunernas allmänna verksamhetsområde (GrUU 65/2002 rd, s. 3/II och GrUU 11/1984 rd, s. 2/II). Grundlagsutskottet har inte heller, med beaktande av särdragen i landskapens självstyrelse, ansett det vara problematiskt att inrätta landskap och att landskapen enligt propositionen om ordnande av social- och hälsovården åläggs samarbetsförpliktelser, men utskottet förutsätter att det tillräckligt exakt på lagnivå föreskrivs om bildandet av samarbetsområden och om statens rätt att styra samarbetet (GrUU 26/2017 rd).  
Grundlagsutskottet har ansett det vara problematiskt att öka uppgifterna för kommunernas samverkansorgan i en sådan utsträckning och på ett sådant sätt att detta väsentligen påverkar medlemskommunernas förvaltning och äventyrar den med den kommunala självstyrelsen sammanhängande principen att kommunens beslutanderätt ska utövas av organ som kommuninvånarna själva har valt (GrUU 65/2002 rd, s. 3 och GrUU 11/1984 rd, s. 2/II). Utskottet har i fråga om frivilligt kommunalt samarbete inom regionerna konstaterat (GrUU 11a/1984 rd, s. 2/I) att det med hänsyn till demokratiprincipen i den kommunala självstyrelsen som värnas i grundlagens 121 § vore besvärlig om kommunal beslutanderätt och kommunala uppgifter i stor skala överfördes till ett regionalt organ. Utskottet anser att denna synpunkt gäller och i sista hand inskränker kommunernas möjlighet att enligt kommunallagen överföra sina uppgifter till samkommuner (GrUU 37/2006 rd, s. 5/II, GrUU 22/2006 rd, s. 2 och GrUU 65/2002 rd, s. 3/I).  
Statsrådets bestämmanderätt i fråga om den kommunala självstyrelsen är en betydelsefull omständighet med tanke på kommunernas självstyrelse. Det har inte ansetts att sådan bestämmanderätt strider mot den grundlagsfästa kommunala självstyrelsen när statsrådets behörighet har begränsats av andra bestämmelser i lag om samverkan och av de allmänna rättsprinciperna inom förvaltningen och då statsrådets beslut har varit överklagbara och gällt endast till dess att kommunerna har kommit överens om samarbetet. Bestämmelserna om statsrådets behörighet måste dock vara tillräckligt exakta (GrUU 20/2013 rd, s. 5–6, GrUU 21/2009 rd, s. 4/II och GrUU 32/2001 rd, s. 3/I). Grundlagsutskottet har i sin praxis betonat att man när man lagstiftar om nya uppgifter också måste se till att kommunerna har faktiska möjligheter att klara av dem (GrUU 41/2014 rd, s. 3/II, GrUU 36/2014 rd, s. 3, GrUU 34/2013 rd, GrUU 30/2013 rd, s. 5, GrUU 42/2010 rd, s. 5/II, GrUU 29/2009 rd, s. 2, GrUU 50/2005 rd, s. 2/I, och GrUU 41/2002 rd, s. 3/II).  
Enligt den föreslagna lagen ska staten kvarstå som väghållare och staten företräds då av Trafikverket, vilket redan nu är fallet. I lagen föreslås en bestämmelse enligt vilken Trafikverket ska vara väghållare. Staten ska också fortsättningsvis vara ägare till landsvägarna. Staten kommer sålunda också i fortsättningen att i sista hand ansvara för väghållningen. I väghållningen ingår också förvaltning av statens egendom. Därför kommer finansieringen av väghållningen att ordnas som särskild finansiering vars användning i landskapen kommer att styras i enlighet med väghållningsavtal mellan väghållningsområdet och väghållaren.  
Landskapens självstyrelse kan parallellt med kommunernas självstyrelse framför allt anses innebära att landskapsinvånarna har rätt att besluta om landskapets förvaltning och ekonomi. I fråga om väghållningen kommer landskapen emellertid inte att självständigt kunna besluta hur de finansiella resurserna används eller om väghållningsåtgärderna och hur de ordnas, vilket innebär att landskapens handlingsutrymme när det gäller beslut om finansiering och andra frågor kommer att vara synnerligen begränsat. Väghållningen kommer i fortsättningen att i enlighet med den föreslagna lagen att vara en delad uppgift mellan staten och landskapens samarbetsområden. Det är staten som står för kostnaderna och som också i sista hand bär ansvaret. Avtalsförfarandet som enligt förslaget innebär att man avtalar om finansieringen och ordnandet av väghållningen och som landskapen för sin del kan påverka, kan anses vara godtagbart med tanke på landskapens självstyrelse. Landskapens självstyrelse begränsas också av de ovan behandlade normgivningsbemyndigandena i fråga om väghållningen. Bemyndigandena ska dock framför allt gälla förvaltning av statens egendom och fokusera på tekniska och kvalitativa frågor avseende landsvägar och väghållning. Bemyndigandena har inte någon betydelse för hur landskapens förvaltning organiseras i övrigt.  
Enligt den föreslagna landskapslagens 7 § 1 mom. kan organiseringen av landskapens uppgifter genom lag samlas på ett eller flera landskap, om det är nödvändigt för att förbättra kvaliteten och tillgången på tjänster, främja tillgodoseendet av språkliga rättigheter eller garantera tillräckliga personalresurser och andra resurser eller tillräcklig särskild expertis som behövs för den berörda uppgifter eller om det är nödvändigt av någon annan motsvarande och grundad anledning. I föreslagna 15 f § föreskrivs att landskapen ska avtala om samarbete för skötseln av den väghållning som de har organiseringsansvar för inom högst nio samarbetsområden för väghållning. Avsikten med samarbetsskyldigheten är att se till att väghållningen sköts kostnadseffektivt, enhetligt, sakkunnigt och långsiktigt samt att landsvägarnas servicenivå är tillräckligt hög och att kundernas behov beaktas. Landskapen ska själva få avtala om samarbetsformen på det sätt som föreskrivs i landskapslagens 8 kap.  
Den samlade väghållningen sker över landskapsgränserna och den ska beakta dels nationella aspekter och dels regionala aspekter, ofta i ett mer omfattande perspektiv än inom ett landskaps administrativa gränser. Det är ändamålsenligt att förplikta landskapen att utföra väghållningsuppgifter i samarbete så att det går att säkerställa behövliga resurser och tillräcklig expertis oberoende av de administrativa gränserna. Samarbetet ska organiseras på det sätt som landskapen kommer överens om och med iakttagande av vad landskapslagen föreskriver om formerna för frivilligt samarbete mellan landskapen. Beslutsmekanismen vid samarbetet ger således inte något enskilt landskap möjlighet att få ensidig bestämmanderätt.  
Enligt lagförslagets 15 h § får statsrådet utfärda behövliga föreskrifter om landskapens samarbete för skötseln av väghållningsuppgifterna, om landskapen inte kommer överens om saken. Med andra ord kan statsrådet, i stället för den rätt att avtala om saken som landskapen har enligt 15 f §, då ensidigt bestämma hur samarbetet ska organiseras, vilket har betydelse med tanke på landskapens självstyrelse.  
Statsrådets bestämmanderätt begränsas ändå av de krav som föreskrivs i 15 f § gällande landskapens samarbete och av 15 h § 2 mom. där det föreskrivs vilka ärenden statsrådet får fatta beslut om. Bestämmanderätten begränsas också av de allmänna rättsprinciper som gäller inom förvaltningen. Statsrådets beslut ska i ett senare skede kunna ersättas av avtal som landskapen ingår i enlighet med 15 f §. Vid beredningen av statsrådets beslut ska de landskap höras som beslutet gäller. Beslutet ska vara överklagbara. Det kan således inte anses att statsrådets bestämmanderätt avsevärt begränsar landskapens självstyrelse.  
Med tanke på en konstitutionell bedömning av regleringen har det betydelse att det föreslagna avtalsförfarandet inte ger ett enskilt landskap en ställning som möjliggör bestämmanderätt (jfr GrUU 67/2014 rd och GrUU 37/2006 rd samt de utlåtanden som nämns där).  
Överföring av förvaltningsuppgifter på andra än myndigheter 
Enligt grundlagens 124 § kan offentliga förvaltningsuppgifter anförtros andra än myndigheter endast genom lag eller med stöd av lag, om det behövs för en ändamålsenlig skötsel av uppgifterna och det inte äventyrar de grundläggande fri- och rättigheter, rättssäkerheten eller andra krav på god förvaltning. Enligt motiveringen till grundlagen ska offentliga förvaltningsuppgifter i samband med grundlagens 124 § förstås som en relativt omfattande helhet av administrativa uppgifter, inklusive exempelvis uppgifter i anslutning till verkställighet av lagar samt beslutsfattande som gäller enskilda personers och sammanslutningars rättigheter, skyldigheter och förmåner (RP 1/1998 rd, s. 61 och 179).  
Grundlagsutskottet har i sin praxis vid tolkningen av begreppet offentliga förvaltningsuppgifter för det första uppmärksammat vissa uppgifters karaktär och särdrag. Utskottet har vidare beaktat om det föreskrivs om uppgifterna i lag och likaså om en viss aktör vid skötseln av uppgifterna handlar inom ramen för myndigheternas bestämmande-, styrnings- eller övervakningsrätt. Dessutom har avseende fästs bland annat vid rättsverkningarna av en viss uppgift och beslutsfattandet i anslutning till den (se t.ex. GrUU 5/2014 rd och GrUU 53/2014 rd). Enligt grundlagsutskottets praxis behöver en uppgift som betraktas som en offentlig förvaltningsuppgift inte nödvändigtvis innebära utövning av offentlig makt. Exempelvis i samband med rådgivning är det trots verksamhetens biträdande karaktär fråga om skötsel av en offentlig förvaltningsuppgift, eftersom rådgivning enligt förvaltningslagens 8 § hör till myndighetens lagstadgade uppgifter. Utskottet har i sin praxis ansett att biträdande uppgifter genom avtal kan överföras på andra aktörer än myndigheter, förutsatt att överföringen är baserad på lag (se t.ex. GrUU 47/2005 rd, s. 6/I). Offentliga förvaltningsuppgifter kan med stöd av grundlagens 124 § sålunda också genom ett avtal enligt lag anförtros andra än myndigheter.  
Trots att det i samband med sådana uppgifter i terräng som avses i de 99 b § som föreslås i lagen om trafiksystem och landsvägar är fråga om produktion av information och tekniskt material som myndigheten tolkar när den fattar beslut, är det med beaktande av den extensiva tolkning som grundlagsutskottet i sin praxis gett begreppet offentliga förvaltningsuppgifter möjligt att uppgifterna i fråga betraktas som offentliga förvaltningsuppgifter som kan anförtros andra än myndigheter endast genom lag eller med stöd av lag. I nämnda 99 b § föreskrivs om överföring av sådana uppgifter till privata tjänsteleverantörer.  
Enligt grundlagsutskottets tolkningspraxis innebär tryggande av kraven på rättssäkerhet och god förvaltning, i den bemärkelse som avses i grundlagens 124 §, att de allmänna förvaltningslagarna ska iakttas när ärenden behandlas och att de som handlägger ärendena handlar under tjänsteansvar (GrUU 33/2004 rd, s. 7/II och GrUU 46/2002 rd, s. 10). Numera är det emellertid inte längre nödvändigt att på grund av grundlagens 124 § hänvisa till allmänna förvaltningslagar (GrUU 11/2006 rd, s. 3). Om en sådan reglering för tydlighetens skull emellertid anses behövlig, måste hänvisningen vara omfattande för att e contrario-tolkning ska undvikas (GrUU 42/2005 rd, s. 3). För tydlighetens skull hänvisas i 99 b § emellertid också till dessa allmänna lagar.  
Grundlagsutskottet har i sin praxis ansett att skötseln av sådana offentliga förvaltningsuppgifter som avses i grundlagens 124 § i princip förutsätter att de fysiska personer som sköter uppgifterna handlar under tjänsteansvar (GrUU 8/2014 rd, s. 5/I, GrUU 29/2013 rd, s. 2, GrUU 18/2007 rd, s. 7/I, GrUU 20/2006 rd, s. 2 och GrUU 33/2004 rd, s. 7/II).  
Sammanfattning 
Med stöd av det som anförs ovan anses lagförslaget vara förenligt med grundlagens bestämmelser om demokrati, förvaltningens lagbundenhet, de grundläggande fri- och rättigheterna, delegering av lagstiftningsbehörighet och regional självstyrelse. Därför anses det att lagförslagen kan behandlas i vanlig lagstiftningsordning.  
Med stöd av det som anförs ovan föreläggs riksdagen följande lagförslag: 
Lagförslagag
1. 
Lag 
om ändring av landsvägslagen 
I enlighet med riksdagens beslut 
upphävs i landsvägslagen (503/2005) 9 §, 
ändras lagens rubrik samt 1–4, 6, 8, 10, 11,13, 16, 17, 19, 22, 24, 27, 30–32, 32 a, 33–40, 42, 42 a, 42 b, 43–45, 47–49, 51, 52, 52 b, 53 a, 54, 56, 56 a, 57, 62, 69, 74, 75, 79–81, 83, 85, 88, 90, 91, 93, 95, 95 a, 99, 99 a, 101–105, 107 och 108 §,  
av dem 4, 6, 27 och 104 sådana de lyder delvis ändrade i lag 1242/2009, 10, 11, 17, 24, 31, 31, 32, 32 a, 34, 36–38, 40, 42, 42 a, 42 b, 44, 52, 52 b, 53 a, 56, 56 a, 74, 80, 83, 90, 91, 95, 95 a, 99 a, 101, 103, 105, 107 och 108 § sådana de lyder i lag 566/2016, 22 och 45 § sådana de lyder delvis ändrade i lag 566/2016, 41 och 99 § sådana de lyder i lag 1242/2009 och 79 § sådan den lyder i lag 1628/2015 samt 
fogas till lagen en ny 13 a §, nya 1a och 1 b kap., nya 15 q – 15 s, 27 a, 27 b och 99 b § 
och en ny 100 §, i stället för den 100 § som upphävts genom lag 566/2016 samt nya 100 a, 100 b, 108 a och 109 a § som följer: 
 
Lag om trafiksystem och landsvägar 
1 § 
Lagens syfte 
Syftet med denna lag är att organisera trafiksystemplaneringen så att dess riksomfattande och regionala mål samordnas och skapa förutsättningar för ett fungerande trafiksystem som kan utvecklas.  
Syftet med denna lag är också att upprätthålla och utveckla landsvägsförbindelserna som en del av trafiksystemet så att de fungerar, är trygga, främjar en hållbar utveckling och tillgodoser trafik- och transportbehoven samt att säkerställa ett enhetligt landsvägsnät och en enhetlig servicenivå i hela landet. Dessutom är syftet med lagen att trygga möjligheterna att delta i planeringen av statsägda landsvägar genom att genomföra och främja god förvaltning och gott rättsskydd i ärenden som gäller landsvägar.  
2 § 
Tillämpningsområde 
Denna lag innehåller bestämmelser om trafiksystemplanering på riks- och landskapsnivå inom alla trafikformer och färdsätt.  
Denna lag innehåller också bestämmelser om landsvägar och deras servicenivå, om väghållning och ordnande av uppgifter som gäller den, om avtal, styrning och andra arrangemang i anknytning till väghållning samt om de rättigheter och skyldigheter som staten, landskapen och övriga myndigheter har samt om fastighetsägares och övriga sakägares rättsliga ställning.  
3 § 
Definitioner 
I denna lag avses med 
1) trafiksystem den helhet som består av person- och godstrafik inom alla trafikformer, av de trafiknät som betjänar dessa, av kommunikationsförbindelser och information, samt av i lagen om transportservice (320/2017) avsedda tjänster, trafikmedel och system som styr trafiken,  
2) väghållning planering, byggande, underhåll och trafikförvaltning av landsvägar samt produktion och uppdatering av informationen kring dessa uppgifter,  
3) byggande anläggande av ny väg och förbättring av väg,  
4) underhåll skötsel och reparation av väg,  
5) väghållare Trafikverket,  
6) väghållningsområde ett område som fastställs genom ett samarbetsavtal mellan landskapen och inom vilket de väghållningsuppgifter som landskapen i området ska ansvara för sköts i enlighet med samarbetsavtalet,  
7) avtal om väghållning det avtal som ska ingås mellan väghållaren och landskapen för ordnandet av väghållningen.  
4 § 
Landsvägar 
En landsväg är en statsägd väg eller en väg som innehas med vägrätt som har anvisats för allmän trafik och förvaltas av Trafikverket. Landsvägarna är beroende på sin betydelse för trafiken riksvägar, stamvägar, regionala vägar eller förbindelsevägar.  
Riksvägarna betjänar långväga trafik som är riksomfattande eller rör sig över landskapsgränserna. Stamvägarna kompletterar nätet av riksvägar och betjänar trafiken inom landskapen. De regionala vägarna betjänar trafiken inom de ekonomiska regionerna och förbinder dem med riks- och stamvägar. De övriga landsvägarna är förbindelsevägar. Bestämmelser om klassificeringen av riksvägar, stamvägar, regionala vägar och förbindelsevägar utfärdas genom förordning av kommunikationsministeriet.  
De landsvägar som hör till det nationellt viktiga stomnätet förbinder de största nationella och internationella centrumen och knutpunkterna med varandra samt betjänar särskilt den långväga trafiken. Närmare bestämmelser om till vilka delar landsvägarna hör till stomnätet utfärdas genom förordning av kommunikationsministeriet.  
En landsväg kan vara en motorväg eller motortrafikled eller annan väg avsedd för trafik av en viss art. Närmare bestämmelser om motorvägars och motortrafikleders tekniska egenskaper utfärdas genom förordning av statsrådet. En landsväg kan även vara avsedd att användas endast på vintern (särskild vinterväg).  
6 § 
Landsvägsfärjor 
Till en landsväg hör också färja med färjeled och färjeläge. En färja kan styras med hjälp av styrlinor eller annan ersättande anordning som Trafiksäkerhetsverket har godkänt (vajerfärja) eller vara en frigående färja (frigående färja). På frigående färjor tillämpas vad som föreskrivs om de ro-ro-passagerarfartyg som avses i 2 § i lagen om fartygs tekniska säkerhet och säker drift av fartyg (1686/2009). 
För färjor gäller vad som särskilt föreskrivs eller bestäms om dem. Den som producerar färjtrafikservice ansvarar för att föraren av vajerfärjan har fyllt 18 år och har förmåga att sköta uppgiften. Serviceproducenten ansvarar dessutom för att föraren av vajerfärjan är förtrogen med vajerfärjans maskineri, konstruktion och användning samt med reglerna i 1972 års konvention om de internationella reglerna till förhindrande av sammanstötning till sjöss (FördrS 30/1977) och i förordningen om förhindrande av sammanstötning i inre farvatten (Regler för inre farvatten 1978, 252/1978) samt med innehållet i de bestämmelser som har utfärdats med stöd av 4 mom. En förare av en vajerfärja ska ha tillräckligt god hälsa för att kunna köra vajerfärjan. Föraren ska också ha tillräckliga språkkunskaper för att kunna ge anvisningar till passagerarna i nödsituationer. Trafiksäkerhetsverket får meddela närmare föreskrifter om besiktning av vajerfärjor och om vajerfärjors utrustning och väghållaren närmare föreskrifter om vajerfärjors bemanning.  
Färjorna går i regel utan tidtabell. Av orsaker som har samband med trafiken eller på ansökan av ett landskap, en kommun eller någon annan myndighet eller aktör kan väghållaren besluta att en färja ska gå enligt tidtabell. I beslutet ska samtidigt anges grunderna för fastställandet av tidtabellen. Innan saken avgörs ska väghållaren ge dem som direkt berörs av färjtrafiken tillfälle att framföra sin åsikt i saken samt inhämta utlåtande av kommunen i fråga och vid behov också av andra myndigheter. Väghållaren ska kungöra beslutet, och tidtabellen ska läggas fram i omedelbar närhet av färjeläget. 
Närmare bestämmelser om tillsynen över färjor, körordningen till en färja, prioriterade transporter och annan vägtrafik, körande av en vajerfärja när den är frikopplad från styrlinan, åtgärder som föranleds av korsningar mellan färjeled och allmän farled, läkarintyg som krävs av föraren av en vajerfärja och utrustningen vid ett färjeläge utfärdas genom förordning av kommunikationsministeriet. 
8 § 
Serviceområden som hör till landsväg  
På ett parkeringsområde som avses i 5 § 1 mom. får placeras anordningar, anläggningar och byggnader för kiosk samt på en rastplats även för kafé, restaurang, bränsledistribution, motorfordonsservice och annan service för vägtrafikanterna. Utöver vad som föreskrivs i markanvändnings- och bygglagen (132/1999) krävs det väghållarens samtycke för placering av anordningar, anläggningar och byggnader. 
För placering av anordningar, anläggningar och byggnader på serviceområden som hör till en landsväg ska väghållaren vid behov ingå avtal om användningen av området, byggandet, producerandet av information, utövandet av affärsverksamhet och om eventuell ersättning till staten. Väghållaren ska för ingåendet av avtalet begära anbud från tillförlitliga, solida och yrkeskunniga företagare. Avtal ska ingås med den företagare som inom utsatt tid lämnat det anbud som med hänsyn till vad trafiken och turismen kräver samt den servicenivå som områdets användningsändamål förutsätter totalekonomiskt sett är förmånligast. Ett avtal får inte utan väghållarens samtycke överföras på någon annan.  
10 § 
Väghållare och kostnaderna för väghållningen 
Trafikverket är väghållare för landsvägsnätet och utövar de rättigheter som har grundats för väghållningen. Staten svarar för kostnaderna för väghållningen.  
Av särskilda orsaker, till exempel om väghållningen sköts så att den till sin kvalitet eller omfattning håller en högre standard än vad den allmänna trafiken eller anpassningen av vägen till miljön kräver eller om någon drar särskild nytta av de åtgärder som vidtas, kan förutom väghållaren också någon annan enligt avtal delta i kostnaderna för väghållningen eller åta sig att se till att någon åtgärd som hänför sig till väghållningen vidtas. 
För att säkerställa att trafiksystemet fungerar och för att genomföra lagens syften kan väghållaren av särskilda skäl och i enlighet med ett avtal delta i kostnaderna för andra åtgärder som hänför sig till väghållarens uppgifter än byggande och underhåll av landsvägar. 
11 § 
Myndigheter som svarar för väghållningen 
Trafikverket svarar för de uppgifter som ska skötas av ägaren till landsvägsnätet och för de riksomfattande uppgifterna inom väghållningen. Trafikverket ska även styra landskapen vid skötseln av uppgifterna inom väghållningen. 
Landskapen svarar inom sina respektive verksamhetsområden för skötseln av uppgifter inom väghållningen i enlighet med avtalet om väghållningen och under Trafikverkets styrning på högst nio väghållningsområden. Trafikverket svarar dock för byggandet av viktiga projekt.  
Trafikverket är det behöriga organ som avses i artikel 2 i Europaparlamentets och rådets direktiv 2008/96/EG om förvaltning av vägars säkerhet och den administrativa myndighet som avses i artikel 4 i Europaparlamentets och rådets direktiv 2004/54/EG om minimikrav för säkerhet i tunnlar som ingår i det transeuropeiska vägnätet. 
13 § 
Allmänna krav för väghållning 
Utvecklandet och underhållet av samt investeringarna i landsvägsnätet ska främja 
1) den riksomfattande trafiksystemplanens mål, 
2) möjligheterna att uppnå de riksomfattande målen för områdesanvändningen, områdesutvecklingen, möjligheterna att uppnå de mål som ställts för samhällsstrukturen och miljön vid planeringen av markanvändningen samt en ekonomisk samhällsstruktur och områdesanvändning,  
3) minskningen av utsläpp i trafiken, och 
4) möjligheterna att utnyttja information och digitalisering samt trafikens automatisering och förutsättningarna för utvecklande av trafiktjänster.  
Landsvägar ska planeras, byggas och hållas i skick med hänsyn till deras betydelse för trafiken så att  
1) landsvägarna erbjuder möjlighet till trygg och fungerande trafik och transport i hela landet till skäliga kostnader och med beaktande av olika trafikformer, olika befolkningsgruppers trafikbehov och olika näringsgrenars transportbehov,  
2) de olägenheter som landsvägsnätet och trafiken orsakar miljön blir så små som möjligt och naturresurserna används sparsamt,  
3) väghållningen inte orsakar någon större skada eller olägenhet än behövligt, 
4) landsvägarna med avseende på trafiken och tekniskt sett är så fungerande och säkra som möjligt och syftet med dem uppnås på ett så förmånligt sätt som möjligt, 
5) informationen om landsvägarna uppdateras och är tillgänglig, och 
6) landsvägarna och den digitala infrastrukturen i anknytning till dem är kompatibla med den övriga trafiken och dess digitala infrastruktur.  
En landsväg förbättras när den allmänna trafiken så kräver eller i syfte att undanröja eller minska olägenheter av trafiken eller om markanvändningen så kräver. En ny landsväg anläggs om det existerande landsvägsnätet inte längre tillgodoser den allmänna trafikens eller markanvändningens behov och om dessa behov inte kan tillgodoses på ett ändamålsenligt sätt genom att utveckla trafiksystemet eller förbättra vägen eller om olägenheterna av trafiken inte kan undanröjas eller i tillräcklig utsträckning minskas. En landsväg får inte byggas i strid med en plan med rättsverkningar.  
Trafiksäkerhetsverket får meddela föreskrifter som behövs för att garantera uppfyllandet av de i 2 mom. avsedda krav som gäller vägkonstruktion, utrustning, trafiktekniska lösningar samt användningen av landsvägar och begräsningar för den. 
13 a § 
Servicenivån på resor och transporter på landsvägar 
Väghållaren ska se till att servicenivån är tillräcklig med hänsyn till de krav som avses i 13 § 1 och 2 mom. och till den betydelse som varje landsväg har för trafiken. Vid upprätthållandet av servicenivån ska hänsyn tas till de faktorer som är centrala för servicenivån på resor och transporter såsom restiden, restidens förutsebarhet, säkerheten och kostnadseffektiviteten. 
Ett stomnät som är nationellt viktigt ska ha en hög servicenivå för den långväga trafiken. Väghållaren ska genom stomnätet sörja för att den information i realtid som ges om trafiken och trafikförhållandena är heltäckande och aktuell.  
De riks- och stamvägar som inte hör till stomnätet ska ha en god servicenivå på resor och transporter som är anpassad till trafikmängden, trafikmiljön och de regionala behoven. Särskilt för riks- och stamvägar med livlig trafik ska väghållaren se till att det finns tillgång tillaktuell information om trafiken och trafikförhållandena. 
De regionala vägar och förbindelsevägar som inte hör till stomnätet ska ha en servicenivå som motsvarar regionala behovet och vägens betydelse för trafiken.  
Närmare bestämmelser om servicenivån på resor och transporter på landsvägar får utfärdas genom förordning av kommunikationsministeriet. 
1 a kap. 
Trafiksystemplanering 
15 a § 
Trafiksystemplanering och målen för den 
Trafiksystemplanering är fortlöpande planering som sker i växelverkan mellan olika parter och som baserar sig på konsekvensbedömning och samarbete mellan myndigheter och andra aktörer. Syftet med trafiksystemplaneringen är att främja ett fungerande, säkert och hållbart trafiksystem genom att särskilt beakta 
1) växelverkan mellan trafiken, markanvändningen, servicestrukturen och näringsverksamheten samt de nuvarande och framtida transportbehov som olika funktioner skapar, 
2) olika människogruppers transportbehov och behovet av fungerande resekedjor, 
3) näringslivets behov av transporter och behovet av fungerande transportkedjor, 
4) trafiksäkerheten, 
5) förebyggandet och minskandet av de olägenheter som trafiken orsakar för miljön, 
6) trafiksystemets energieffektivitet,  
7) möjligheterna att utnyttja information och digitalisering, 
8) privata och marknadsbaserade mobilitetstjänster samt trafik- och transporttjänster, 
9) utvecklings- och finansieringsbehov inom offentliga och offentligt finansierade mobilitetstjänster samt trafik- och transporttjänster, och 
10) utvecklingsbehoven och finansieringen i fråga om trafiknäten och deras knutpunkter. 
15 b § 
Den riksomfattande trafiksystemplanen 
Kommunikationsministeriet ansvarar för beredningen av den riksomfattande trafiksystemplanen. Planen godkänns av statsrådet.  
Den riksomfattande trafiksystemplanen ska innehålla en bedömning av trafiksystemets nuläge och framtida verksamhetsmiljö, målen för trafiksystemet samt åtgärdsförslag för hur målen ska uppnås.  
Den riksomfattande trafiksystemplanen ska innehålla ett program för en period på 10-12 år för statens, landskapens och kommunernas åtgärder. Programmet ska dessutom innehålla statens finansieringsplan för trafiksystemet. Programmet kan revideras vid behov. 
Den riksomfattande trafiksystemplanen ska innehålla en bedömning av miljökonsekvenserna enligt lagen om bedömning av miljökonsekvenserna av myndigheters planer och program (200/2005). 
Trafiksystemplanen ska vid ingången av varje regeringsperiod revideras och samordnas med planen för de offentliga finanserna samt vid behov revideras då planen för de offentliga finanserna ändras. Kommunikationsministeriet ska säkerställa samordningen av den riksomfattande trafiksystemplanen med de övriga riksomfattande planerna. 
15 c § 
Landskapets trafiksystemplan 
I syfte att uppnå målen i den riksomfattande trafiksystemplanen och främja genomförandet av åtgärderna i den ska landskapet i samarbete med olika aktörer utarbeta en flerårig trafiksystemplan för sitt verksamhetsområde. Landskapets trafiksystemplan får även innehålla andra specifika mål som gäller landskapet och följer av landskapets förhållanden samt åtgärder för att främja och utveckla trafikens och trafiksystemets effektivitet, trygghet och hållbarhet. 
I landskapets trafiksystemplan framförs en bedömning av trafiksystemets nuläge och framtida verksamhetsmiljö i landskapets område samt målen och åtgärdsförslagen för uppnåendet av målen. Planen ska innehålla en bedömning av hur planen kan verkställas inom ramen för de tillgängliga ekonomiska resurserna samt av tidtabellen för genomförandet och av de övriga konsekvenserna av planen. Landskapet ska bedöma genomförandet och effekterna av trafiksystemplanen minst en gång under fullmäktigeperioden och vid behov revidera planen.  
Landskapets trafiksystemplan ska samordnas med landskapets övriga planering, med landskapets detaljplan och med de trafiksystemplaner som utarbetas av de landskap som gränsar till dess område. Landskapet får även utarbeta en trafiksystemplan tillsammans med ett eller flera andra landskap. I planen ska hänsyn tas till planering av trafiksystem för de kommuner och stadsregioner som finns inom landskapets område. Planen kan utarbetas som en del av landskapets övriga strategiska planering. 
Myndigheterna inom landskapets område ska i sin verksamhet ta hänsyn till landskapets trafiksystemplan.  
15 d § 
Förfarandet för beredningen av planerna 
Kommunikationsministeriet ska bereda den riksomfattande trafiksystemplanen i samarbete med samtliga landskap och med de ministerier, myndigheter och andra aktörer som är centrala med tanke på planen. Utlåtande om utkastet till planen ska begäras från de ministerier, myndigheter och andra aktörer för vars verksamhetsområde eller uppgifter planen har en väsentlig betydelse.  
Landskapet ska bereda landskapets trafiksystemplan i samarbete med statens trafikförvaltning, områdets kommuner och övriga landskap samt myndigheter och övriga aktörer för vars verksamhetsområde trafiksystemplanen kan ha väsentlig betydelse. Landskapet ska begära utlåtande om utkastet till planen från områdets kommuner och från de ministerier, myndigheter, övriga landskap och andra instanser för vars verksamhetsområde eller uppgifter planen har väsentlig betydelse.  
Trafikverket och Trafiksäkerhetsverket ska delta i utarbetandet både av den riksomfattande trafiksystemplanen och av landskapets trafiksystemplan.  
Den som svarar för beredningen av planen ska ge även andra instanser än de som avses i 1 och 2 mom. möjlighet att bekanta sig med de i de nämnda momenten avsedda planutkasten och att framföra sina åsikter. Information om den möjligheten ges genom att offentliggöra en kungörelse på det sätt som anges i 108 §. För framförande av åsikter ska det reserveras minst 30 dagar. Även om en godkänd plan och om motiveringarna samt hur utlåtanden och åsikter har beaktats ska kungöras offentligt på motsvarande sätt.  
15 e § 
Bemyndigande att utfärda förordning 
Närmare bestämmelser om förfarandet för utarbetandet och för uppföljningen av den riksomfattande trafiksystemplanen och landskapets trafiksystemplan får utfärdas genom förordning av statsrådet. 
1 b kap. 
Ordnande av väghållning 
15 f § 
Väghållningsområden 
Landskapen ska ingå avtal om samarbetet för skötseln av de väghållningsuppgifter som de har enligt denna lag för högst nio väghållningsområden på det sätt som föreskrivs i 8 kap. i landskapslagen ( / ). I samarbetsavtalet ska det avtalas om organisering av uppgifterna inom väghållningen och om fördelningen av behörighet och ansvar mellan landskapen inom väghållningsområdet.  
Genom samarbetsavtalet ska säkerställas att 
1) väghållningen är kostnadseffektiv, enhetlig, sakkunnig och långsiktig,  
2) servicenivån enligt denna lag uppnås och kundernas behov i pendlingsregionerna beaktas, samt 
3) de väghållningsområden som bildas är ändamålsenliga med avseende på geografin och deras storlek och även i övrigt.  
Om landskapet kan ordna skötseln av väghållningsuppgifterna på egen hand så att kraven i 2 mom. uppfylls, kan det bilda ett väghållningsområde på egen hand förutsatt att väghållningsområdena sammanlagt inte är flera än nio. 
15 g § 
Avtal om väghållningsområde 
Ett samarbetsavtal om ett väghållningsområde ska ingås tills vidare. Samarbetsavtalet träder i kraft vid ingången av det kalenderår som följer på det år då avtalet ingicks.  
Landskapen ska bereda och godkänna samarbetsavtalet så att kommunikationsministeriet och väghållaren delges det godkända avtalet senast den 30 augusti året före det år avtalet träder i kraft. 
Landskapen ska ge kommunikationsministeriet och väghållaren möjlighet att yttra sig om samarbetsavtalet mellan landskapen senast åtta veckor innan avtalet godkänns. Om kommunikationsministeriet anser att samarbetsavtalet inte uppfyller de krav som anges i 15 f § 2 mom., ska ministeriet och landskapen förhandla om saken.  
15 h § 
Ersättande av landskapens samarbetsavtal med beslut av statsrådet 
Om landskapen inte kommer fram till ett avtal som avses i 15 f § eller inte når enighet i de förhandlingar som avses i 15 g § 3 mom., fattar statsrådet på föredragning av kommunikationsministeriet ett beslut om landskapens samarbete för skötseln av uppgifterna inom väghållningen.  
Statsrådet kan fatta beslut om 
1) väghållningsområden,  
2) skötseln av uppgifterna genom ett sådant gemensamt organ som avses i 48 § i landskapslagen, 
3) vilket landskap som är ansvarigt landskap enligt 48 § 1 mom. i landskapslagen samt om vad som i 49 § 1-3 punkten i den lagen anges i fråga om det gemensamma organet,  
4) övrigt som gäller organiseringen av samarbetet och som behövs för att uppfylla de krav som avses i 15 f § 2 mom.  
Statsrådet ska samtidigt bestämma om det förfarande genom vilket dess beslut kan ersättas med i 15 f § avsett avtal mellan landskapen.  
Det beslut av statsrådet som avses i denna paragraf bereds vid kommunikationsministeriet. Vid beredningen ska ministeriet höra de landskap som beslutet gäller samt andra ministerier och myndigheter.  
15 i § 
Ändringar som gäller väghållningsområden 
Ett samarbetsavtal om ett väghållningsområde kan ändras, eller sägas upp för ingående av nytt avtal, högst en gång under landskapets fullmäktigeperiod, om det har skett en sådan väsentlig förändring i verksamhetsmiljön som påverkar väghållningsområdets verksamhet eller om ändringen eller uppsägningen och ingående av ett nytt avtal kan främja uppfyllandet av de krav som avses i 15 f § 2 mom.  
På ändringar av samarbetsavtal och på ingående av nya samarbetsavtal tillämpas vad som i 15 g och 15 h § föreskrivs om samarbetsavtal och om ersättande av samarbetsavtal med beslut av statsrådet. 
15 j § 
Finansiering av väghållningen 
Finansieringen av väghållningen specificeras landskapsvis enligt vägnätets och trafikens karaktär och andra omständigheter så att landsvägsnätets enhetlighet och skick säkerställs och kraven i 13, 13 a och 33 § uppfylls. Väghållaren anvisar finansiering till varje landskap och avsätter utifrån avtalen om väghållning finansiering att användas på respektive väghållningsområde av landskapen inom detta.  
En del av anslaget för väghållningen inom bastrafikledshållningen i statsbudgeten reserverar väghållaren för de riksomfattande uppgifterna inom väghållningen, till olika program och till akuta eller oförutsägbara reparationsbehov.  
15 k § 
Plan för väghållning och trafik 
För varje landskap ska det varje fullmäktigeperiod utarbetas en plan för väghållning och trafik som ska ses över årligen och som behandlar kundbehov, vägunderhåll, regionala investeringar och finansieringen av dem samt planens konsekvenser och andra frågor som gäller landskapets väghållning. Planen kan även gälla andra omständigheter kring de trafikuppgifter som landskapet ansvarar för.  
Planen för väghållning och trafik bereds av landskapet eller inom väghållningsområdet i enlighet med samarbetsavtalet mellan landskapen. Kommunerna i området ska ges möjlighet att yttra sig om utkastet till planen. Beslutet om godkännandet av planen fattas av det landskap som planen gäller.  
15 l § 
Avtal om väghållning 
Väghållaren och landskapen inom väghållningsområdet bereder för väghållningsuppgifterna ett fyraårigt avtal om väghållning som ses över årligen.  
I avtalet om väghållning ska avtalas om den finansiering som finns tillgänglig för skötseln av de uppgifter som enligt denna lag ankommer på landskapen inom väghållningsområdet och om fördelningen av finansieringen, om underhållsklasserna för landsvägarna, om de mål och tillvägagångssätt som gäller väghållningen, om beredskapsåtgärder, om ordnande av egenkontroll av väghållningen, om målen för verksamheten och ekonomin samt om rapporteringen och andra frågor som är viktiga för landskapets väghållning. Avtalet ska innehålla bestämmelser om den finansiering som avsatts för att användas av landskapen inom väghållningsområdet. Avtalet kan innehålla en separat del för varje landskap inom väghållningsområdet.  
15 m § 
Förfarandet vid avtal om väghållning 
Väghållningsområdet ska bereda planerna för väghållning och trafik eller utkasten till planerna innan förhandlingarna om avtalet om väghållningen inleds med väghållaren. De planer för väghållning och trafik som landskapen inom väghållningsområdet utarbetar utgör utgångspunkten för förhandlingarna.  
Avtalsförhandlingarna förs årligen på hösten. I avtalet avtalas det för det första året exakt och för följande år mera allmänt om de ärenden som avses i 15 l § 2 mom. Avtalet ses över vid de årliga förhandlingarna och vid behov på grund av förändringar i verksamhetsmiljön.  
Vid förhandlingarna ska representanter för väghållaren och väghållningsområdet vara närvarande i enlighet med avtalet mellan landskapen inom väghållningsområdet. Avtalet undertecknas av väghållarens representant och representanterna för landskapen inom väghållningsområdet.  
Om en överenskommelse inte nås vid avtalsförhandlingarna mellan väghållaren och väghållningsområdet, ska kommunikationsministeriet, väghållaren och representanterna för väghållningsområdets representanter förhandla om saken.  
15 n § 
Ersättande av avtal om väghållning med beslut av statsrådet 
Om väghållaren och landskapen inom väghållningsområdet inte uppnår ett avtal enligt 15 l § eller om enighet vid de förhandlingar som avses i 15 m § inte nås, fattar statsrådet på föredragning av kommunikationsministeriet ett beslut om de ärenden som enligt 15 n § 2 mom. ska avgöras genom ett avtal om väghållning.  
Statsrådet ska samtidigt bestämma om det förfarande genom vilket statsrådets beslut kan ersättas med ett avtal om väghållning som ingås enligt 15 l § mellan väghållaren och landskapen inom väghållningsområdet. Statsrådets beslut gäller till utgången av det kalenderår under vilket avtal mellan väghållaren och väghållningsområdet ingås. 
Det beslut av statsrådet som avses i denna paragraf bereds vid kommunikationsministeriet. Vid beredningen ska ministeriet höra de landskap som beslutet gäller samt väghållaren och de övriga ministerier och myndigheter för vars verksamhetsområde väghållningen kan vara av väsentlig betydelse. 
15 o § 
Egenkontroll av väghållningen 
Väghållaren och landskapet ska upprätta ett program för egenkontroll av de uppgifter inom väghållningen som de ska sköta. I programmet ska fastställas hur uppfyllandet av lagens allmänna krav för väghållningen, servicenivån på resor och transporter på landsvägar samt uppnåendet av målet för underhållet av landsvägar säkerställs. I programmet för egenkontroll ska det fastställas hur uppfyllandet av kraven följs upp och hur konstaterade brister avhjälps.  
Programmet för egenkontroll samt de iakttagelser som gjorts vid uppföljningen av verkställandet av programmet för egenkontroll och de åtgärder som iakttagelserna föranleder ska publiceras på internet. 
Landskapet ska sörja för att de avtal som ingås med tjänsteleverantörer innehåller sådana bestämmelser om tillsynen över tjänsteleverantören och om behandlingen av brister som konstaterats i väghållningens kvalitet som behövs för att verkställa landskapets egenkontroll. 
Närmare bestämmelser om innehållet i och utarbetandet av programmet för egenkontroll samt om den plan i programmet som gäller främjande av kvalitetshanteringen inom väghållningen får vid behov utfärdas genom förordning av kommunikationsministeriet.  
15 p § 
Rätt att få information 
Väghållaren och landskapet har rätt att av varandra, av andra myndigheter och av sådana privata tjänsteleverantörer som på deras vägnar sköter genom avtal bestämda uppgifter avgiftsfritt och trots sekretessbestämmelserna få den information som är nödvändig för att väghållaren och landskapet ska kunna sköta sina uppgifter i fråga om väghållning, egenkontroll och tillstånd enligt denna lag.  
Väghållaren och landskapet har rätt att lämna sekretessbelagda uppgifter till aktörer som på deras vägnar sköter genom avtal bestämda uppgifter, om informationen är nödvändig för skötseln av uppgifterna. 
2 kap. 
Planering av landsväg 
15 q § 
Uppgifter vid planering av landsväg 
Planeringen av en landsväg innefattar en utredningsplan och en vägplan samt den projektbedömning enligt 15 r § och de planeringsgrunder enligt 15 s § som gäller dessa planer.  
Landskapet ansvarar för utarbetandet av utredningsplanen och vägplanen i enlighet med vad som avtalats i samarbetsavtalet för väghållningsområdet. Väghållaren kan dock åta sig att svara för utarbetandet av en utredningsplan eller vägplan som gäller ett viktigt projekt samt uppgifter som sammanhänger med planen. Vad som i denna lag föreskrivs för situationer där landskapet utarbetar utredningsplaner, vägplaner, projektbedömningar, planeringsgrunder och utvärderingar gäller även väghållaren när denne svarar för dessa uppgifter.  
Vid utarbetandet av en utredningsplan och en vägplan samarbetar landskapet med områdets kommuner och övriga myndigheter. Planeringen ska grunda sig på landsvägens utvecklingsbehov, den riksomfattande trafiksystemplanen och landskapets trafiksystemplan, planeringsgrunderna för utrednings- och vägplaneringen och på planeringen av områdesanvändningen.  
15 r § 
Projektbedömning 
Landskapet ska göra en projektbedömning av sådana utredningsplaner och vägplaner som gäller viktiga vägprojekt. En projektbedömning ska även göras för sådana lösningar som genomförs stegvis i en vägplan som gäller ett viktigt vägprojekt.  
Projektbedömningen ska innehålla en beskrivning av projektets utgångspunkter, mål och konsekvenser, en konsekvensbedömning, en lönsamhetskalkyl samt en bedömning av och slutsatser om genomförbarheten. Som en del av projektbedömningen ska det dessutom läggas fram en plan över genomförandet av och innehållet i uppföljningen och utvärderingen av projektet.  
15 s § 
Planeringsgrunder för utredningsplanering och vägplanering 
Innan utarbetandet av en utredningsplan och en vägplan inleds kan det för ett vägprojekt som ingår i planen fastställas allmänna mål för servicenivån och landsvägens tekniska egenskaper samt för att avlägsna eller minska de skadliga verkningar som byggandet av landsvägen och trafiken medför (planeringsgrunder). När en utredningsplan och vägplan utarbetas ska planeringsgrunderna beaktas och förverkligandet av dessa främjas. 
Beslut om utarbetande av planeringsgrunder gällande utredningsplaner och vägplaner för riksvägar, stamvägar eller regionala vägar med livlig trafik fattas av väghållaren. Beslut om utarbetande av planeringsgrunder för övriga landsvägar fattas av landskapet.  
För beredningen av planeringsgrunderna svarar landskapet i samarbete med väghållaren och med de övriga myndigheter som saken berör. 
Väghållaren godkänner de planeringsgrunder som gäller riksvägar, stamvägar och livligt trafikerade regionala vägar. De planeringsgrunder som gäller övriga vägar i landsvägsnätet godkänns av landskapet. 
16 § 
Rätt till utredning 
När landskapet har beslutat att inleda utarbetandet av en utredningsplan eller en vägplan ska utredningsarbeten tillåtas på en fastighet. För detta ändamål får på fastigheten utföras mätning, utmärkning i terrängen, kartläggning och markundersökning samt andra förberedande åtgärder. I samband med utredningsarbeten får ingrepp i annans rätt inte göras i högre grad än vad som är nödvändigt för att uppnå resultat av utredningen, och ägare och rättsinnehavare får inte orsakas onödiga störningar. 
När utarbetandet av en utredningsplan eller en vägplan samt utredningar som har samband med den inleds ska landskapet underrätta kommunen och väghållaren om saken och kungöra ärendet på det sätt som landskapens tillkännagivanden ska kungöras enligt landskapslagen eller på annat lämpligt sätt för de personer som avses i 27 § 1 mom., och dessa har rätt att vara närvarande vid utredningarna och att framföra sin åsikt i saken. 
17 § 
Planering av väg och områdesplanering 
En utredningsplan och en vägplan ska grunda sig på en sådan plan med rättsverkningar som avses i markanvändnings- och bygglagen och i vilken landsvägens sträckning och dess förhållande till övrig områdesanvändning har klarlagts. På ett område för vilket en plan med rättsverkningar håller på att utarbetas eller ändras kan åtgärder vidtas i syfte att utarbeta en utredningsplan eller en vägplan som grundar sig på målen för planen med rättsverkningar. 
De riksomfattande målen för områdesanvändningen samt landskapsplaner och generalplaner ska beaktas så som föreskrivs i markanvändnings- och bygglagen. En utredningsplan eller en vägplan får inte godkännas i strid med en landskapsplan eller i strid med en generalplan med rättsverkningar. En utredningsplan kan godkännas i strid med en gällande detaljplan, om detta förordas av kommunen. En vägplan kan godkännas i strid gällande detaljplan, om det är fråga om en avvikelse med ringa verkningar, och om detta förordas av kommunen och de fastighetsägare som direkt påverkas av avvikelsen.  
Trots vad som föreskrivs i 1 mom. kan en landsväg planeras, om vägens sträckning och förhållande till övrig områdesanvändning med beaktande av vägens karaktär också utan en plan kan klarläggas i tillräcklig omfattning i samarbete med kommunen och i vid behov landskapet.  
En utredningsplan och en vägplan utarbetas med iakttagande av vad som föreskrivs i naturvårdslagen (1096/1996) och med stöd av den. 
19 § 
Utredningsplanens innehåll 
En utredningsplan ska innehålla en utredning av behovet av landsvägen samt av de alternativ som granskats, de grundläggande trafiklösningarna och tekniska lösningarna för vägen, vägens ungefärliga sträckning samt en bedömning av verkningarna av vägen, såsom verkningar på väg- och trafikförhållandena, trafiksäkerheten, markanvändningen, fastighetsstrukturen och miljön samt på människors hälsa, levnadsförhållanden och trivsel. Möjligheterna att avlägsna eller lindra menliga verkningar samt en preliminär kostnadskalkyl ska också presenteras i planen. 
Utredningsplanen ska innehålla en redogörelse för hur målen för den riksomfattande trafiksystemplanen och trafiksystemplanen på landskapsnivå har beaktats. Utredningsplanen ska även innehålla en projektbedömning som avses i 15 r § samt de planeringsgrunderna som avses i 15 s §.  
22 § 
Vägplanens innehåll 
I vägplanen för byggande av landsväg ska vägens sträckning och höjdläge samt tvärsektion anges så att vägområdet kan märkas ut i terrängen. Till planen ska fogas en bedömning av vägens verkningar och i planen anges de åtgärder som behövs för att avlägsna eller minska de menliga verkningar som vägen medför. I planen ska i mån av möjlighet ägandeförhållandena beträffande marken beaktas. Av vägplanen ska framgå vägens skyddsområden enligt 44 § 1 mom. och frisiktsområden enligt 45 § 1 mom. samt huruvida mark reserveras för framtida breddning av vägen. Till planen ska fogas en uppskattning av kostnaderna för byggandet av vägen. 
Om en landsväg till följd av förbättring får en ny sträckning och vägen för den gamla sträckningens del bibehålls som landsväg eller för andra vägändamål, ska bestämmelser om detta ingå i vägplanen. Om vägen är avsedd att vara motorväg, motortrafikled eller annan sådan väg där endast trafik av visst slag är tillåten eller om trafiken i övrigt permanent begränsas, ska bestämmelser om detta ingå i vägplanen. 
I vägplanen kan ett i 45 § 1 mom. avsett frisiktsområde anvisas som vägområde, om trafiksäkerheten i betydande grad anses kräva det. 
Vägplanen ska innehålla en redogörelse för hur målen för den riksomfattande trafiksystemplanen och trafiksystemplanen på landskapsnivå har beaktats i planen. En sådan redogörelse behövs dock inte om vägplanen grundar sig på en lagakraftvunnen utredningsplan med en tillräcklig redogörelse för beaktandet av målen för den riksomfattande trafiksystemplanen och trafiksystemplanen på landskapsnivå. Vägplanen ska även innehålla en projektbedömning som avses i 15 r § samt planeringsgrunderna som avses i 15 s §. 
24 § 
Enskilda vägars anslutningar och lantbruksanslutningar samt utloppsdiken i vägplanen 
I syfte att främja trafiksäkerheten på en landsväg och landsvägens förmedlingskapacitet kan det i en vägplan meddelas bestämmelser om eller förbud mot anslutning av enskilda vägar till landsvägen och användningen av anslutningar till landsvägen. Bestämmelser och förbud som här avses kan också meddelas i fråga om sådana anslutningar som används uteslutande för körningar inom lant- eller skogsbruket (lantbruksanslutning). 
Om användningen av en befintlig anslutning till en enskild väg eller en lantbruksanslutning förbjuds i vägplanen, ska det i planen bestämmas om anordnande av en ny vägförbindelse, varvid det kan bestämmas att en enskild väg eller en anslutning vid behov ska byggas på väghållarens bekostnad eller att en rätt ska bildas till en befintlig enskild väg eller till en väg eller ett vägavsnitt som dragits in eller upphört som landsväg. 
Om det för torrläggning av ett väg- eller biområde behöver bildas en rätt att hålla ett utloppsdike på någon annans mark eller rätt att leda avrinningsvatten till någon annans dike eller bäck, ska det bestämmas om detta i vägplanen, i vilken det område som behövs för utloppsdiket ska anges. På utloppsdiken tillämpas i övrigt vad som i vattenlagen (587/2011) föreskrivs om dikning. 
27 § 
Växelverkan 
När en utredningsplan och en vägplan utarbetas ska landskapet ge kommunen, fastighetsägare och övriga sakägare samt personer vars boende, arbete eller övriga förhållanden kan påverkas av planen möjlighet att delta i beredningen av planen, att bedöma verkningarna av planen och att skriftligen eller muntligen framföra sin åsikt i saken. 
Innan planen godkänns ska landskapet ge de i 1 mom. avsedda intressenterna tillfälle att göra en anmärkning med anledning av planen. Landskapet ska i detta syfte hålla utredningsplanen och vägplanen offentligt framlagda oavbrutet i 30 dagar. Anmärkningarna mot planen ska ges in till landskapet före utgången av den tid under vilken planen är framlagd. Landskapet ska ge de kommuner vars område omfattas av planen möjlighet att yttra sig om anmärkningarna. Landskapet ska på det sätt som landskapens tillkännagivanden ska kungöras enligt landskapslagen kungöra framläggandet av planen samt på vilket sätt och inom vilken tid anmärkningar kan göras. Landskapet ska sända ett skriftligt meddelande om att planen lagts fram till de ägare och innehavare av fastigheter inom planens verkningsområde som är bosatta i ett annat landskap och är nämnda i handlingarna eller annars är kända. 
Landskapet ska framföra sitt motiverade ställningstagande till de anmärkningar som har gjorts mot planen. Landskapets ställningstagande ska meddelas områdets kommuner samt dem som skriftligen har begärt det och som samtidigt har meddelat sin adress. Landskapets motiverade ställningstagande meddelas i väghållarens beslut som gäller godkännandet av planen.  
Landskapet ska begära utlåtande om planen av de övriga landskap och kommuner vars område planen gäller eller på vars område verkningar av planen i övrigt visar sig samt av Statens tillstånds- och tillsynsmyndighet. Landskapet ska begära utlåtande även av andra myndigheter, om det med tanke på beslutsprövningen är behövligt. Landskapet ska ge sitt motiverade ställningstagande om de utlåtanden som getts om planen.  
Om en vägplan som varit offentligt framlagd behöver ändras och ändringens verkningar bedöms vara ringa, kan ett enklare förfarande iakttas än vad som föreskrivs i 2–4 mom. 
Närmare bestämmelser om förfarandet för växelverkan utfärdas genom förordning av statsrådet. 
27 a § 
Förhandsöverläggning 
Medan en utredningsplan och en vägplan utarbetas och innan planen lämnas för godkännande kan väghållaren i egenskap av den som godkänner planen anordna en förhandsöverläggning på eget initiativ eller på begäran av landskapet eller en annan myndighet. Förhandsöverläggningen har till syfte att främja hanteringen av de utrednings- och utvärderingsförfaranden som krävs för planen, informationsutbytet mellan landskapet, väghållaren och de övriga myndigheterna samt att förbättra utredningarnas och handlingarnas kvalitet och tillgänglighet och skapa smidigare förfaranden. 
27 b § 
Framställning om godkännande av en utredningsplan och en vägplan 
Landskapet gör en framställning till väghållaren om godkännande av en utredningsplan eller en vägplan.  
Den framställning om godkännande av en utredningsplan ska innehålla de uppgifter, utredningar och handlingar enligt 15 q, 15 r, 16, 17, 19, 27, 29 och 43 b § i denna lag som behövs för den prövning som gäller godkännandet av planen.  
Den framställning om godkännande av en vägplan ska innehålla de uppgifter och utredningar enligt 15 q, 15 r, 16, 17, 22–24, 27, 28, 29, 43 b, 44 ja 45 § i denna lag som behövs för den prövning som gäller godkännandet av planen. 
Framställningen om godkännandet och det material om planen som utgör grunden för framställningen ska lämnas till väghållaren skriftligen samt i mån av möjlighet elektroniskt.  
Närmare bestämmelser om innehållet i utredningsplanen och vägplanen och om inlämnandet av dessa får utfärdas genom förordning av statsrådet.  
30 § 
Ändring av och mindre avvikelser från planerna 
Om en godkänd utredningsplan eller vägplan behöver ändras, ska det göras i enlighet med vad som i denna lag och med stöd av den föreskrivs om nya utredningsplaner och vägplaner.  
Från en godkänd vägplan får avvikas utan att den behöver ändras, om avvikelsen har ringa verkningar och landskapet prövar att avvikelsen i samband med genomförandet av planen är behövlig och ändamålsenlig.  
31 § 
Planernas giltighetstid 
En vägplan ska börja utarbetas inom åtta år från utgången av det år under vilket godkännandet av utredningsplanen för projektet har vunnit laga kraft. I annat fall förfaller beslutet om godkännande av utredningsplanen. Väghållaren kan på ansökan av landskapet förlänga utredningsplanens giltighetstid med högst fyra år, om förutsättningarna i 17 och 19 § alltjämt uppfylls. En vägplan anses ha börjat utarbetas när detta kungjorts så som föreskrivs i 16 § 2 mom. 
Beslutet om godkännande av en utredningsplan förfaller även till den del en vägplan som har utarbetats enligt planen har godkänts och beslutet om godkännande har vunnit laga kraft. 
Beslutet om godkännande av en vägplan förfaller, om arbetet på vägen inte till någon del har påbörjats inom fyra år från utgången av det år under vilket vägplanen har vunnit laga kraft. Väghållaren kan på ansökan av landskapet förlänga tidsfristen med högst fyra år och av särskilda skäl med ytterligare en period på högst fyra år. Tidsfristen kan förlängas bara om vägplanen alltjämt uppfyller förutsättningarna i 17 och 22 §. Arbetet på vägen anses ha påbörjats när det område som behövs för vägändamålen har tagits i väghållarens besittning i enlighet med 56 §. 
32 § 
Uppföljning och utvärdering 
Väghållaren ska systematiskt följa vägprojektets uppskattade och övriga verkningar och utnyttja resultaten av uppföljningen vid bedömningen av olika projekts verkningar och vid valet av planeringslösningar. 
Väghållaren kan av särskilda skäl besluta att det i fråga om sådana i 15 r § 1 mom. avsedda vägprojekt av vilka det har gjorts en projektbedömning även ska göras en utvärdering. För utvärderingen ansvarar landskapet i samarbete med väghållaren. Utvärderingen ska innehålla en redogörelse förde tekniskekonomiska avvikelser som har gjorts från vägplanen under genomförandet av vägplanen, för utvecklingen i trafiken samt för utfallet av de verkningar som är av betydelse med tanke på vägprojektets lönsamhet och effekter.  
32 a § 
Hur järnväg beaktas vid planeringen av en väg 
De ändringar som byggandet av en landsväg medför för en järnväg kan anvisas i den plan som gäller byggandet av landsvägen. 
I den plan som gäller byggandet av en landsväg ska de ändringar som detta medför för en järnväg presenteras separat i enlighet med vad som i banlagen (110/2007) föreskrivs om utredningsplan och järnvägsplan för järnvägar.  
33 § 
Underhåll av landsväg 
En landsväg ska hållas i ett sådant skick som motsvarar trafikens behov och trafikledens betydelse för trafiken. Vid underhåll av landsvägar och vid fastställande av nivån på underhållet ska hänsyn tas till 
1) de krav som föreskrivs i 13 § 1 och 2 mom. och till den servicenivå som avses i 13 a §, 
2) trafikmiljön, lokala behov och väglaget,  
3) trafikens smidighet och säkerhet, 
4) livscykelverkningar och kostnadseffektivitet, 
5) bevarandet av vägegendomen,  
6) miljöaspekter.  
Underhållet av de landsvägar som hör till stomnätet ska vara av hög kvalitet, men underhållet får i rimlig utsträckning variera tidsmässigt eller lokalt med beaktande av trafikens behov och förhållanden. Vägavsnitt i dåligt skick och viktbegränsningar får inte finnas eller bara finnas i obetydligt antal. 
Underhållet av de riksvägar och stamvägar som inte hör till stomnätet ska vara av god kvalitet, men det får variera tidsmässigt eller lokalt med beaktande av trafikens behov och förhållanden. Jämfört med riksvägarna och stamvägarna i stomnätet får dessa vägar ha ett större antal vägavsnitt i dåligt skick. 
Underhållet av de regionala vägar och förbindelsevägar som inte hör till stomnätet ska anpassas till de regionala trafikbehoven. Nivån på underhållet av vägarna får vara lägre än för vägnätet i övrigt och den får variera tidsmässigt eller lokalt med beaktande av trafikens behov och förhållanden. Jämfört med landsvägsnätet i övrigt får det finnas ett större antal vägavsnitt som är i dåligt skick, men målet ska vara att mängden inte ökar. 
Närmare bestämmelser om nivån på underhållet av landsvägar och om underhållsklasserna utfärdas genom förordning av kommunikationsministeriet.  
34 § 
Begränsat underhåll 
Av särskilda skäl kan väghållaren på förslag av landskapet besluta att en viss landsväg eller en viss del av en landsväg inte ska hållas i det skick som avses i 33 §. En sådan väg eller del av en väg ska stängas av från allmän trafik. Avstängningen av vägen eller en del av vägen ska anvisas med vägmärke och uppgiften om avstängningen ska föras in i det av väghållaren angivna registret eller informationssystemet. Polisen och räddningsmyndigheterna ska underrättas om avstängningen av en väg eller en del av en väg, om avstängningen kan ha betydelse för skötseln av deras brådskande uppdrag och uppgiften inte har uppdaterats i det register eller informationssystem som har angetts av väghållaren. Avstängningen av en väg eller en del av en väg ska vid behov tillkännages genom kungörelse. 
Landskapet kan besluta att en del av en viss gångbana eller cykelbana eller av en kombinerad eller parallell cykelbana och gångbana vilka hör till en landsväg hålls i skick utan halkbekämpning. 
35 § 
Tillfälligt trafikförbud eller tillfällig begränsning av trafiken 
Om det finns risk för att fordonstrafik skadar en landsväg som till följd av tjällossning, regn eller annan liknande orsak till sin konstruktion har försvagats, kan landskapet tills vidare eller för viss tid förbjuda eller begränsa trafiken på vägen eller en del av den. 
Av särskilda skäl kan landskapet bevilja tillstånd att göra ett temporärt undantag från de förbud eller den begränsning som avses i 1 mom., om trafiksäkerheten enligt landskapets prövning inte äventyras och landsvägen inte tar skada. Till tillståndet för undantaget kan det fogas behövliga villkor. Sådana transporter som är nödvändiga för att samhället ska fungera behöver inget undantagstillstånd.  
De förbud och begränsningar som avses i 1 mom. ska anvisas med vägmärke och uppgiften om dem ska föras in i det register eller informationssystem som anges av väghållaren. 
36 § 
Tillfällig farväg 
Om trafiken på en landsväg förhindras eller måste begränsas till följd av att landsvägen eller en konstruktion som hör till den har rasat eller riskerar att rasa eller till följd av exceptionella naturförhållanden, eller om ett vägarbete av särskilda skäl förutsätter det, har landskapet rätt att ordna en tillfällig farväg på någon annans mark tills hindret eller begränsningen har avlägsnats. Innan farvägen ordnas ska fastighetens ägare eller innehavare om möjligt ges tillfälle att bli hörd. Dessutom ska ett väglag som avses i lagen om enskilda vägar om möjligt ges tillfälle att bli hört, om den enskilda vägen finns på fastigheten i fråga eller gränsar till den. I fråga om underhållet av en sådan farväg som avses i detta moment tillämpas 33 §.  
Om trafiken på en landsväg förhindras till följd av en trafikolycka eller av någon annan motsvarande orsak får den som enligt 49 § i vägtrafiklagen (267/1981) reglerar trafiken ordna en tillfällig farväg på någon annans mark tills hindret har avlägsnats. 
Temporära förbud och begränsningar ska anvisas med vägmärke och uppgiften om dem ska föras in i det register eller informationssystem som anges av väghållaren. 
37 § 
Anslutning till landsväg 
Trots förbud eller bestämmelser som avses i 24 § 1 mom. kan väghållaren tillåta anslutning av en enskild väg till en landsväg som är underkastad förbud eller användning av en förbjuden anslutning eller ändring av anslutningens användningsändamål, om en ändamålsenlig användning av en fastighet kräver det och trafiksäkerheten inte äventyras av anslutningen eller användningen av den. Om fastigheten behöver en lantbruksanslutning ska tillstånd beviljas för att anlägga en sådan i anslutning till en väg som avses i detta moment, om trafiksäkerheten inte äventyras av anslutningen och dess läge. Tillståndet kan förenas med behövliga villkor.  
Tillstånd för att ansluta en enskild väg till någon annan än en sådan landsväg som avses i 1 mom. ska beviljas, om anslutningen behövs för nyttjandet av en fastighet och anslutningen och dess läge är sådana att trafiksäkerheten inte äventyras av anslutningen eller användningen av den. Tillståndet kan förenas med behövliga villkor. En lantbruksanslutning får enligt väghållarens anvisningar anslutas till en väg som avses i detta moment, om detta inte äventyrar trafiksäkerheten. Väghållaren ska i god tid innan åtgärder vidtas underrättas om anläggandet av en sådan lantbruksanslutning. 
Om det för att inrätta en snöskoterled som avses i terrängtrafiklagen (1710/1995) eller någon annan därmed jämförbar trafikförbindelse måste ordnas med ett övergångsställe på vägområdet för korsande av landsvägen, kan väghållaren bevilja tillstånd för denna åtgärd, om övergångsstället inte äventyrar trafiksäkerheten eller medför olägenhet för väghållningen. Tillståndet kan förenas med behövliga villkor. 
Vad som föreskrivs i 1–3 mom. gäller inte motorvägar eller motortrafikleder eller de nationellt viktiga stomvägar som avses i 4 § 3 mom. och för vilka bestämmelser om tillträde kan ges endast i vägplanen. För en stomvägs del kan väghållaren av särskilda skäl bevilja tillstånd för att anlägga en anslutning enligt 1 mom. eller ordna med ett övergångsställe enligt 3 mom. 
38 § 
Anläggande, underhåll eller ändring av anslutning eller övergångsställe 
Väghållare som svarar för en enskild väg och innehavare av en lantbruksanslutning är skyldiga att anlägga sin anslutning och hålla den i skick enligt väghållarens anvisningar så att den inte äventyrar trafiksäkerheten eller medför olägenhet för underhållet av landsvägen. Väghållaren eller enligt avtal landskapet svarar dock för underhållet av en enskild vägs anslutning och en lantbruksanslutnings vägtrumma.  
Om en befintlig anslutning till en enskild väg eller en lantbruksanslutning till följd av ändrad eller avsevärt ökad användning orsakar fara för trafiken eller medför olägenhet för underhållet av landsvägen, är den väghållare som svarar för den enskilda vägen eller innehavaren av lantbruksanslutningen skyldig att på egen bekostnad enligt väghållarens anvisningar utföra sådana ändringar i fråga om anslutningen eller i undantagsfall även i fråga om anslutningsområdet att den fara eller olägenhet som anslutningen förorsakar avlägsnas eller minskas, samt att vid behov ansöka om nytt tillstånd för anslutningen. 
Vad som föreskrivs i 1 och 2 mom. gäller i fråga om ett övergångsställe på en landsväg också den som håller en snöskoterled eller en annan därmed jämförbar trafikförbindelse. 
Om den som åläggs skyldigheter med stöd av 1–3 mom. försummar dessa skyldigheter, får väghållaren vidta åtgärderna på den försumliges bekostnad eller avbryta byggarbetet. Bestämmelser om hot om tvångsutförande eller hot om avbrytande finns i viteslagen (1113/1990).  
39 § 
Avskärande av en enskild väg, en gata eller en snöskoterled 
Om en landsväg byggs så att den skär av en befintlig enskild väg eller så att tillträdet till landsvägen från en befintlig enskild väg eller från en lantbruksanslutning försvåras betydligt, ska den som ansvarar för projektet på egen bekostnad utföra de arbeten jämte anordningar som behövs för att dra den enskilda vägen över landsvägen eller ansluta den enskilda vägen eller lantbruksanslutningen till landsvägen. 
Vad som i 1 mom. föreskrivs om enskild väg gäller även gator och snöskoterleder. 
40 §  
Avlägsnande av anslutning 
I samband med byggandet av en landsväg kan den som ansvarar för projektet på egen bekostnad avlägsna en anslutning som är förbjuden i vägplanen eller förhindra användningen av anslutningen, när en ersättande trafikförbindelse har ordnats. 
Landskapet kan på egen bekostnad avlägsna en anslutning som står i strid med detaljplanen eller förhindra användningen av anslutningen, om en godtagbar ersättande trafikförbindelse har ordnats. Innan åtgärder vidtas ska fastighetens ägare eller innehavare samt den enskilda vägens väglag ges tillfälle att bli hörda och, om anslutningen används allmänt för trafik, ärendet kungöras. 
Senast då anslutningen tas ur bruk ska landskapet i det register eller informationssystem som anges av väghållaren föra in uppgiften om att anslutningen har avlägsnats.  
42 § 
Arbete på vägområde samt placering av konstruktioner, anläggningar och anordningar på vägområde 
För arbete på vägområde samt för placering av konstruktioner, anläggningar och anordningar på vägområde krävs det tillstånd av väghållaren. Tillstånd får beviljas om åtgärden inte orsakar fara för trafiken eller medför olägenhet för väghållningen. Tillstånd för placering av konstruktioner, anläggningar eller anordningar som är nödvändiga med tanke på ett fungerande samhälle ska dock beviljas om placeringen inte orsakar fara för trafiken och inte medför mer än ringa olägenhet för väghållningen. 
Den som beviljats tillstånd är skyldig att utföra det arbete som avses i 1 mom. och att underhålla konstruktioner, anläggningar och anordningar enligt väghållarens föreskrifter. Tillståndsinnehavaren är skyldig att på egen bekostnad göra de ändringar som väghållaren kräver eller att flytta eller avlägsna en konstruktion, anläggning eller anordning, om nyttjandet av den orsakar sådan fara eller olägenhet som avses i 1 mom. 
Om tillstånd inte krävs på grund av bestämmelser i någon annan lag, ska det göras en anmälan om åtgärden till väghållaren i god tid innan åtgärden vidtas. 
Om inte något annat följer av 1 eller 3 mom., 8 § 1 mom. eller 42 a § 1 mom., krävs väghållarens tillstånd för att ett vägområde och sådana konstruktioner, anläggningar och anordningar som finns på vägområdet ska få användas för andra ändamål än landsvägsändamål. 
Tillstånd krävs dock inte för 
1) en förbindelseväg och regional väg som inte är markerad med ett vägmärke som anger förkörsrätt, om området utanför dikets yttre slänt på en landsvägs vägområde ska användas kortvarigt då det är fråga om att trävaror förvaras kortvarigt i högst sex månader i samband med avverkning och med beaktande av bestämmelserna i vägtrafiklagen och inte heller för lastning på vägområdet av den trävara som har förvarats på ovannämnda sätt, 
2) placering av en i 52 a § avsedd tillfällig annons på vägområde, eller  
3) placering på vägområde med stöd av 45 § 3 mom. i postlagen (415/2011) av sådana anordningar eller mindre konstruktioner som behövs för insamling och utdelning av post.  
Trafikverket får meddela närmare föreskrifter om vilka uppgifter som ska ingå i tillståndsansökan och anmälan, om hur uppgiften om placeringen ska meddelas och om de tekniska egenskaperna hos och placeringen av konstruktioner, anläggningar och anordningar samt om arrangemangen under den tid arbetet pågår. När det gäller el- och telekablar kan Trafikverkets föreskrift gälla endast kablarnas yttre skyddskonstruktioner och placering samt arrangemangen under den tid arbetet pågår. 
42 a § 
Placering av vissa kablar på vägområde 
Med avvikelse från vad som föreskrivs i 42 § 1 mom. räcker en anmälan till väghållaren om placeringen av el- och telekablar samt tillhörande kabelskåp och kabelbrunnar på vägområde förutsatt att det är fråga om  
1) kablar som ska passera under en landsväg eller en gångbana och en cykelbana som hör till en landsväg, 
2) en förlängning av en kabel som löper i vägens längdriktning eller en korsande kabel som ansluter till den men som sträcker sig utanför vägområdet eller som passerar under en landsväg, 
3) luftledningar som korsar en landsväg eller en gångbana och en cykelbana som hör till en landsväg, 
4) luftledningar som löper i vägens längdriktning och som placeras utanför vägområdet invid en landsväg, men vars ledningsområde sträcker sig till vägområdet, 
5) nya kundanslutningar inom bredbandsprojekt, om de har skaffats först efter det att byggarbetet redan inletts, 
6) kablar som löper i vägens längdriktning, om kablarna enbart placeras i redan befintliga rörledningar som löper i vägens längdriktning. 
Till anmälan ska det fogas en redogörelse för kabelns ägare, kabelns placering, förhållanden på och grunduppgifter om platsen, hur arbetet utförs och vem som utför det, trafikarrangemangen under den tid arbetet pågår samt vilken dag åtgärden enligt planerna ska inledas. Anmälan ska göras senast 21 dagar före den dag då åtgärden enligt planerna ska inledas. 
Väghållaren kan efter att ha tagit emot anmälan och före den dag åtgärden enligt planerna ska inledas förbjuda åtgärden, om väghållaren bedömer att placeringen av kabeln äventyrar trafiksäkerheten eller medför mer än ringa olägenhet för väghållningen. Den planerade åtgärden får inte inledas före den dag som angetts i anmälan. 
Trafikverket får meddela närmare föreskrifter om innehållet i anmälan, om de i 1 mom. avsedda el- och telekablarnas yttre skyddskonstruktioner och placering samt om arrangemangen under den tid arbetet pågår. 
För placering av de kablar som avses i 1 mom. behövs dock ett tillstånd enligt 42 § 1 mom. om 
1) åtgärden gäller vägområdet för en motorväg eller en motortrafikled, 
2) åtgärden gäller ett område med grundvattenskydd, 
3) åtgärden förutsätter ingrepp i en sprängstenskonstruktion, eller 
4) avståndet från den plats där kabeln ska passera under vägområdet till en gångtunnels, rörbros eller trummas konstruktion är mindre än fem meter eller till annan brokonstruktion mindre än 25 meter. 
Bestämmelser om den anmälan om placeringen av kablar som ska göras till Kommunikationsverket finns i lagen om sambyggnad och samutnyttjande av nätinfrastruktur (276/2016). 
42 b § 
Skyldighet att flytta, skydda och avlägsna konstruktioner, anläggningar och anordningar 
Om väghållaren anser att det för att flytta eller förbättra en väg eller för annan väghållning krävs att en konstruktion, anläggning eller anordning som med stöd av denna lag placerats på vägområde ska skyddas, flyttas eller avlägsnas, är det konstruktionens, anläggningens eller anordningens ägare som svarar för kostnaderna för åtgärden. 
Den åtgärd som avses i 1 mom. ska i fråga om högst tre kunders kundanslutningar till el- och telekablar utföras inom tre månader och i fråga om andra konstruktioner, anläggningar och anordningar på vägområde inom sex månader från väghållarens anmälan. Väghållaren kan också bestämma att tidsfristen ska vara längre än så eller förlänga tiden, om detta behövs för att åtgärden ska kunna utföras under den tjälfria perioden, eller av någon annan motsvarande orsak. 
Den som ansvarar för projektet ska dock svara för kostnaderna för flyttandet, skyddandet och avlägsnandet av ett objekt, om objektet ursprungligen har varit placerat utanför vägområdet eller om väghållaren inte har underrättat den som beviljats tillstånd om att objektet under handläggningsåret för ärendet eller inom fem år kommer att omfattas av ett väghållningsarbete som inte är en punktåtgärd och som kräver att konstruktionen, anläggningen eller anordningen flyttas eller avlägsnas. Vid ersättandet av flyttkostnader beaktas objektets ålder samt den kapacitetsökning som den ersättande kabeln medför. 
Trafikverket får meddela närmare föreskrifter om hur de åtgärder som avses i denna paragraf ska genomföras, om tidsfrister för genomförandet samt om andra tekniska omständigheter som gäller åtgärderna. Trafikverket får i egenskap av väghållare också meddela närmare föreskrifter om hur objektets ålder och den kapacitetsökning som den ersättande kabeln medför ska beaktas vid ersättandet av de i 3 mom. avsedda kostnaderna för flyttande av objektet. 
43 § 
Korsning mellan särskild vinterväg och farled  
Om en särskild vinterväg som korsar en allmän farled avskärs på grund av att en ränna öppnas i isen till följd av fartygstrafik under vintern, ska landskapet i mån av möjlighet lägga ut en bro eller sätta in en färja eller på annat sätt sörja för de åtgärder som krävs i syfte att trygga trafiken och leda den över farleden. 
En enskild farled får inte utan samtycke av landskapet öppnas så att den skär av en särskild vinterväg. Den som öppnat farleden eller använder den är skyldig att ställa i ordning och underhålla den anordning som behövs för överfart. 
44 § 
Skyddsområde för landsväg 
Skyddsområdet för en landsväg sträcker sig 20 meter från mittlinjen av landsvägens körbana eller, om det finns flera körbanor, från den närmaste körbanans mittlinje. I fråga om en viss väg eller del av en väg kan det i vägplanen av särskilda skäl anvisas ett kortare avstånd än 20 meter eller avståndet förlängas till högst 50 meter. I fråga om en reservlandningsplats som hör till vägen kan avståndet förlängas till högst 300 meter och i längdriktning med 750 meter i vardera ändan av landningsplatsen. 
Byggnader får inte finnas på ett skyddsområde. Landskapet har då trafiksäkerheten så kräver samt vid reservlandningsplats även av flygsäkerhetsskäl rätt att avlägsna växtlighet från skyddsområde. 
45 § 
Frisiktsområde för landsväg 
Där en landsväg bildar en kurva eller till vägen ansluter sig en annan landsväg eller en viktig enskild väg eller vägen korsas av järnväg, är det förbjudet att även utanför skyddsområdet hålla byggnader inom ett område som med hänsyn till trafiksäkerheten ska vara fritt från hinder som skymmer sikten (frisiktsområde). 
Landskapet har rätt att på frisiktsområdet avlägsna växtlighet och naturhinder som skymmer behövlig sikt och därigenom äventyrar trafiksäkerheten. 
47 § 
Rätt att bevilja undantag 
Väghållaren kan av särskilda skäl bevilja undantag från förbud som avses i 44–46 §, om den bedömer att trafiksäkerheten inte äventyras och väghållningen inte förorsakas annan än högst obetydlig olägenhet. Beslutet om undantag kan förenas med behövliga villkor. 
48 § 
Undantag från begränsningar 
Bestämmelserna i 44–47 § tillämpas inte om växtligheten har planterats eller tagits under särskild omvårdnad eller om en byggnad, ett upplag, ett stängsel eller en annan anläggning eller anordning har uppförts innan nyttjanderätten till området blivit underkastad begränsningar enligt nämnda paragrafer eller motsvarande begränsningar som avses i tidigare lag. 
Om sådan växtlighet som avses i 1 mom. eller en byggnad, anläggning eller anordning äventyrar trafiksäkerheten eller medför olägenhet för väghållningen, kan väghållaren besluta att de ska avlägsnas eller flyttas eller att en behövlig ändring ska göras på dem. Om ägaren inte vidtar åtgärden inom utsatt, skälig tid, har väghållaren rätt att vidta den på egen bekostnad. 
Vad som föreskrivs i 44–47 § samt i 1 och 2 mom. gäller inte en byggnad inom ett detaljplaneområde eller avlägsnandet av växtlighet som med hänsyn till miljön är av särskild betydelse. 
49 § 
Förfarandet vid avlägsnande av växtlighet och naturhinder 
Innan landskapet börjar avlägsna växtlighet som avses i 44 § 2 mom. eller 45 § 2 mom. eller naturhinder som avses i det sistnämnda momentet ska den ifrågavarande fastighetens ägare eller innehavare underrättas om detta eller saken kungöras i god tid innan åtgärden vidtas. Fastighetsägaren kan om denne så önskar själv sörja för åtgärderna enligt anvisning av landskapet. 
51 § 
Snöskärm och uppläggning av snö 
Landskapet har rätt att anlägga en tillfällig eller fast snöskärm utanför vägområdet, om det behövs för att förhindra anhopning av snö på vägen. Inom bebott område får en fast snöskärm dock anläggas endast med samtycke av fastighetens ägare eller innehavare eller, om samtycke inte ges, med tillstånd av kommunens byggnadstillsynsmyndighet. Tillstånd kan beviljas om snöskärmen behövs för att hålla landsvägen i tillfredsställande skick med hänsyn till den allmänna trafiken och skärmen eller hållandet av skärmen inte medför betydande olägenheter för fastigheten. 
Landskapet har rätt att i samband med underhåll av landsvägen lägga upp snö från landsvägsområdet också utanför vägområdet. 
52 § 
Reklam och annonsering invid vägar 
Sådana reklamaffischer och annonser avsedda för trafikanter på en landsväg som sätts upp utanför ett detaljplaneområde, eller inom ett detaljplaneområde på ett trafikområde som avses i 83 § 4 mom. i markanvändnings- och bygglagen, ska utformas och placeras så att de inte äventyrar trafiksäkerheten eller medför olägenhet för väghållningen och så att de så väl som möjligt passar in i omgivningen. 
Det ska göras en anmälan till väghållaren om uppsättande av en reklamaffisch eller annons som avses i 1 mom., om inte något annat föreskrivs nedan. Till anmälan ska fogas en utredning med information om reklamaffischen eller annonsen och dess placering samt uppgift om fastighetsägarens eller fastighetsinnehavarens samtycke till att den sätts upp. 
Om uppsättandet av reklamaffischen eller annonsen inte uppfyller kraven i 1 mom., ska väghållaren inom 30 dagar från det att anmälan inkommit fatta ett beslut där uppsättandet av reklamaffischen eller annonsen förbjuds eller där det ställs behövliga villkor för uppsättandet. Reklamaffischen eller annonsen får inte sättas upp före utgången av denna tid. Väghållaren kan dock i ett beslut som fattas med anledning av anmälan tillåta att reklamaffischen eller annonsen sätts upp före den tidpunkt som nämns ovan. En reklamaffisch eller en annons får vara på den anmälda platsen i 10 år, om inte väghållaren bestämmer att tiden ska vara kortare än det. 
Väghållaren kan med anledning av anmälan begära utlåtande av landskapet och kommunen.  
52 b § 
Bemyndigande att meddela föreskrifter 
Trafikverket får i egenskap av väghållare meddela behövliga föreskrifter om innehållet i den anmälan till väghållaren som avses i 52 § och om anmälningsförfarandet. För att garantera trafiksäkerheten får Trafikverket också meddela närmare föreskrifter om de tekniska egenskaperna hos och placeringen av sådana reklamaffischer och annonser som avses i 52 och 52 a §. 
53 a § 
Hur järnväg beaktas vid landsvägsförrättning 
De ändringar beträffande en järnväg som har anvisats i en sådan vägplan som avses i 32 a § behandlas och avgörs vid en landsvägsförrättning. Av de områden som löses in för landsvägs- och järnvägsändamål bildas separata inlösningsenheter. Inlösning som berör järnvägar samt ersättningar regleras i övrigt i 5 kap. i banlagen. 
54 § 
Inledande av landsvägsförrättning 
Väghållaren och, om väghållaren har gett sitt samtycke till det, landskapet har rätt att med stöd av 26 § 1 mom. ansöka om landsvägsförrättning när en godkänd vägplan har vunnit laga kraft eller kan verkställas trots besvär eller på grundval av skriftligt samtycke som avses i 21 §. 
56 § 
Besittningstagande 
De vägområden som anvisats i en vägplan och de övriga områden som i vägplanen anvisats väghållaren samt de rättigheter som ska bildas för väghållning tas i väghållarens besittning vid en tidpunkt som fastställs vid en tillträdessyn i samband med landsvägsförrättningen. Det område som i vägplanen anvisats för en enskild väg eller för en anslutning tas i väghållarens besittning till dess att vägen eller anslutningen har anlagts. I samband med besittningstagandet får väghållaren rätt att använda områdena och utöva rättigheterna för de ändamål som anges i vägplanen, trots andra rättigheter som hänför sig till fastigheten. Det besittningstagande som avses i detta moment kan också ske stegvis, i enlighet med väghållarens anvisningar. 
Om besittningstagandet medför en påföljd som avses i 57 § 2 mom. i inlösningslagen, kan inlösningskommissionen på yrkande av den som saken gäller bestämma att besittningstagandet till denna del får ske tidigast när en tidsperiod på högst tre månader, utsatt av kommissionen, har förflutit sedan förskottsersättning eller den ersättning som bestämts vid den första förrättning som avses i 62 § 2 mom. har betalats till den som saken gäller. 
Vid en sådan vägförbättring som avses i 21 § och som bedöms ha ringa verkningar kan besittningstagande ske på basis av avtal. Efter besittningstagandet ska väghållaren dock utan dröjsmål ansöka om en landsvägsförrättning. 
Om överenskommelse inte nås om att avlägsna eller flytta egendom från ett område som tagits i besittning, ska väghållaren för ägaren eller innehavaren av den egendom som ska avlägsnas sätta ut en skälig och med tanke på vägarbetet lämplig tidsfrist, efter vars utgång egendomen avlägsnas av väghållaren. Väghållaren ska i sådana fall innan egendomen avlägsnas, om möjligt, underrätta egendomens ägare eller innehavare om detta. 
Om byggnader, upplag eller anordningar eller träd, växande gröda eller annan växtlighet måste avlägsnas eller flyttas från ett område som ska upplåtas eller har upplåtits för vägändamål, ska utöver den därigenom orsakade skadan eller olägenheten även de kostnader som sakägaren orsakas på grund av avlägsnandet eller flyttningen ersättas. 
56 a § 
Överlåtelse av en enskild väg 
En sådan enskild väg som avses i 56 § 1 mom. överlåts till vägdelägarna eller fastighetens ägare vid den tidpunkt som väghållaren bestämmer, efter att det vid en landsvägsförrättning har fattats beslut om vägdelägarna och om hur ansvaret för vägens underhåll fördelas mellan delägarna. För att vägen ska kunna överlåtas är det möjligt att fatta ett temporärt beslut om vägdelägarna och om fördelningen av ansvaret för underhållet under den tid landsvägsförrättningen pågår. 
57 § 
Fastställande av föremålet för inlösning samt uppkomst av äganderätt till vägområdet 
I ett beslut om inlösen fastställs föremålet för inlösningen enligt vägplanen eller ett skriftligt samtycke enligt 21 §, vid behov enligt väghållarens anvisning. Mindre avvikelser från vägplanen kan av särskilda skäl göras. Vid landsvägsförrättning enligt 75 § 2 mom. fastställs föremålet för inlösning enligt 5 § 3 mom., vid behov enligt väghållarens anvisning. 
Ett område som fastställts som vägområde övergår efter att beslutet om inlösen vunnit laga kraft i väghållarens ägo, om väghållaren inte sedan tidigare äger området. 
62 § 
Behandling av inlösen vid två förrättningar 
Utöver vad som föreskrivs i 20 § i inlösningslagen kan förrättningsingenjören på framställning av väghållaren dela upp de ärenden som gäller inlösen enligt förrättningsförordnandet för behandling vid två särskilda landsvägsförrättningar, om det på grund av antalet eller arten av de ärenden som ska avgöras eller av andra orsaker är ändamålsenligt. 
Om inlösen i enlighet med 1 mom. behandlas vid två särskilda förrättningar, ska förrättningsingenjören efter att den första förrättningen avslutats, utan särskild ansökan, fortsätta med inlösningen vid en ny förrättning, när behandlingen av ärendena så kräver. Förutom inlösningsärenden som inte avgjorts ska vid denna förrättning behandlas och avgöras även de ärenden som gäller sådana ändringar i föremålet för inlösen som görs efter att den tidigare förrättningen avslutats. 
69 § 
Reglering av enskilda vägar 
Vid en landsvägsförrättning ska sådana regleringar av enskilda vägar och vägrätter företas som behövs med hänsyn till byggandet av en landsväg eller på grund av bestämmelser eller förbud enligt 24 § 1 och 2 mom. Vid förrättningen behandlas och avgörs också övriga ärenden som ska behandlas vid en vägförrättning enligt lagen om enskilda vägar. 
Vägförbindelser till enskilda vägar samt vägrätter kan regleras vid en sådan lokal förrättning som avses i 38 c § i lagen om enskilda vägar och som kan verkställas på begäran av väghållaren utan särskild ansökan. Frågan om den ersättning som avses i 72 § avgörs då vid denna förrättning, på vilken dessutom tillämpas vad som föreskrivs i 82 § i inlösningslagen. 
74 § 
Övriga ersättningar och landsvägsförrättning som gäller ersättningar 
Om en landsväg orsakar en fastighet någon annan skada eller olägenhet än vad som avses i detta kapitel, är fastighetens ägare berättigad till ersättning av väghållaren. Om skadan eller olägenheten är betydande, och fastighetens ägare inte önskar ersättning för sin förlust, har fastighetens ägare rätt att kräva att väghållaren löser in fastigheten eller en del av den. Om överenskommelse om ersättningen eller inlösningen inte nås, ska frågan avgöras vid en landsvägsförrättning. 
Om en ersättnings- eller inlösningsfråga som följer av denna lag tas till behandling i annat fall än vid en landsvägsförrättning eller om ersättningen kan bestämmas först efter det att landsvägsförrättningen har avslutats och överenskommelse inte nåtts om ersättningarna, ska ersättningsfrågan avgöras vid en landsvägsförrättning som företas på ansökan av väghållaren eller den som yrkar på ersättning. 
75 § 
Landsvägsförrättning i särskilda fall 
Väghållaren ska utan dröjsmål ansöka om landsvägsförrättning när en enskild väg eller en gata har ändrats till landsväg eller när en landsväg eller ett biområde dragits in. 
I syfte att bestämma gränsen för en befintlig landsvägs vägområde, biområde, skyddsområde eller frisiktsområde kan landsvägsförrättning företas på ansökan av väghållaren eller fastighetens ägare. Vid en sådan förrättning kan ersättning bestämmas för förluster som en breddning av vägen eller biområdet orsakar samt ett ersättningsärende enligt 71 § 2 mom. avgöras. 
Om en befintlig väg omfattar en fastighet som väghållaren äger eller en del av en sådan fastighet, kan ett sådant område vid landsvägsförrättning överföras till en landsväg som utgör inlösningsenhet. På överföringen tillämpas vad som i fastighetsbildningslagen föreskrivs om styckning. 
79 § 
Utbetalning av ersättning samt ränta 
De förskottsersättningar och slutliga ersättningar som väghållaren ålagts att betala, jämte sex procents årlig ränta, ska betalas inom tre månader räknat från den tidpunkt då ersättningarna fastställdes. Vid dröjsmål med betalningen av ersättning ska på denna betalas en årlig dröjsmålsränta enligt den räntesats som avses i 4 § 1 mom. i räntelagen (633/1982). 
Vid ägoreglering är mottagaren av ett område skyldig att till väghållaren betala en ersättning för området till den del som ersättningen inte kan dras av från de betalningar som väghållaren påförts, och överlåtaren av området får en ersättning av väghållaren för det överlåtna området. På de ersättningar som avses i detta moment tillämpas vad som i 1 mom. föreskrivs om beräkning av ränta och utbetalning av ersättning. 
Den årliga räntan på sex procent som avses i 1 mom. beräknas från och med det besittningstagande som avses i 56 §, om inte annat överenskoms när det gäller besittningstagande enligt 56 § 3 mom., samt i de fall som avses i 74 och 75 § från och med tidpunkten för slutsammanträdet i samband med landsvägsförrättningen. Ränta på ersättning som bestämts på grund av ägoreglering beräknas från den tidpunkt som vid förrättningen har bestämts för besittningstagande av områdena. 
80 § 
Deponering av ersättning som är stridig 
Om väghållaren anför besvär över ersättningar som bestämts vid en landsvägsförrättning kan den del av ersättningen som bestridits deponeras. På deponeringen tillämpas 52 § 2 och 3 mom. samt i 70 § i inlösningslagen. 
81 § 
Tvångsverkställighet i särskilda fall 
På en ersättning som har bestämts vid en landsvägsförrättning och som sakägaren ska betala till väghållaren samt på egendom som till följd av ägoreglering har bytts ut, tillämpas vad som föreskrivs i 288 § i fastighetsbildningslagen. 
83 § 
Ringa ersättningar 
Om det totala belopp av de ersättningar som inlösningskommissionen har bestämt att väghållaren ska betala till en och samma sakägare inte överstiger 20 euro, behöver ersättningarna inte betalas eller deponeras. 
85 § 
Kostnaderna för landsvägsförrättning 
Väghållaren svarar för förrättningskostnaderna vid en landsvägsförrättning. Vid en landsvägsförrättning enligt 74 § ska förrättningskostnaderna helt eller delvis påföras den som framställt yrkandet, om yrkandet har varit uppenbart ogrundat. 
88 § 
Upphörande av landsväg 
Om en landsväg i samband med förbättring har fått en ny sträckning och det i vägplanen inte har bestämts att vägen med den tidigare sträckningen kvarstår som landsväg, upphör den till denna del att vara landsväg. Trots detta får väghållaren och landskapet använda det tidigare vägområdet för andra vägändamål enligt vad som bestäms i vägplanen. Vid landsvägsförrättning ska då bestämmas att vägområdet kvarstår i väghållarens ägo eller att vägrätten till området fortsätter att vara i kraft. Om en sådan bestämmelse inte har tagits in i vägplanen, upphör användningen av området för landsvägsändamål och rätten till området när den förbättrade landsvägen upplåtits för allmän trafik. 
När ett vägområde till en landsväg som upphört inte längre behövs för övriga vägändamål enligt 1 mom., drar väghållaren in användningen av området och väghållarens rätt till området. På ett sådant område tillämpas vad som i detta kapitel föreskrivs om tidigare vägområde. 
90 § 
Konstruktioner och anordningar på ett tidigare vägområde 
Det som i väghållningssyfte byggts eller placerats på ett tidigare vägområde övergår till områdets ägare, om inte den som ansvarar för projektet för bort det inom ett år från det att vägen upphört eller överlåter det till någon annan aktör. I vägplanen ska det påvisas huruvida området behövs som enskild väg eller som gata och om det på området finns konstruktioner eller anordningar som kräver särskilt underhåll. Området ska lämnas i ett sådant skick att dess användning för nämnda syfte inte försvåras. Ansvaret för konstruktionerna och anordningarna övergår på den som håller den enskilda vägen eller gatan när landsvägen upphör.  
Om en landsväg som upphör eller dras in inte behövs för det ändamål som nämns i 1 mom. ska de åtgärder som behövs för att återställa det tidigare vägområdet i ursprungligt skick anges i vägplanen. Den som ansvarar för projektet ska vidta dessa åtgärder på egen bekostnad inom ett år från det att vägen upphört. 
Rätten att med stöd av 42 eller 42 a § placera konstruktioner, anläggningar och anordningar på ett vägområde ska när vägområdet övergår till en ny ägare förbli gällande i enlighet med det tillstånd som väghållaren beviljat eller den anmälan som gjorts till väghållaren.  
91 § 
Överföring av ett tidigare vägområde 
Om inte något annat följer av 88 § 1 mom. övergår ett vägområde som väghållaren äger och som hör till en landsväg som upphört från väghållaren kostnadsfritt till den fastighet som ligger närmast invid. Inom ett detaljplaneområde eller ett område för vilket kommunen beslutat utarbeta en detaljplan övergår vägområdet i kommunens ägo. Bestämmelser om överföring av ett vägområde till kommunen när en detaljplan träder i kraft finns i 93 § i markanvändnings- och bygglagen. 
Vad som föreskrivs i 1 mom. gäller också för tidigare vägområden som använts för andra vägändamål som avses i 112 § 6 mom. efter det att väghållaren har dragit in användningen av området på det sätt som avses i 88 § 2 mom. 
Om en landsvägs vägområde enligt 58 § 1 mom. och 112 § 4 och 5 mom., som har innehafts med vägrätt och som har upphört, har anvisats i detaljplanen som ett sådant allmänt område som avses i 83 § 1 mom. i markanvändnings- och bygglagen, ska vägrätter som belastat ägarens eller innehavarens rättigheter beaktas vid bestämmandet av eventuell ersättning för ett sådant område i samband med genomförandet av detaljplanen. 
Vägområdet övergår till de angränsande fastigheterna längs mittlinjen av det område som vägens körbana eller körbanor bildar. Rån mellan fastigheter som gränsar till varandra fortsätter på vägområdet från dess gräns lodrätt mot mittlinjen. Trots vad som sagts ovan får en rå vid rågång på det tidigare vägområdet rätas ut och andra sådana råjusteringar göras som med hänsyn till fastighetsindelningen är ändamålsenliga så att små områden som till arealen är av ringa värde byts ut mellan fastigheterna eller, om inget lämpligt vederlagsområde finns, övergår från en fastighet till en annan. 
93 § 
Ett tidigare vägområde som enskild väg 
Även om ett vägområde som har hört till en tidigare landsväg har övergått till den närmast intill liggande fastighetens ägare eller övergått i kommunens ägo får också andra som behöver området som enskild vägkostnadsfritt använda det som sin väg, tills de frågor som berör vägrätten har behandlats så som föreskrivs i 69 § eller vid en landsvägsförrättning enligt 75 § 1 mom. 
Frågor som gäller användningen av de områden som avses i 92 § 2 och 3 mom. som enskild väg behandlas och avgörs enligt lagen om enskilda vägar. 
Väghållaren svarar för underhållet av en sådan tidigare landsväg som avses i 1 mom. fram till den 1 oktober kalenderåret efter indragningen av landsvägen. 
Innan väghållarens underhållsskyldighet upphör ska vägdelägarna sinsemellan vid en landsvägsförrättning besluta om underhållet av den tidigare landsvägen. Vid behov kan det fattas ett temporärt beslut om underhållet. Ett sådant beslut om underhåll upphör att gälla när landsvägsförrättningen vunnit laga kraft, om inte annat bestämts om beslutets giltighet när beslutet fattades. 
95 § 
Indragning av biområde 
Väghållaren drar in ett biområde när området inte längre behövs för det ändamål som det har inrättats för. När ett biområde dras in upphör samtidigt den vägrätt som hänfört sig till området. 
Ett sådant indraget biområde enligt 2 § 2 mom. i fastighetsregisterlagen (392/1985) som har införts som annan registerenhet i fastighetsregistret ska vid en landsvägsförrättning bestämmas höra till den fastighet från vilken det har upplåtits för vägändamål eller, om denna fastighet inte längre existerar, till den fastighet eller de fastigheter där biområdet områdesmässigt passar bäst. 
Om indragningen av ett biområde medför sådan nytta för någon som inte ska anses vara obetydlig, är denne skyldig att ersätta väghållaren för den erhållna nyttan. Om överenskommelse om ersättningen inte nås, ska frågan avgöras vid en landsvägsförrättning. 
95 a § 
Indragning och överlåtelse av en del av ett vägområde  
Väghållaren får dra in sådana delar av ett vägområde som inte behövs för landsvägsändamål. Väghållarens rätt till en indragen del av ett vägområde upphör då beslutet om indragning har fattats. Väghållaren ska utan dröjsmål ansöka om en landsvägsförrättning när en del av ett vägområde har dragits in. Vid behov kan en vägplan utarbetas och godkännas för indragning av en del av ett vägområde. 
En indragen del av ett vägområde som är i väghållarens ägo överförs vid landsvägsförrättningen till den fastighet som ligger närmast invid, med iakttagande av vad som i fastighetsbildningslagen föreskrivs om styckning. Om indragningen av en del av ett vägområde har inletts på initiativ av någon annan än landskapet eller väghållaren, svarar den som inlett ärendet för landsvägsförrättningens förrättningskostnader. På ersättandet av den nytta som erhålls vid indragningen av ett vägområde som är i väghållarens ägo tillämpas 95 § 3 mom. 
På det som i väghållningssyfte byggts eller placerats på en indragen del av ett vägområde tillämpas 90 § 1 mom. 
Trots vad som föreskrivs i 1 mom. har väghållaren rätt att överlåta sådana delar av ett vägområde som inte behövs för väghållningen. På överlåtelsen tillämpas lagen om rätt att överlåta statlig fastighetsförmögenhet (973/2002). 
7 kap. 
Särskilda bestämmelser 
99 § 
Beslutsfattande 
Trafikverket godkänner utredningsplaner och vägplaner. Om en kommun, ett landskap eller Statens tillstånds- och tillsynsmyndighet på centrala punkter i planen är av annan åsikt än Trafikverket, ska frågan föras till kommunikationsministeriet för avgörande. Trafikverket kan av särskilda skäl också annars föra en plan till kommunikationsministeriet för godkännande. 
99 a § 
Avgifter 
I fråga om avgifter som tas ut för tillstånd och anmälningar som avses i denna lag föreskrivs i lagen om grunderna för avgifter till staten (150/1992) och med stöd av den.  
99 b § 
Överföring av biträdande uppgifter  
Trafikverket kan genom avtal överföra de biträdande terräng- och rådgivningsuppgifter som anknyter till dess tillståndsuppgifter inom väghållningen till en privat eller offentlig tjänsteleverantör.  
Tjänsteleverantören ska ha tillräckliga tekniska förutsättningar samt tillräckliga kunskaper för skötseln av de uppgifter som avses i 1 mom. På den personen som sköter uppgifterna tillämpas bestämmelserna om straffrättsligt tjänsteansvar när personen utför de uppgifter som avses i denna paragraf. Bestämmelser om skadeståndsansvar finns i skadeståndslagen (412/1974). 
100 § 
Förberedelser för störningar och undantagsförhållanden 
Väghållaren och landskapen inom väghållningsområdet ska samarbeta vid förberedelser för störningar i de normala förhållandena och för de undantagsförhållanden som avses i beredskapslagen (1552/2011) genom beredskapsplanering och genom att på förhand förbereda för de åtgärder som ska vidtas vid störningar i de normala förhållandena och vid undantagsförhållanden. Vid förberedelserna ska hänsyn tas till landsvägens betydelse för trafiken, väglaget och de förutsägbara förändringarna i det samt övriga omständigheter.  
Trafiksäkerhetsverket får meddela närmare föreskrifter om den beredskapsplanering som krävs av väghållaren och landskapen för att säkerställa att förberedelserna är enhetliga i hela landet och att de tillgodoser de behov som gäller undantagsförhållanden och störningar i de normala förhållandena på landsvägar. 
100 a § 
Trafikverkets säkerhetsstyrningssystem för väghållningen  
Genom Trafikverkets säkerhetsstyrningssystem för väghållningen ska hanteringen av riskerna i samband med väghållningen tryggas på alla riks- och stamvägar samt alla livligt trafikerade regionala vägar. 
Säkerhetsstyrningssystemet ska upprättas skriftligt. Det ska innehålla en säkerhetspolitik som har godkänts av Trafikverket och meddelats hela personalen samt kvalitativa och kvantitativa mål för upprätthållande och förbättring av säkerheten och planer och förfaranden för uppnående av dessa mål. 
I säkerhetsstyrningssystemet ska särskild vikt fästas vid ansvarsfördelningen inom organisationen, att övervakning bedrivs av samtliga nivåer inom organisationen, att personalen deltar i beslutsfattandet om styrningssystemet samt att säkerhetsstyrningssystemet förbättras kontinuerligt. 
Trafiksäkerhetsverket får meddela närmare föreskrifter om innehållet i säkerhetsstyrningssystemet. 
100 b § 
Myndighetstillsyn över väghållningen 
Trafiksäkerhetsverket utövar tillsyn över att 13, 13 a, 33, 100 och 100 a § och de bestämmelser som utfärdats och föreskrifter som meddelats med stöd av dem iakttas. Trafiksäkerhetsverket ska sköta dess tillsynsuppgifter effektivt och på ett så ändamålsenligt sätt som det utgående från riskbedömningen är möjligt. 
Trafiksäkerhetsverket kan i samband med skötseln av de uppgifter som avses i 1 mom. ge en anmärkning till den som handlar i strid med denna lag eller i strid med bestämmelser som utfärdats eller föreskrifter som meddelats med stöd av den samt ålägga denne att avhjälpa sitt fel eller sin försummelse inom en skälig tidsfrist. Verket får förena förpliktelsen med vite eller hot om avbrytande av verksamheten eller med hot om att åtgärderna vidtas på den försumliges bekostnad. Bestämmelser om vite, hot om avbrytande och hot om tvångsutförande finns i viteslagen. 
Trafiksäkerhetsverket har, när det sköter uppgifter som avses i 1 mom., rätt att få den information som verket behöver för att fullgöra sina uppgifter av dem vilkas rättigheter och skyldigheter denna lag gäller samt av aktörer som handlar för deras räkning. 
101 § 
Administrativa tvångsmedel 
Väghållaren eller landskapet kan förbjuda den som bryter mot denna lag eller mot bestämmelser som utfärdats eller föreskrifter som meddelats med stöd av den att fortsätta med eller upprepa det lagstridiga förfarandet. Väghållaren eller landskapet kan också föreskriva att den som bryter mot denna lag eller mot bestämmelser som utfärdats eller föreskrifter som meddelats med stöd av den ska fullgöra sin skyldighet. Väghållaren eller landskapet kan förena sitt beslut med vite eller med hot om att den försummade åtgärden vidtas på den försumliges bekostnad eller att verksamheten avbryts. I fråga om vite, tvångsutförande och avbrytande tillämpas i övrigt viteslagen. 
Om en brådskande åtgärd krävs för att avlägsna en fara som omedelbart hotar trafiken eller om det är fråga om rättelse av en olovlig åtgärd som riktar sig mot ett vägområde, har väghållaren och landskapet rätt att vidta åtgärden eller att rätta till den olovliga åtgärden på bekostnad av den som är skyldig att rätta till den. 
Om väghållaren eller landskapet förhindras att utföra ett tjänsteuppdrag som avses i 2 mom. eller ett utredningsarbete som avses i 16 § 1 mom., ska polisen på begäran ge handräckning i enlighet med 9 kap. 1 § i polislagen (872/2011).  
102 § 
Indrivning av kostnader 
Om landskapet eller väghållaren har rätt att vidta en åtgärd som avses i denna lag på någon annans bekostnad, kan kostnaderna indrivas i den ordning som föreskrivs i lagen om indrivning av skatter och avgifter i utsökningsväg (367/1961). 
103 § 
Delgivning och delfående av beslut 
Väghållaren sänder besluten om godkännande av utredningsplaner och vägplaner samt om förlängning av deras giltighetstid till landskapet. I syfte att delge beslutet ska landskapet på det sätt som landskapets tillkännagivanden offentliggörs i enlighet med landskapslagen tillkännage att beslutet och de handlingar som utgör grund för beslutet är framlagda offentligt. Beslutet och handlingarna ska vara offentligt framlagda i landskapet under 30 dagar. Delfåendet anses ha skett när beslutet lades fram offentligt. 
Ett sådant beslut om godkännande av en vägplan som är av ringa betydelse kan delges genom bevislig delgivning enligt vad som föreskrivs i förvaltningslagen. Bestämmelser om delgivning av beslut på elektronisk väg finns i lagen om elektronisk kommunikation i myndigheternas verksamhet (13/2003). 
104 § 
Meddelande om beslut till dem som gjort en anmärkning och till myndigheterna 
Landskapet ska samtidigt när ett beslut om godkännande av en utredningsplan och en vägplan delges genom offentlig delgivning i enlighet med 103 § sända ett meddelande om beslutet till dem som på grund av planen gjort en anmärkning och vars adresser är kända. 
Väghållaren ska underrätta landskapet, kommunen och Statens tillstånds- och tillsynsmyndighet samt vid behov även andra myndigheter om beslut om godkännande av en utredningsplan och en vägplan. En kopia av planen ska vid behov fogas till meddelandet. 
105 § 
Ändringssökande 
Omprövning av ett beslut som gäller behörighetsintyg enligt 43 f § får begäras på det sätt som föreskrivs i förvaltningslagen. 
I beslut av statsrådets allmänna sammanträde får ändring sökas genom besvär hos högsta förvaltningsdomstolen på det sätt som föreskrivs i förvaltningsprocesslagen (586/1996). Ändring i andra beslut som fattats med stöd av denna lag och beslut som har meddelats med anledning av en begäran om omprövning får sökas genom besvär hos förvaltningsdomstolen på det sätt som föreskrivs i förvaltningsprocesslagen. 
Bestämmelser om sökande av ändring i landskapens beslut finns i 18 kap. i landskapslagen.  
I beslut av förvaltningsdomstolen får ändring genom besvär sökas endast om högsta förvaltningsdomstolen beviljar besvärstillstånd. 
Besvär över väghållarens beslut i fall som avses i 37 §, 38 § 2 mom., 42 § 1 mom., 42 a §, 47 §, 48 § 2 mom. och 52 § ska anföras hos den förvaltningsdomstol inom vars domkrets anslutningen, övergångsstället, vägområdet, fastigheten eller reklamaffischen eller annonsen i fråga finns. 
Kommunen, landskapet och Statens tillstånds- och tillsynsmyndighet har rätt att söka ändring genom besvär i ett sådant beslut om godkännande av en utredningsplan eller vägplan vars verkningar sträcker sig till kommunens eller landskapets område eller myndighetens verksamhetsområde. 
En lokal eller regional registrerad sammanslutning eller stiftelse har rätt att i ärenden som hör till dess verksamhetsfält söka ändring genom besvär i ett sådant beslut om godkännande av en utredningsplan eller vägplan vars verkningar sträcker sig till sammanslutningens eller stiftelsens geografiska verksamhetsområde. 
Besvär som gäller ett sådant beslut om godkännande av en utredningsplan eller en vägplan som ska anses vara av samhällelig vikt ska behandlas skyndsamt. 
Bestämmelser om sökande av ändring i beslut som fattats vid landsvägsförrättningar finns i 87 §. 
107 § 
Omedelbar verkställighet av beslut 
Ett beslut av statsrådet ska trots ändringssökande iakttas tills ärendet har avgjorts genom ett laga kraft vunnet beslut. 
Ett beslut om godkännande av en utredningsplan eller en vägplan eller om förlängning av dess giltighetstid kan verkställas trots besvär, om inte fullföljdsdomstolen bestämmer något annat. 
I ett beslut som väghållaren meddelar med stöd av 48 § 2 mom. kan bestämmas att beslutet får verkställas trots besvär. 
108 § 
Kungörelse 
Om kungörelse, förordnande, förbud eller något annat ärende ska delges offentligt enligt denna lag och det inte särskilt har utfärdats bestämmelser om på vilket sätt delgivningen ska ske, ska den behöriga myndigheten informera om ärendet genom att under minst 30 dagar kungöra det offentligt på det sätt som föreskrivs i 62 a § i förvaltningslagen.  
108 a § 
Landsvägsregister  
Väghållaren ska föra ett landsvägsregister. I registret antecknas 
1) huruvida landsvägen är en motorväg eller någon annan väg som är avsedd endast för en viss art av trafik, 
2) den klassificering enligt 4 § som beskriver vägens betydelse för trafiken,  
3) vägens längd inom varje kommun och den tidpunkt då vägen upplåtits för allmän trafik samt, med tanke på förvaltningen av trafikledsegendomen, vägens viktigaste tekniska egenskaper, utrustning och anordningar. 
Landskapen ska till väghållaren lämna de uppgifter som behövs med tanke på 1 mom. 3 punkten. 
109 a § 
Dispens 
Trafikverket kan av särskilda skäl bevilja dispens från föreskrifter som verket meddelat. Dispens får dock inte beviljas om det äventyrar trafiksäkerheten eller vägens trafikmässiga eller tekniska funktion.  
Dispens ska sökas innan åtgärder vidtas. Den som ansöker om dispens ska lägga fram en redogörelse för de risker som avvikandet medför och för metoderna för att hantera dessa. Trafikverket kan förena beslutet med villkor och begränsningar för att säkerställa säkerheten och vägens trafikmässiga eller tekniska funktion.  
Bestämmelser om ikraftträdandet av denna lag utfärdas separat genom lag. 
Lagens rubrik, bestämmelserna i 1–4, 8–10, 13, 13 a §, 1 a kap. samt 15 q–15 s, 17, 19, 22, 32, 32 a, 33, 42, 53 a, 100, 100 a, 100 b, 109 a § och upphävandet av 9 § träder dock i kraft den 20 .  
Den behörighet som landskapen har enligt 1 a kap. i denna lag ska före den 1 januari 2020 först utövas av landskapens temporära beredningsorgan och efter valet av landskapsfullmäktige av landskapsfullmäktige och den landskapsstyrelse som utses av denna. I stället för det förfarande som föreskrivs i 15 d § 4 mom. i denna lag ska möjlighet att bekanta sig med de i de 15 d § avsedda planutkasten och att framföra åsikter om dem ges före den 1 januari 2020 genom att informera om saken i det allmänna informationsnätet. 
Den behörighet som väghållaren har enligt 6 § och 42 § 1–4 mom. i denna lag utövas fram till den 31 december 2019 av närings-, trafik- och miljöcentralen. Den behörighet som Trafikverket har enligt 99 b § i denna lag utövas fram till den 31 december 2019 av närings-, trafik- och miljöcentralen. Den behörighet som landskapet har enligt 15 q–15 s, 32 och 100 § i denna lag utövas fram till den 31 december 2019 av närings-, trafik- och miljöcentralen. 
På utredningsplaner, vägplaner och vägprojekt som har börjat utarbetas eller genomföras men inte är färdiga vid ikraftträdandet av 13, 13 a, 15 o, 15 q–15 s , 19, 22 och 33 § i denna lag tillämpas de bestämmelser som gällde vid ikraftträdandet av nämnda paragrafer. På avtal som Trafikverket och närings-, trafik- och miljöcentralen har ingått med en utomstående serviceproducent före ikraftträdandet av 13, 13 a, 15 o, 15 q–15 s, 19, 22 och 33 § i denna lag tillämpas de bestämmelser som gällde vid ikraftträdandet av nämnda paragrafer. 
2. 
Lag 
om ändring av 2 § i lagen om Trafikverket 
I enlighet med riksdagens beslut 
ändras i lagen om Trafikverket (862/2009) 2 § som följer: 
2 § 
Uppgifter 
Trafikverket har till uppgift att 
1) upprätthålla och utveckla trafiksystemet i samarbete med andra aktörer, 
2) svara för statens väg- och bannät samt de farleder som verket förvaltar och för samordnandet av åtgärder som gäller dem samt styra och övervaka farledshållningen i hela landet, 
3) svara för att viktiga vägprojekt genomförs och för planering, underhåll och byggande av banor och farleder, 
4) svara för styrningen av väghållningen samt för samarbetet och avtalsarrangemang med landskapen, 
5) svara för den särskilda finansieringen av trafik- och transporttjänster i skärgården inom ramen för statsbudgeten, 
6) svara för samarbetet i fråga om trafikuppgifter och för avtalsarrangemang med landskapen, 
7) främja samordningen av trafiken och markanvändningen och delta i beredningen av en riksomfattande trafiksystemplan samt i upprättandet av trafiksystemplaner på landskapsnivå i samråd med landskapen, kommunerna, stadsregionerna och övriga aktörer, 
8) sörja för trafikledningen och dess utveckling på statens trafikleder och i sjöfart även utanför statens farleder enligt vad som särskilt föreskrivs om detta, 
9) trygga vintersjöfartens förutsättningar, 
10) utveckla och främja trafiktjänsterna och marknadens funktion, 
11) främja höjandet av farledshållningens produktivitet, 
12) utveckla verksamhetsbetingelserna för kollektivtrafiken samt bevilja stöd för främjandet av sjöfarten och andra trafikformer, 
13) sörja för underhållet och utvecklingen av sjökartläggningen, 
14) bereda sig på att inom sitt verksamhetsområde sörja för att trafiksystemet fungerar under undantagsförhållanden och vid störningar under normala förhållanden. 
Trafikverket ska även sörja för andra sådana uppgifter inom verksamhetsområdet som det har enligt särskilda bestämmelser. 
Bestämmelser om ikraftträdandet av denna lag utfärdas särskilt genom lag. 
3. 
Lag 
om ändring av 2 § i lagen om Trafiksäkerhetsverket 
I enlighet med riksdagens beslut 
ändras 2 § i lagen om Trafiksäkerhetsverket (863/2009), sådan den lyder delvis ändrad i lagarna 74/2015 och xx/xxx (RP 145/2017), som följer:  
2 § 
Uppgifter 
Trafiksäkerhetsverket har till uppgift att 
1) sörja för den allmänna säkerheten i trafiksystemet och utvecklandet av säkerheten,  
2) begränsa miljöolägenheter som orsakas av trafiken,  
3) sörja för tryggandet av sjöfarten och luftfarten,  
4) sörja för uppgifter i anslutning till trafikmarknaden, främjandet av mobilitetstjänster och utvecklandet av trafiksystem inom sitt verksamhetsområde, 
4 a) främja digitaliseringen i anslutning till trafiken och trafikmarknaden samt möjliggöra genomförandet av experiment, forskning och innovationer i anslutning till trafik och transport,  
5) delta i den strategiska och funktionella beredningen av en riksomfattande trafiksystemplan samt i upprättandet av trafiksystemplaner på landskapsnivå i samråd med landskapen, kommunerna, stadsregionerna och övriga aktörer samt inom ramen för sin särskilda behörighet övervaka att reglerna och föreskrifterna om trafiksystemet iakttas,  
6) sköta intecknings-, beskattnings- och registreringsuppgifter samt informationstjänstuppgifter inom sitt verksamhetsområde, 
7) utfärda de tillstånd, godkännanden och andra beslut som krävs inom verksamhetsområdet och sörja för ordnandet av bedömningen av behörigheter,  
8) utfärda rättsnormer som gäller verksamhetsområdet inom ramen för särskilt föreskriven behörighet, 
8 a) sköta de uppgifter som tilldelats verket i anslutning till prissättning av transporter, 
9) inom ramen för sina befogenheter ingå internationella fördrag av teknisk karaktär som inte gäller området för lagstiftningen, 
10) delta i internationellt samarbete inom sitt verksamhetsområde, 
11) bereda sig på att inom sitt verksamhetsområde sörja för att trafiksystemet fungerar under undantagsförhållanden och vid störningar under normala förhållanden. 
Trafiksäkerhetsverket ska även sörja för andra sådana myndighetsuppgifter inom verksamhetsområdet som det har enligt särskilda bestämmelser. 
Bestämmelser om ikraftträdandet av denna lag utfärdas särskilt genom lag. 
4. 
Lag 
om ändring av lagen om flyttning av fordon 
I enlighet med riksdagens beslut 
ändras i lagen om flyttning av fordon (828/2008) 4–7, 9 och 14 §, 
av dem 5 § sådan den lyder i lagarna 729/2011 och 1508/2011, 6 § sådan den lyder delvis ändrad i lag 1508/2011, 9 § sådan den lyder delvis ändrad i lagarna 1508/2011 och x/xxxx (RP 145/2017) samt 14 § sådan den lyder delvis ändrad i lag 1319/2009, som följer:  
4 § 
Skyldigheten att flytta fordon från olycksplatser 
Ett fordons ägare, innehavare och förare är skyldiga att utan dröjsmål och senast inom två dygn efter en trafikolycka flytta fordonet från olycksplatsen. Bestämmelser om flyttning av fordon i samband med en olycka där någon har omkommit eller skadats svårt finns i 60 § i vägtrafiklagen. 
Har inte fordonet flyttats inom den tid som fastställts i 1 mom., är landsvägens väghållare eller kommunen skyldig att göra en upplags-flyttning. Vid trafikolyckor som sker på en-skilda vägar sköter kommunen upplagsflyttningar på motiverad begäran från väghållaren för den enskilda vägen. 
Om fordonet står så att det äventyrar trafiksäkerheten, är polisen skyldig att flytta fordonet utan dröjsmål. 
5 §  
Flyttning med stöd av parkeringsbestämmelser 
Har ett fordon parkerats på en väg i strid med en bestämmelse om parkering, får landsvägens väghållare, kommunen eller den kommunala parkeringsövervakaren utföra en närflyttning eller upplagsflyttning tidigast två dygn efter det att fordonet parkerats i strid med bestämmelsen. 
Har ett fordon parkerats på ett privat område eller i terrängen i strid med en bestämmelse om parkering, utför kommunen eller den kommunala parkeringsövervakaren en närflyttning eller upplagsflyttning efter två dygn på motiverad begäran från områdets ägare eller innehavare. 
Trots det som föreskrivs i 1 och 2 mom. får ett fordon flyttas utan dröjsmål, om det fordonet har felparkerats fem olika gånger i strid med en bestämmelse om parkering och det för dessa gärningar har påförts fem felparkeringsavgifter som är obetalda och i vilka ändring inte kan sökas. 
Om fordonet har parkerats så att det äventyrar trafiksäkerheten, är polisen skyldig att flytta fordonet utan dröjsmål. Medför ett parkerat fordon betydande olägenhet för väganvändningen, får polisen, landsvägens väghållare, kommunen eller den kommunala parkeringsövervakaren utföra en närflyttning eller upplagsflyttning utan dröjsmål. 
Har ett fordon i strid med 11 § 2 mom. i räddningslagen (379/2011) parkerats på en räddningsväg, får polisen eller den kommunala parkeringsövervakaren utföra en närflyttning eller upplagsflyttning utan dröjsmål.  
6 §  
Flyttning på grund av arbete som utförs eller evenemang som ordnas inom vägområdet 
Medför ett parkerat fordon olägenhet för underhåll eller renhållning eller reparations- eller byggarbeten inom vägområdet, får landsvägens väghållare utföra en närflyttning. Detsamma gäller vid ett evenemang som med väghållarens tillstånd ordnas inom vägområdet. På enskilda vägar sköter kommunen närflyttningen på motiverad begäran från väghållaren för den enskilda vägen. 
Om det på förhand är känt att ett arbete eller ett evenemang ska ske inom vägområdet, ska flyttningen av fordon meddelas minst två dygn på förhand genom lämplig märkning eller lämpliga anslag på området. I exceptionella situationer eller efter myndighetens prövning kan fordon flyttas utan förhandsanmälan om att ett arbete ska utföras inom vägområdet.  
Om en närflyttning av ett fordon inte kan utföras på grund av trafik eller utrymmesbrist eller av andra motsvarande orsaker, får en upplagsflyttning av fordonet utföras. 
7 §  
Flyttning av ett övergivet fordon 
Om det utifrån ett fordons värde, skick och andra faktorer som kan konstateras utvändigt är uppenbart att fordonet är övergivet men inte är skrotfordon, är landsvägens väghållare inom sitt område skyldig att flytta fordonet till ett upplag. Ett övergivet fordon på en enskild väg eller ett privat område flyttas av kommunen till ett upplag på motiverad begäran från väghållaren för den enskilda vägen eller innehavaren av det privata området. Bestämmelserna i denna paragraf gäller även flyttning på polisens begäran av ett övergivet fordon som omhändertagits av polisen. 
9 §  
Meddelande om flyttning av fordon och flyttningsbeslut 
Myndigheten ska muntligen eller skriftligen underrätta fordonets ägare eller innehavare om en närflyttning eller lämna ett meddelande om flyttningen på ett synligt ställe på fordonet. Myndigheten ska upprätta ett protokoll över närflyttningen av fordonet eller göra någon annan skriftlig anteckning i ett dokument som gäller flyttningen. 
Myndigheten ska meddela ett skriftligt beslut om en upplagsflyttning. Beslutet ska delges den sista ägare som antecknats i trafik- och transportregistret eller annan känd ägare och innehavare genom vanlig delgivning med iakttagande av förvaltningslagen (434/2003). En kopia av beslutet eller en förteckning med de uppgifter som är av betydelse för identifieringen av flyttade fordon ska även sändas till polisen. Om fordonets ägare eller dennes adress inte är känd, ska bestämmelserna om offentlig delgivning tillämpas på delgivningen av beslutet. Beslutet ska meddelas utan dröjsmål efter flyttningen. Beslutet ska innehålla en uppmaning att hämta fordonet inom 30 dagar från delfåendet vid äventyr att fordonet övergår i kommunens ägo. Beslut enligt 2 mom. meddelas av den myndighet som har flyttat fordonet. Orsaken till flyttningen, vilket fordon som flyttats, varifrån och vart fordonet flyttats samt namnet på och kontaktuppgifter till den som flyttat fordonet ska uppges i beslutet. 
14 §  
Verkställighet och närmare bestämmelser 
Kommunikationsministeriet ansvarar för den riksomfattande styrningen av de uppgifter som föreskrivs i denna lag. 
Trafikverket kan med stöd av ett avtal ge landskapet i uppgift att sköta sådana offentliga uppgifter som enligt denna lag ankommer på verket eller själv överta offentliga uppgifter som enligt denna lag ankommer på landskapet. 
Bestämmelser om ikraftträdandet av denna lag utfärdas särskilt genom lag. 
5. 
Lag 
om ändring av 76 och 80 § i luftfartslagen 
I enlighet med riksdagens beslut 
ändras i luftfartslagen (864/2014) 76 och 80 § som följer:  
76 § 
Användning av flygplatser och andra områden 
För start och landning med luftfartyg får användas endast flygplatser eller sådana områden som avses i 2 mom. Förbudet att använda andra områden gäller inte nödlägen, nödlandningar eller andra därmed jämförbara situationer och inte heller start och landning med obemannade luftfartyg eller militära helikoptrar, andra statliga helikoptrar eller, vid räddningsflygningar, handräckningsflygningar och operativa flygningar, med helikoptrar som används för efterspanings- och räddningsverksamhet. I fråga om användning av landningsområden på fartyg för start och landning med helikoptrar föreskrivs särskilt. 
För start och landning med luftfartyg får tillfälligt användas ett öppet vattenområde samt med samtycke av områdets ägare eller innehavare något annat land- eller vattenområde, även om området inte särskilt har organiserats för ett sådant ändamål. Trafiksäkerhetsverket meddelar vid behov för säkerheten inom luftfarten behövliga föreskrifter om 
1) tillfällig användning av land- och vattenområden, 
2) dimensionering av och ytegenskaper hos områden som används av luftfartyg, 
3) flyghinderbegränsningar, 
4) andra omständigheter som påverkar säkerheten vid start och landning. 
Bestämmelser om det samtycke av delägarlaget för ett samfällt mark- eller vattenområde som förutsätts för det tillstånd av mark- eller vattenområdets ägare eller innehavare som behövs för verksamhet enligt 2 mom. finns i lagen om samfälligheter (758/1989). 
Om det krävs av hänsyn till flygsäkerheten eller för att trafiken ska kunna löpa smidigt eller av skäl som hänför sig försvaret eller för idkande av näring eller förebyggande av skadliga miljökonsekvenser, kan Trafiksäkerhetsverket förbjuda användningen av andra områden än en flygplats eller begränsa användningen av ett område som avses i 2 mom. till luftfartygs starter och landningar. Trafiksäkerhetsverket ska höra det landskap som saken gäller samt vid behov andra myndigheter, om skälet till förbudet eller begränsningen är något annat än flygsäkerhet eller att trafiken ska kunna löpa smidigt. 
Landskapet kan årligen bevilja stöd för verksamhets-, underhålls- och investeringskostnader till trafikflygplatsers och flygplatsers utanför statens flygplatsnätbolag. Stöd kan beviljas enligt Europeiska unionens riktlinjer för statligt stöd till flygplatser och flygbolag (2014/C 99/03) samt enligt EU kommissionens förordning (EU) nr 651/2014 av den 17 juni 2014 genom vilken vissa kategorier av stöd förklaras förenliga med den inre marknaden enligt artiklarna 107 och 108 i fördraget och dess förändringar. Bedömningen av om understödsanslaget är tillräckligt görs enligt landskapens fullmäktigeperioder. I bedömningen ska granskas trafikflygplatsers och flygplatsers behov av statsunderstöd, verkningarna som bidraget har åstadkommit, den uppskattade utvecklingen samt förhållandet till utvecklingen av den offentliga ekonomin. 
80 §  
Hörande i samband med behandlingen av ärenden som gäller byggnadstillstånd 
Innan tillstånd till byggande av en flygplats beviljas ska kommunen samt, enligt ärendets art, försvarsministeriet, miljöministeriet, Statens tillstånds- och tillsynsmyndighet samt landskapet ges tillfälle att avge utlåtande i ärendet. 
Om ansökan om byggnadstillstånd avser byggande eller i 79 § avsedda ändringar av ett annat område som tjänar luftfarten än en flygplats eller konstruktioner och anordningar på en sådan, ska kommunen samt, enligt ärendets art, andra behöriga myndigheter och grannarna ges tillfälle att avge utlåtande i ärendet innan byggnadstillstånd beviljas. 
Bestämmelser om ikraftträdandet av denna lag utfärdas särskilt genom lag. 
6. 
Lag 
om ändring av 9 § i gruvlagen 
I enlighet med riksdagens beslut 
ändras i gruvlagen (621/2011) 9 § som följer:  
 
9 § 
Tillståndsplikt för malmletning 
För malmletning krävs tillstånd av gruvmyndigheten (malmletningstillstånd), om malmletningen inte kan genomföras som prospekteringsarbete enligt 7 § eller fastighetsägaren inte gett sitt samtycke till arbetet. 
Malmletningstillstånd krävs också om 
1) malmletningen kan medföra olägenhet för människors hälsa, den allmänna säkerheten eller annan näringsverksamhet eller om verksamheten kan försämra landskaps- eller naturskyddsvärden, 
2) malmletningen har som mål att lokalisera och undersöka fyndigheter av uran eller torium, eller 
3) tillståndet behövs för att en i denna lag avsedd företrädesrätt för utvinning av en fyndighet ska fås. 
På områdesbegränsningar som gäller malmletning tillämpas på motsvarande sätt vad som föreskrivs om dem i 7 § 2 och 3 mom. 
För malmletning krävs dessutom samtycke av den myndighet eller inrättning som är behörig i saken eller av den berörda rättsinnehavaren när det gäller ett gatuområde eller ett torg enligt markanvändnings- och bygglagen, en landsvägs vägområde enligt lagen om trafiksystem och landsvägar (503/2005), en flygplats eller annat område som tjänar luftfarten enligt luftfartslagen (1194/2009), ett järnvägsområde enligt banlagen (110/2007), en kanal eller annat motsvarande trafikområde för allmän trafik eller ett område som ligger på mindre än 30 meters avstånd från sådana trafikområden, om inte ett bredare skyddsområde fastställts i de lagarna, någon annan lag eller med stöd av lag. 
Denna lag träder i kraft den 20 . 
7. 
Lag 
om ändring av 2 § i fastighetsregisterlagen 
I enlighet med riksdagens beslut 
ändras i fastighetsregisterlaglagen (392/1985) 2 § sådan den lyder i lagarna 559/1995, 274/1998, 448/2000 och 375/2016, som följer: 
2 § 
I fastighetsregistret införs som fastigheter 
1) lägenheter, 
2) tomter, 
3) allmänna områden, 
4) statens skogsmarker, 
5) skyddsområden som i enlighet med naturvårdslagen HYPERLINK "https://www.finlex.fi/sv/laki/ajantasa/1996/19961096" \o "Uppdaterade lagen" (1096/1996) eller tidigare gällande lagstiftning har inrättats på områden som tillhör staten (skyddsområde),  
6) områden som har avskilts genom inlösning (inlösningsenhet), 
7) områden som har avskilts för allmänna behov, 
8) fristående tillandningar samt 
9) allmänna vattenområden.  
Som andra registerenheter införs i fastighetsregistret samfällda områden samt biområden som enligt lagen om allmänna vägar HYPERLINK "https://www.finlex.fi/sv/laki/ajantasa/1954/19540243" \o "Uppdaterade lagen" (243/1954) och 58 § 2 mom. i lagen om trafiksystem och landsvägar HYPERLINK "https://www.finlex.fi/sv/laki/ajantasa/2005/20050503" \o "Uppdaterade lagen" (503/2005) besitts med vägrätt. 
Denna lag träder i kraft den 20 .  
8. 
Lag 
om ändring av lagen om transportservice 
I enlighet med riksdagens beslut 
ändras i lagen om transportservice (320/2017) III avd. 3 kap. 11 § och 4 kap. 1 §, IV avd. 1 kap. 4 § 1 mom. och 5 § 1 mom., av dem III avd. 3 kap. 11 § sådan den lyder i lag xx/xxxx (RP 145/2017 rd) och III avd. 4 kap. 1 § sådan den lyder delvis ändrad i lag xx/xxxx (RP 145/2017 rd), som följer: 
AVDELNING III 
TJÄNSTER 
3 kap. 
Upphandlingsförfaranden och beviljande av ensamrätt 
11 § 
Allmän trafikplikt inom luftfarten 
Landskapet beslutar om införande av sådan allmän trafikplikt för luftfarten som avses i 16 kap. i flygtrafikförordningen efter att ha hört Trafikverket och Trafiksäkerhetsverket. Landskapet kan besluta om begränsningar enligt flygtrafikförordningen för en rutt som omfattas av allmän trafikplikt om det behövs för att säkerställa trafik på rutten i fråga. 
Köpta tjänster för flygtrafik som landskapen ansvarar för att ordna ska finansieras separat. Trafikverket ska rikta finansieringen så att den täcker landskapets serviceförpliktelse inom ramen för anslaget i statsbudgeten. Trafikverket ska avtala om saken med landskapet. 
4 kap. 
Offentligt stöd för trafiktjänster 
1 § 
Statsfinansieringens användningsändamål 
Av de anslag i statsbudgeten som anvisats för köp och utveckling av tjänster som avses i denna lag kan ersättningar, stöd eller understöd betalas ut till 
1) trafikidkare enligt vad som föreskrivs i Europeiska unionens lagstiftning, 
2) användare av trafiktjänster på grundval av en förbindelse som ingås av den behöriga myndigheten enligt vilken kostnaderna för trafiktjänster ersätts upp till ett i förväg fastställt värde, 
3) landskap, kommuner, samkommuner, allmännyttiga samfund och andra än trafikidkare för utveckling, planering och forskning som gäller transporttjänster. 
Genom förordning av statsrådet kan utfärdas närmare bestämmelser om användningsändamålet och förutsättningarna för beviljande av anslag som avses i 1 mom.  
AVDELNING IV 
MYNDIGHETER OCH TILLSYN 
1 kap. 
Myndigheternas verksamhet 
4 § 
Behöriga vägtrafikmyndigheter enligt trafikavtalsförordningen 
Landskapen samt de kommunala myndigheter som nämns i 2 mom. och de regionala myndigheter som nämns i 3 mom. är sådana behöriga vägtrafikmyndigheter som avses i trafikavtalsförordningen. Landskapet kan sköta uppgiften ensamt eller tillsammans med ett eller flera landskap enligt vad som föreskrivs i landskapslagen (xx/2018).  
5 § 
Behöriga järnvägstrafikmyndigheter enligt trafikavtalsförordningen 
Kommunikationsministeriet, landskapen och, inom sitt behörighetsområde, Samkommunen Helsingforsregionens trafik är de behöriga myndigheter som avses i trafikavtalsförordningen i ärenden som gäller järnvägstrafiken. Behöriga myndigheter i ärenden som gäller annan spårtrafik är landskapen och inom sina behörighetsområden de kommunala och regionala myndigheter som nämns i 4 § 2 och 3 mom. 
Bestämmelser om ikraftträdandet av denna lag utfärdas särskilt genom lag.  
9. 
Lag 
om ändring av 93 § i markanvändnings- och bygglagen 
I enlighet med riksdagens beslut 
ändras i markanvändnings- och bygglagen (132/1999) 93 § sådan den lyder i lag 504/2005, som följer: 
93 § 
Överföring av ett vägområde för en landsväg till kommunen 
Ett sådant vägområde för en landsväg som ingår i ett detaljplaneområde och som ägs av väghållaren övergår utan ersättning i kommunens ägo när detaljplanen träder i kraft, och för väghållaren uppkommer samtidigt vägrätt till vägområdet enligt 58 § 3 mom. i lagen om trafiksystem och landsvägar (503/2005). 
Denna lag träder i kraft den 20 . 
10. 
Lag 
om ändring av 12 kap. 3 § i sjölagen  
I enlighet med riksdagens beslut 
ändras i sjölagen (674/1994) 12 kap. 3 § som följer: 
12 kap. 
Begränsningsfond och begränsningsmål 
3 § 
Ansökan om upprättande av fond och därtill ansluten utredning 
Den som ansöker om upprättande av begränsningsfond ska hos Statens tillstånds- och tillsynsmyndighet och, när det gäller landskapet Åland, hos Statens ämbetsverk på Åland deponera ett penningbelopp som motsvarar ansvarsbeloppet eller ställa av myndigheten godkänd säkerhet för beloppet. 
I ansökan, som ska vara skriftlig, ska sökanden redogöra för de omständigheter på vilka ansökan grundas samt lämna uppgift om namn och adress på dem som kan antas vilja anmäla fordringar mot begränsningsfonden. 
Bestämmelser om ikraftträdandet av denna lag utfärdas särskilt genom lag.  
11. 
Lag 
om ändring av miljöskyddslagen för sjöfarten  
I enlighet med riksdagens beslut 
ändras i miljöskyddslagen för sjöfarten (1672/2009) 9 kap. 4, 5 och 7 § samt 12 kap. 1, 4, 9, 15, 16 och 18 §, av dem 9 kap. 5 § och 12 kap. 18 § sådana de lyder i lag 998/2014, 12 kap. 1 § sådan den lyder delvis ändrad i lag 998/2014 och 4 § sådan den lyder delvis ändrad i lag 473/2016, som följer: 
9 kap. 
Mottagning av avfall i hamn 
4 §  
Godkännande av avfallshanteringsplanen 
Avfallshanteringsplanen för en hamn ska läggas fram för godkännande för Statens tillstånds- och tillsynsmyndighet. Småbåtshamnar ska dock presentera sina planer för godkännande hos miljövårdsmyndigheten i den kommun där hamnen är belägen. 
En avfallshanteringsplan ska ändras om det sker en betydande förändring i fråga om kvalitet, kvantitet eller hantering av det avfall som avlämnas i en hamn. Om det inte finns något behov att ändra planen inom tre år från dess godkännande, ska hamninnehavaren till den berörda tillsynsmyndigheten skicka en anmälan om att planen fortsatt gäller. Planen ska ändras på tillsynsmyndighetens uppmaning. Av uppmaningen ska det framgå vilka delar av planen som ska ändras. 
En hamns avfallshanteringsplan ska godkännas om avfallsmottagningen och mottagningsanordningarna uppfyller kraven i detta kapitel och 10 kap. och i de bestämmelser och föreskrifter som utfärdats med stöd av dem. 
När en hamns avfallshanteringsplan har godkänts ska Statens tillstånds- och tillsynsmyndighet och den kommunala miljövårdsmyndigheten registrera planen i datasystemet för miljövårdsinformation enligt miljöskyddslagen. Ett registerutdrag ska då sändas till hamninnehavaren. 
5 §  
Tillfälle att bli hörd och informering om en hamns avfallshanteringsplan 
Innan hamninnehavaren lägger fram hamnens avfallshanteringsplan för Statens tillstånds- och tillsynsmyndighet eller den kommunala miljövårdsmyndigheten för godkännande, ska hamninnehavaren ge de fartygsinnehavare som använder hamnen och deras företrädare samt andra som kan beröras av planen tillfälle att uttrycka sin åsikt om avfallshanteringsplanen eller om en ändring av den. Utkastet till avfallshanteringsplan ska under minst 14 dagar medan hamnen är i funktion hållas tillgängligt på hamninnehavarens verksamhetsställe och på något annat ändamålsenligt sätt. Hamninnehavaren ska på sin anslagstavla samt på sin webbplats, på elektronisk väg, per brev eller på något annat lämpligt sätt informera dem som använder hamnen och andra berörda att utkastet finns tillgängligt. 
Hamninnehavaren ska lämna dem som ansvarar för avfallshanteringen på fartyg som använder hamnen och deras företrädare uppgifter om avfallshanteringsarrangemangen i hamnen och om avfallshanteringsavgifterna. Detta ska ske så att hamnens samtliga viktiga användargrupper får denna information. Statens tillstånds- och tillsynsmyndighet eller den kommunala miljövårdsmyndigheten får i samband med att den godkänner en avfallshanteringsplan vid behov bestämma på vilka språk informationen till dem som ansvarar för avfallshanteringen på fartyg som använder hamnen och deras företrädare ska lämnas. 
7 §  
Rapportering 
Statens tillstånds- och tillsynsmyndighet, Trafiksäkerhetsverket och hamnarna ska sända den information som avses i Europaparlamentets och rådets direktiv 2000/59/EG om mottagningsanordningar i hamn för fartygsgenererat avfall och lastrester, nedan fartygsavfallsdirektivet, till Finlands miljöcentral, som har i uppgift att sammanställa en rapport som ska skickas till Europeiska kommissionen. 
12 kap.  
Tillsyn och administrativt tvång  
1 §  
Tillsynsmyndigheter 
Tillsynsmyndigheter enligt denna lag är Trafiksäkerhetsverket, Finlands miljöcentral, Statens tillstånds- och tillsynsmyndighet, Gränsbevakningsväsendet, Tullen och polisen.  
Kommunikationsministeriet och miljöministeriet sörjer för den allmänna styrningen och utvecklingen av verksamheten enligt denna lag. 
4 §  
Statens tillstånds- och tillsynsmyndighets tillsynsuppgifter 
Statens tillstånds- och tillsynsmyndighet ska utöva tillsyn över efterlevnaden av bestämmelserna i denna lag och med stöd av den utfärdade bestämmelser och föreskrifter till den del de gäller 
1) hamnarnas planering av avfallshanteringen, och 
2) hamnarnas mottagningsanordningar för fartygsgenererat avfall och sediment. 
Tillsynsuppgiften gäller särskilt sådana hamnar för handelssjöfart som måste ha miljötillstånd enligt miljöskyddslagen. 
9 §  
Handräckning 
Meteorologiska institutet, Finlands miljöcentral, Försvarsmakten och Statens tillstånds- och tillsynsmyndighet ska inom respektive behörighet lämna tillsynsmyndigheterna den handräckning de behöver för utförande av uppgifter enligt denna lag. 
Bestämmelser om handräckning när det gäller oljeutsläppsavgift finns i 3 kap. 8 §. 
15 §  
Administrativt tvång 
Trafiksäkerhetsverket och Statens tillstånds- och tillsynsmyndighet får i ärenden inom sin respektive behörighet enligt denna lag 
1) förbjuda den som bryter mot denna lag eller en med stöd av den utfärdad förordning eller föreskrift att fortsätta med eller upprepa ett förfarande som bryter mot bestämmelserna eller föreskrifterna, 
2) ålägga den som bryter mot denna lag eller en med stöd av den utfärdad förordning eller föreskrift att fullgöra sin skyldighet på något annat sätt, 
3) bestämma att den som förfarit på ett sådant sätt som avses 1 eller 2 punkten ska återställa miljön i ursprungligt skick eller att undanröja den olägenhet som överträdelsen orsakat miljön. 
16 §  
Vite, hot om tvångsutförande och hot om avbrytande 
Trafiksäkerhetsverket och Statens tillstånds- och tillsynsmyndighet får förena ett förbud eller föreläggande som de utfärdat med stöd av denna lag med vite, hot om tvångsutförande eller hot om avbrytande. Bestämmelser om de nämnda sanktionerna finns i övrigt i viteslagen (1113/1990). 
18 §  
Närmare bestämmelser 
Närmare bestämmelser om Trafiksäkerhetsverkets, Finlands miljöcentrals, Statens tillstånds- och tillsynsmyndighets, gränsbevakningsväsendets, Tullens och polisens uppgifter som tillsynsmyndigheter och om arbetsfördelningen mellan dessa myndigheter får utfärdas genom förordning av statsrådet. 
Bestämmelser om ikraftträdandet av denna lag utfärdas särskilt genom lag.  
12. 
Lag 
om ändring av 45 § i postlagen 
I enlighet med riksdagens beslut 
ändras i postlagen (415/2011) 45 § som följer: 
45 § 
Placering av anordningar och konstruktioner som behövs för postutdelning 
En kommun är skyldig att tillåta att sådana anordningar och mindre konstruktioner, såsom postlådor, som behövs för insamling och utdelning av brevförsändelser placeras på sådana allmänna områden som anvisats i en detaljplan, om de inte kan placeras på något annat för postföretaget eller adressaten rimligt sätt och till rimliga kostnader. Anordningar och mindre konstruktioner som behövs för insamlingen och utdelningen får inte medföra onödig fara för trafiken eller väsentlig olägenhet för underhåll, renhållning och annan användning av ett allmänt område. 
Ägaren till en tomt, någon annan fastighet eller en byggnad är skyldig att tillåta att anordningar eller mindre konstruktioner som behövs för insamlingen och utdelningen fästs på en vägg, en port eller vid ett staket eller placeras på marken under de förutsättningar som anges i 1 mom. Skyldigheten kan dock påföras endast om den är rimlig med hänsyn till ägaren. 
Anordningar eller mindre konstruktioner som behövs för insamling och utdelning får placeras vid sådana landsvägars skydds- eller frisiktsområden som avses i lagen om trafiksystem och landsvägar HYPERLINK "https://www.finlex.fi/sv/laki/ajantasa/2005/20050503" \o "Uppdaterade lagen" (503/2005), om placeringen eller användningen av lådorna inte medför onödig fara för trafiken eller väsentlig olägenhet för väghållningen. 
Denna lag träder i kraft den 20 . 
13. 
Lag 
om ändring av banlagen  
I enlighet med riksdagens beslut 
upphävs i banlagen (110/2007) 6, 25 a, 43 a och 89 a §, av dem 25 a, 43 a och 89 a § sådana de lyder i lag 567/2016, samt 
 
ändras 3–5, 8–10, 12, 15, 22, 25, 28, 28 a, 28 c, 69, 79, 91,92 och 95 §, av dem 3, 10, 28 a, 28 c, 92 och 95 § sådana de lyder i lag 567/2016, 8, 22, 79 och 91 § sådana de lyder delvis ändrade i lag 1243/2009, 28 § sådan den lyder i lag 1243/2009 och 69 § sådan den lyder i lag 1629/2015, som följer:  
3 § 
Defitioner 
I denna lag avses med 
1) järnväg en en- eller flerspårig bana samt ett järnvägsområde och de byggnader, anläggningar och anordningar som finns där och som behövs för att sköta och trygga trafiken samt för all verksamhet som hänför sig till dessa, 
2) järnvägsområde ett område som behövs för banan, banområdet, byggnaderna, anordningarna och skötseln av trafiken samt för all verksamhet som hänför sig till dessa och behövliga serviceområden för järnvägstrafik, 
3) serviceområde för järnvägstrafik områden som behövs direkt för servicefunktionerna inom järnvägstrafiken, 
4) frisiktsområde ett sådant område i en plankorsning som är fritt från hinder som skymmer sikten mot banan, 
5) biområde ett marktäktsområde eller en placeringsplats för marksubstanser som behövs för banhållningen eller ett område som reserverats för anordningar som behövs för banhållningen, 
6) skyddsområde ett område utanför järnvägsområdet som behövs för att främja en trygg användning av banan, 
7) banhållning planering, förvärv, byggande, förvaltning och underhåll av en järnväg och fast egendom som hänför sig till den samt förbättring av en befintlig järnväg, 
8) byggandeav järnväg anläggande av ny järnväg och förbättring av befintlig järnväg, 
9) bannät statsägda järnvägar som förvaltas av Trafikverket och med TEN-nätet de järnvägar som hör till ett sådant stomnät eller övergripande nät som avses i Europaparlamentets och rådets förordning (EU) nr 1315/2013 om unionens riktlinjer för utbyggnad av det transeuropeiska transportnätet och om upphävande av beslut nr 661/2010/EU, 
10) privat spåranläggning en till bannätet ansluten järnväg som inte är statsägd och inte förvaltas av Trafikverket, 
11) väg enskilda vägar enligt lagen om enskilda vägar HYPERLINK "https://www.finlex.fi/sv/laki/ajantasa/1962/19620358" \o "Uppdaterade lagen" (358/1962) samt andra enskilda vägar, landsvägar enligt lagen om trafiksystem och landsvägar HYPERLINK "https://www.finlex.fi/sv/laki/ajantasa/2005/20050503" \o "Uppdaterade lagen" (503/2005) och gator enligt markanvändnings- och bygglagen HYPERLINK "https://www.finlex.fi/sv/laki/ajantasa/1999/19990132" \o "Uppdaterade lagen" (132/1999),  
12) väghållare sådana vägdelägare som avses i lagen om enskilda vägar gemensamt eller ett väglag, då ett sådant har bildats, eller en fastighetsägare eller den väghållningsmyndighet som avses i 11 § 1 mom. i landsvägslagen eller kommunen i egenskap av ansvarig för gatuhållningen i enlighet med markanvändnings- och bygglagen, 
13) trafikanordning trafikljus, vägmärken, avstängnings- och varningsanordningar samt vägmarkeringar.  
Med en fastighet jämställs vid tillämpningen av denna lag även ett outbrutet område och fastigheters samfällda område. 
4 §  
Klassificering av järnvägar 
Stomnätet för järnvägar består av banor för snabb persontrafik och tung godstrafik, vilka är av nationell betydelse och dessutom betjänar långväga trafik mellan landskapen. Stomnätet ska erbjuda möjlighet till både snabb persontrafik och effektiv godstrafik. 
Det övriga bannätet består av banor för person- och godstrafik, vilka kompletterar stomnätet. 
Bestämmelser om vilka banor som hör till stomnätet för järnvägar utfärdas genom förordning av kommunikationsministeriet. Närmare bestämmelser om stomnätets servicenivå när det gäller förmedlingskapacitet, funktion, hastighet och axellaster samt andra faktorer som påverkar servicenivån får utfärdas genom förordning av kommunikationsministeriet. 
5 §  
Allmänna krav på banhållningen 
Bannätet ska utvecklas och underhållas och investeringar ska göras i syfte att främja 
1) målsättningarna för den riksomfattande trafiksystemplaneringen, 
2) uppnåendet av de riksomfattande målen för områdesanvändningen och utvecklingen av områdena samt i samband med planeringen av markanvändningen målsättningarna för samhällsstrukturen och miljön och en ekonomisk områdes- och samhällsstruktur, 
3) minskning av trafikutsläppen, samt 
4) möjligheterna att utnyttja data och digitalisering, automatisering av trafiken och förutsättningarna för utveckling av trafiktjänsterna. 
Järnvägarna ska med beaktande av deras trafikmässiga betydelse planeras, byggas och underhållas så att 
1) bannätet erbjuder förbindelser för trygg och fungerande trafik och transporter mellan olika regioner i landet med beaktande av tillgängliga förbindelser, olika befolkningsgruppers trafikbehov och olika näringsgrenars transportbehov, 
2) bannätet skapar förutsättningar för utveckling av en miljö med många aktörer så att de som bedriver järnvägstrafik har likvärdiga förutsättningar att tillhandahålla tjänster på bannätet, 
3) de olägenheter som bannätet och järnvägstrafiken förorsakar miljön blir så små som möjligt och att naturresurserna används sparsamt, 
4) banhållningen inte leder till att någon tillfogas större skada eller olägenhet än behövligt, 
5) järnvägarna trafikmässigt och tekniskt är så funktionella som möjligt, att de från järnvägstrafikens och den övriga trafikens synpunkt är så säkra som möjligt och att syftet med dem uppnås så förmånligt som möjligt, 
6) områdets nuvarande och planerade markanvändning beaktas, 
7) informationen om järnvägarna och deras underhåll uppdateras och är tillgänglig, samt så att 
8) järnvägarna och den digitala infrastrukturen i anslutning till dem är kompatibla med det övriga trafiknätet och den digitala infrastrukturen i anslutning till det. 
Järnvägar ska byggas när ett allmänt trafikrelaterat behov eller säkerheten så kräver eller i syfte att avlägsna eller minska olägenheter av trafiken eller om markanvändningen så kräver. En ny järnväg kan byggas om det existerande bannätet inte längre svarar mot trafikens eller områdesanvändningens behov, och om dessa behov inte kan tillfredsställas ändamålsenligt eller olägenheterna av trafiken inte kan avlägsnas eller i tillräcklig utsträckning minskas genom att ett banavsnitt förbättras eller trafiksystemet utvecklas i något annat avseende. En järnväg får inte byggas i strid med en plan med rättsverkningar. 
Trafiksäkerhetsverket får med tanke på de krav som avses i 2 mom. meddela föreskrifter om banstrukturen och utrustningen samt om trafikanordningar vid plankorsningar. 
8 § 
Allmänt om planering av järnväg 
Utredningsplaner och järnvägsplaner gäller projekt för byggande av järnvägar så som föreskrivs i detta kapitel. 
När planer görs upp ska banhållaren samarbeta med landskapen, kommunerna och övriga myndigheter. Planeringen ska grunda sig på behov av att utveckla järnvägarna, på de riksomfattande målen för områdesanvändningen, på den riksomfattande trafiksystemplaneringen, på trafiksystemplaneringen på landskapsnivå samt på den övriga områdesplaneringen.  
9 § 
Rätt till utredning 
När banhållaren har beslutat att inleda utarbetandet av en utredningsplan eller en järnvägsplan har banhållaren rätt att utföra utredningsarbeten på en fastighet som hör till planeringsområdet. För detta ändamål får på den fastighet som avses i denna paragraf utföras mätning, utmärkning i terrängen, kartläggning eller markundersökning eller andra förberedande åtgärder. I samband med utredningsarbeten får ingrepp i annans rätt inte göras i högre grad än vad som är nödvändigt för att uppnå resultat av utredningen, och ägaren eller rättsinnehavaren får inte åsamkas onödiga störningar. 
När en plan utarbetas samt utredningar som har samband med den inleds ska kommunen underrättas om det. Dessutom ska genom kungörelse på det sätt som landskapets meddelanden ska offentliggöras enligt landskapslagen ( / ) eller på annat lämpligt sätt de personer underrättas som nämns i 22 § 1 mom., och dessa har rätt att vara närvarande vid utredningarna och att framföra sin åsikt i saken. 
10 § 
Planering av järnvägsområde och områdesplanering  
En utredningsplan och en järnvägsplan som gäller byggande av en järnväg ska grunda sig på en sådan plan med rättsverkningar som avses i markanvändnings- och bygglagen och i vilken järnvägsområdets läge och dess förhållande till övrig områdesanvändning har klarlagts. På ett område för vilket en plan med rättsverkningar håller på att utarbetas eller ändras kan åtgärder vidtas i syfte att utarbeta en utredningsplan eller en järnvägsplan som grundar sig på målen för planen med rättsverkningar. 
De riksomfattande målen för områdesanvändningen samt landskapsplaner och generalplaner ska beaktas så som föreskrivs i markanvändnings- och bygglagen. 
Trots det som föreskrivs i 1 mom. kan en utredningsplan och en järnvägsplan för byggande som gäller en befintlig järnväg utarbetas, om planens förhållande till övrig områdesanvändning med beaktande av projektets karaktär kan klarläggas i tillräcklig omfattning i samarbete med trafikmyndigheterna, landskapet och kommunen. 
En utredningsplan eller en järnvägsplan får inte godkännas i strid med en landskapsplan eller i strid med en generalplan med rättsverkningar. En utredningsplan kan godkännas i strid med gällande detaljplan, om detta förordas av kommunen. En järnvägsplan kan godkännas i strid med gällande detaljplan, om det är fråga om en avvikelse med små verkningar, och om detta förordas av kommunen och de fastighetsägare som direkt påverkas av avvikelsen. 
En utredningsplan och en järnvägsplan ska utarbetas med iakttagande av vad som föreskrivs i naturvårdslagen (1096/1996) och med stöd av den. 
12 § 
Utredningsplanens innehåll 
En utredningsplan skall innehålla en utredning av behovet av att bygga en järnväg eller utveckla bannätet samt av de alternativ som granskats, de grundläggande trafiklösningarna och tekniska lösningarna för banan, järnvägsområdets ungefärliga läge samt en bedömning av verkningarna av järnvägsområdet och järnvägstrafiken, såsom verkningar på väg- och trafikförhållandena, trafiksäkerheten, markanvändningen, fastighetsstrukturen och miljön samt på människors hälsa, levnadsförhållanden och trivsel. Möjligheterna att avlägsna eller lindra menliga verkningar samt en preliminär kostnadskalkyl skall dessutom presenteras i planen. 
Utredningsplanen ska innehålla en redogörelse för hur målen för den riksomfattande trafiksystemplanen och trafiksystemplanen på landskapsnivå enligt lagen om trafiksystem och landsvägar har beaktats. 
15 § 
Järnvägsplanens innehåll 
I en järnvägsplan för byggande av järnväg skall järnvägen och dess läge, användning för olika ändamål, höjdläge, tvärsektion och torrläggning anges så att verkningarna kan bedömas tillräckligt och järnvägen kan märkas ut i terrängen. I järnvägsplanen anges de planerade planskilda korsningarna, plankorsningarna och trafikförbindelserna. Till planen skall fogas en bedömning av järnvägens verkningar samt i den anges de åtgärder som behövs för att avlägsna eller minska de menliga verkningar som byggandet av banan eller tågtrafiken medför. 
I järnvägsplanen skall i mån av möjlighet ägandeförhållandena beträffande marken beaktas. Av planen ska framgå banans skyddsområden enligt 37 § 1 mom. och plankorsningarnas frisiktsområden enligt 38 § 1 mom. samt huruvida mark reserveras för framtida breddning av banan. Till planen ska fogas en uppskattning av kostnaderna för byggandet av järnvägen. 
Om en järnväg byggs på en ny plats och den tidigare järnvägen för den gamla sträckningens vidkommande bibehålls som järnväg eller kommer att användas för andra banhållningsändamål, skall bestämmelser om detta ingå i järnvägsplanen. 
Järnvägsplanen ska innehålla en utredning om hur man i den beaktat de mål för trafik-systemplanerna på riks- och landskapsnivå som ställs upp i lagen om trafiksystem och landsvägar. En sådan utredning behövs emellertid inte om vägplanen är baserad på en utredningsplan som vunnit laga kraft och i vilken ingår en tillräcklig utredning om hur man beaktat målen för trafiksystemplanerna på riks- och landskapsnivå. 
22 § 
Växelverkan 
När en utredningsplan och en järnvägsplan utarbetas ska kommunen, fastighetsägare och övriga sakägare samt de vilkas boende, arbete eller övriga förhållanden kan påverkas av planen, ges möjlighet att delta i beredningen av planen, bedöma verkningarna av planen och skriftligen eller muntligen framföra sin åsikt i saken. 
Innan planen godkänns ska de i 1 mom. avsedda intressenterna ges tillfälle att göra en anmärkning med anledning av planen. Landskapet ska i detta syfte hålla utredningsplanen och järnvägsplanen offentligt framlagda i 30 dagar. Anmärkningarna mot planen ska ges in till landskapet före utgången av den tid under vilken planen är framlagd. Landskapet ska ge de kommuner vilkas områden berörs av planen tillfälle att framföra sina åsikter om anmärkningarna. Landskapet ska lämna banhållaren sitt utlåtande om den plan som varit framlagd och om anmärkningarna mot den samt de anmärkningsskrifter som lämnats in. Landskapet ska på det sätt som landskapens tillkännagivanden ska kungöras enligt landskapslagen kungöra framläggandet av planen samt på vilket sätt och inom vilken tid anmärkningar kan göras. Tillkännagivandet ska alltid publiceras i minst en tidning med allmän spridning inom det område som påverkas. Banhållaren ska sända ett skriftligt meddelande om att planen lagts fram till de ägare och innehavare av fastigheter inom planens verkningsområde som är bosatta i en annan kommun och som nämns i handlingarna eller annars är kända. 
Banhållaren ska meddela sitt motiverade ställningstagande till de anmärkningar som gjorts mot planen. Banhållaren ska underrätta kommunerna inom området om sitt ställningstagande samt dem som gjort anmärkningar och som skriftligen har bett om att bli underrättade och samtidigt uppgett sin adress.Banhållarens motiverade ställningstagande meddelas i det beslut som gäller godkännandet av planen. 
Banhållaren ska begära utlåtande om utredningsplanen och järnvägsplanen av Statens tillstånds- och tillsynsmyndighet samt av de landskap och kommuner vars område planen gäller och på vars område verkningar av planen i övrigt visar sig. Banhållaren ska begära utlåtande också av andra myndigheter, om det behövs för beslutsprövningen.  
Om en järnvägsplan som varit offentligt framlagd behöver ändras och ändringens verkningar bedöms vara obetydliga, kan ett enklare förfarande iakttas än vad som föreskrivs i 2–4 mom. 
Närmare bestämmelser om förfarandet för växelverkan utfärdas genom förordning av statsrådet. 
25 § 
Ändring av och mindre avvikelser från planerna 
Om det är nödvändigt att ändra en godkänd utredningsplan eller järnvägsplan ska det göras i enlighet med vad som i denna lag och med stöd av den föreskrivs om nya utredningsplaner och järnvägsplaner.  
Från en godkänd järnvägsplan får avvikas utan att den behöver ändras, om avvikelsen har ringa verkningar och banhållaren i samband med byggandet prövar att avvikelsen är behövlig och ändamålsenlig.  
28 §  
Godkännande av planer 
Kommunikationsministeriet godkänner järnvägsplaner som gäller nedläggning av en järnväg i andra fall än i samband med byggandet av en järnväg. Övriga järnvägsplaner och utredningsplaner godkänns av Trafikverket. Om en kommun, ett landskap eller Statens tillstånds- och tillsynsmyndighet på centrala punkter i planen är av annan åsikt än Trafikverket, ska frågan föras till kommunikationsministeriet för avgörande. Trafikverket kan av särskilda skäl även i övrigt föra en plan till kommunikationsministeriet för godkännande. 
28 a §  
Tillstånd för byggande och flyttande av en plankorsning 
Nya plankorsningar får byggas bara inom det bannät som inte hör till stomnätet och TEN-nätet. Av särskilda skäl får en ny plankorsning byggas på ett sådant banavsnitt inom stomnätet och TEN-nätet där banans högsta tillåtna hastighet permanent är högst 50 kilometer i timmen. En plankorsning inom stomnätet och TEN-nätet får flyttas, om flyttandet i betydande grad förbättrar säkerheten vid plankorsningen eller om det finns andra särskilda skäl till det. 
För byggande eller flyttande av en sådan plankorsning som avses i 1 mom. krävs tillstånd av banhållaren. Tillståndet kan vid behov beviljas för viss tid. Banhållaren kan meddela tekniska föreskrifter om innehållet i tillståndsansökan. Väghållaren kan beviljas ett sådant tillstånd om det behövs för en nödvändig trafikförbindelse och säkerheten vid plankorsningen tryggas med hjälp av säkerhetsanordningar eller andra arrangemang. Tillstånd behövs inte om plankorsningen anges i en sådan godkänd vägplan som avses i landsvägslagen. 
Om användningen av en plankorsning ökar betydligt eller dess användningsändamål ändras, ska väghållaren hos banhållaren ansöka om ett tillstånd som berättigar till den ökade eller ändrade användningen. 
Banhållaren kan bevilja tillstånd för byggande av en tillfällig plankorsning för den tid arbete pågår eller då det finns andra särskilda skäl till det, om plankorsningen inte äventyrar trafiksäkerheten. På en tillfällig plankorsning tillämpas vad som föreskrivs i 28 b och 28 d §. 
Banhållaren kan förena tillståndsbeslutet med villkor som gäller byggandet av plankorsningen eller en ny användningsform för den, underhåll eller avlägsnande av plankorsningen, eller en väg som ansluter till plankorsningen. 
Innan ett tillstånd för plankorsning beviljas ska banhållaren höra de järnvägsoperatörer som trafikerar banavsnittet i fråga. 
28 c §  
Tillstånd att korsa en järnväg 
Banhållaren kan bevilja tillstånd att vid en plankorsning korsa en järnväg med snöskoter eller något annat terrängfordon, dock endast på sådana banavsnitt som inte hör till stomnätet och TEN-nätet. Av särskilda skäl kan tillstånd att korsa en järnväg i anslutning till en plankorsning inom stomnätet och TEN-nätet beviljas. 
Tillstånd att korsa en järnväg får beviljas bara om det med hjälp av tillståndsvillkor säkerställs att användningen av terrängfordon inte skadar banan eller funktionen hos järnvägsområdets konstruktioner, inte medför olägenhet för banhållningen och inte äventyrar trafiksäkerheten. Ett tillstånd att korsa en järnväg kan vid behov beviljas för viss tid. 
Banhållaren kan för viss tid bevilja polisen, Tullen och Gränsbevakningsväsendet tillstånd att för övervakningsuppdrag i terräng korsa en järnväg vid en plankorsning med snöskoter eller något annat terrängfordon också på andra banavsnitt än sådana som avses i 1 mom., på de villkor som anges närmare i tillståndet. 
På sådana plankorsningar och tillstånd att korsa en järnväg som avses i denna paragraf tillämpas 18 § 4 mom., 28 a § 3, 5 och 6 mom. samt 28 b §. 
69 § 
Utbetalning av ersättning samt ränta 
De förskottsersättningar och slutliga ersättningar som banhållaren ålagts att betala, jämte sex procents årlig ränta, ska betalas inom tre månader räknat från den tidpunkt då ersättningarna bestämdes. Vid dröjsmål med betalningen av ersättning ska på denna betalas en årlig dröjsmålsränta enligt den räntefot som avses i 4 § 1 mom. i räntelagen (633/1982). 
Vid ägoreglering är mottagaren av ett område skyldig att till banhållaren betala en ersättning för området till den del som ersättningen inte kan dras av från de betalningar som banhållaren påförts, och överlåtaren av området får en ersättning av banhållaren för det överlåtna området. På de ersättningar som avses i detta moment tillämpas vad som i 1 mom. föreskrivs om beräkning av ränta och utbetalning av ersättning. 
Den årliga räntan på sex procent enligt 1 mom. beräknas från besittningstagandet enligt 46 §, om inte annat överenskoms när det gäller besittningstagande enligt 46 § 3 mom., samt i de fall som nämns i 65 § från tidpunkten för slutsammanträdet i samband med järnvägsförrättningen. Ränta på ersättning som bestämts på grund av ägoreglering beräknas från den tidpunkt som vid förrättningen har bestämts för besittningstagande av områdena. 
Ersättningar som banhållaren ålagts att betala vid banförrättning och vägförrättning för en enskild väg enligt 43 § 3 mom. samt ovan i 2 mom. avsedda ersättningar för ägoreglering till överlåtaren av ett område betalas av banhållaren. Ersättningar som gäller en privat spåranläggning betalas av den som äger järnvägen eller har den i besittning. 
79 §  
Nedläggning av järnväg i andra sammanhang 
Kommunikationsministeriet kan lägga ned en järnväg med stöd av en järnvägsplan som beretts av Trafikverket, om 
1) järnvägen inte längre används för bedrivande av järnvägstrafik, banhållningsrelaterad trafik eller trafikens övriga behov, 
2) användning enligt 1 punkten inte kan förutses i fråga om järnvägen, 
3) det inte finns användning för järnvägen som privat spåranläggning, och 
4) tillgängligheten till området samt transportbehoven har tryggats på något annat sätt. 
Kommunikationsministeriet kan dessutom dra in en järnväg med stöd av en järnvägsplan som beretts av Trafikverket, om trafiken på järnvägen är obetydlig och det inte är ekonomiskt lönsamt att med statens medel hålla järnvägen i ett tryggt skick för trafik så som avses i 29 eller 30 § och om tillgängligheten till området samt transportbehoven har tryggats på något annat sätt. 
Kommunikationsministeriet ska innan ett beslut enligt denna paragraf fattas vid behov höra de ministerier, landskap och kommuner som saken gäller. 
91 §  
Meddelande om beslut till dem som gjort en anmärkning och till myndigheterna 
Samtidigt som ett beslut om godkännande av en utredningsplan och en järnvägsplan delges offentligt enligt 90 § ska banhållaren sända ett meddelande om beslutet till dem som på grund av planen gjort en anmärkning och vilkas adresser är kända. 
Banhållaren ska sända ett meddelande om beslutet om godkännande av en utredningsplan och en järnvägsplan till landskapet och kommunen samt vid behov även till andra myndigheter. En kopia av planen ska vid behov fogas till meddelandet.  
92 § 
Ändringssökande 
Beslut som har fattats med stöd av denna lag får överklagas genom besvär hos förvaltningsdomstolen på det sätt som anges i förvaltningsprocesslagen (586/1996). Besvär över banhållarens beslut i de fall som avses i 18 § 4 mom. och 2 a kap. anförs hos den förvaltningsdomstol inom vars domkrets plankorsningen i fråga finns, samt i de fall som avses i 40 och 41 § hos den förvaltningsdomstol inom vars domkrets fastigheten i fråga finns. 
Förvaltningsdomstolens beslut får överklagas genom besvär endast om högsta förvaltningsdomstolen beviljar besvärstillstånd. 
Landskapet, Statens tillstånds- och tillsynsmyndighet och kommunen har rätt att anföra besvär över ett sådant beslut om godkännande av en utredningsplan eller järnvägsplan vars verkningar sträcker sig till landskapets eller kommunens område eller till myndighetens verksamhetsområde. 
En registrerad lokal eller regional sammanslutning eller stiftelse har rätt att i ärenden som hör till dess verksamhetsfält genom besvär söka ändring i ett sådant beslut om godkännande av en utredningsplan eller en järnvägsplan vars verkningar sträcker sig till sammanslutningens eller stiftelsens geografiska verksamhetsområde. 
Besvär som gäller ett sådant beslut om godkännande av en utredningsplan eller en järnvägsplan som ska anses vara av samhällelig vikt ska behandlas skyndsamt. 
Bestämmelser om sökande av ändring i beslut som fattats vid järnvägsförrättningar finns i 77 §.  
95 § 
Kungörelse 
Om en kungörelse, ett förordnande, ett förbud eller något annat ärende ska delges offentligt enligt denna lag och bestämmelser om delgivningssättet inte har utfärdats särskilt, ska den behöriga myndigheten offentliggöra ärendet genom att i minst 30 dagar kungöra det så som föreskrivs i 62 a § i förvaltningslagen.  
Bestämmelser om ikraftträdandet av denna lag utfärdas särskilt genom lag.  
Bestämmelserna i 3–5, 8, 12, 25, 28 a och 28 c § samt upphävandet av 6, 25 a och 43 a § i denna lag träder dock i kraft den 20 . 
Utöver Trafikverket kan närings-, trafik och miljöcentralen utarbeta en sådan järnvägsplan för plankorsningar som avses i 20 § 2 mom. och på centralen tillämpas då vad som i 2 kap. föreskrivs om banhållare. Denna behörighet upphör den 31 december 2019. 
Den behöriga närings-, trafik- och miljöcentralen får till den 31 december 2019 föra talan enligt 43 a § i ärenden som gäller statens bannät. 
På utredningsplaner, järnvägsplaner och banprojekt som har börjat utarbetas eller genomföras men inte är färdiga vid ikraftträdandet av 5, 8, 12 och 15 § i denna lag tillämpas de bestämmelser som gällde vid ikraftträdandet av nämnda paragrafer. På avtal som Trafikverket och närings-, trafik- och miljöcentralen har ingått med en utomstående serviceproducent före ikraftträdandet av 5, 8, 12 och 15 § i denna lag tillämpas de bestämmelser som gällde vid ikraftträdandet av nämnda paragrafer. 
14. 
Lag 
om ändring av 3 § i lagen om sättande i kraft av de bestämmelser som hör till området för lagstiftningen i fördraget med Ryssland om utarrendering av den del av Saima kanal som tillhör Ryssland och av det därtill hörande området till republiken Finland samt om fartygstrafiken genom Saima kanal och om tillämpning av fördraget  
I enlighet med riksdagens beslut 
ändras i lagen om sättande i kraft av de bestämmelser som hör till området för lagstiftningen i fördraget med Ryssland om utarrendering av den del av Saima kanal som tillhör Ryss-land och av det därtill hörande området till republiken Finland samt om fartygstrafiken genom Saima kanal och om tillämpning av fördraget (104/2011) 3 §, sådan den lyder delvis ändrad i lag 314/2016, som följer: 
3 § 
Enligt artikel 18.2 i arrendeavtalet om Saima kanal ska kommissionen för Saima kanal fungera som ett särskilt organ. Kommunikationsministeriet tillsätter kommissionen för fem år i sänder. Ordförande för kommissionen är kanalfullmäktigen och kommissionens medlemmar företräder kommunikationsministeriet, utrikesministeriet, Gränsbevakningsväsendet, Tullen, landskapet Södra Karelen och Trafikverket. 
Kommissionen ska samordna myndigheternas ståndpunkter i frågor som gäller verkställande av arrendeavtalet om Saima kanal och utvecklande av fartygstrafiken samt fungera som tillståndsmyndighet. 
Bestämmelser om ikraftträdandet av denna lag utfärdas särskilt genom lag. 
15. 
Lag 
om ändring av 234 och 318 § i lagen om tjänster inom elektronisk kommunikation 
I enlighet med riksdagens beslut 
ändras i lagen om tjänster inom elektronisk kommunikation (917/2014) 234 och 318 §, av dem 318 § sådan den lyder i lagarna 456/2016 och xx/xxxx (RP 192/2017 rd), som följer: 
234 § 
Förutsättningar för placering 
Telekablar, radiomaster och basstationer får inte placeras i strid med detaljplanen eller så att genomförandet av en gällande landskaps- eller generalplan försvåras. Placeringen får inte heller försvåra planläggningen. 
En förutsättning för placering av sådana i 229 § 1 mom. avsedda telekablar, basstationer och radiomaster som tjänar allmänna kommunikationsförbindelser är att placeringen inte på något annat sätt kan ordnas på ett tillfredsställande sätt och till skäliga kostnader. När beslutet om placeringen fattas ska det beaktas att fastigheten och byggnaden inte orsakas onödig olägenhet. Placeringen och underhållet av telekablar, radiomaster och basstationer med tillhörande utrustning får inte orsaka sådana olägenheter eller skador för användningen av fastigheten och för byggnaden som kan undvikas till skäliga kostnader. 
Telekablar ska i den utsträckning det är möjligt placeras på sådana vägområden som avses i lagen om trafiksystem och landsvägar (503/2005) eller på sådana allmänna områden som avses i fastighetsbildningslagen (554/1995). 
318 § 
Utlämnande av information från myndigheter 
Kommunikationsministeriet, Kommunikationsverket, dataombudsmannen, Konkurrens- och konsumentverket samt marknadskontroll- och produktsäkerhetsmyndigheterna har, trots sekretessbestämmelserna och andra begränsningar som gäller utlämnande av uppgifter, rätt att till varandra lämna ut dokument som de fått eller upprättat i samband med sina uppgifter enligt lag samt att för varandra röja sekretessbelagd information, om det är nödvändigt för skötseln av deras lagstadgade uppgifter.  
Kommunikationsverket har, trots sekretessbestämmelserna och andra begränsningar som gäller utlämnande av information, rätt att lämna ut dokument som det fått eller upprättat i samband med sina uppgifter enligt lag samt att röja sekretessbelagd information för Trafiksäkerhetsverket, Energimyndigheten, Finansinspektionen, Tillstånds- och tillsynsverket för social- och hälsovården samt landskapet, om det är nödvändigt för skötseln av deras lagstadgade uppgifter i anslutning till informationssäkerhet. 
Kommunikationsministeriet och Kommunikationsverket har rätt att lämna ut sekretessbelagda dokument till och röja sekretessbelagd information för kommissionen och för tillsynsmyndigheterna i andra EES-stater, om det är nödvändigt för tillsynen över kommunikationsmarknaden. 
Rätten enligt denna paragraf att lämna ut dokument och röja information gäller inte information om meddelanden, förmedlingsuppgifter, geografisk information eller information om innehållet i och existensen av konfidentiella radiosändningar. 
Kommunikationsministeriet och Kommunikationsverket får använda sekretessbelagda dokument som erhållits från utländska myndigheter endast för de ändamål som de utlämnats för. 
Bestämmelser om ikraftträdandet av denna lag utfärdas särskilt genom lag.  
16. 
Lag 
om ändring av 16 § i lagen om säkerhetsutredning av olyckor och vissa andra händelser 
I enlighet med riksdagens beslut 
ändras i lagen om säkerhetsutredning av olyckor och vissa andra händelser (525/2011) 16 § som följer: 
16 § 
Anmälningsplikt 
En myndighet som deltar i räddningsarbetet på en olycksplats ska utan dröjsmål underrätta Olycksutredningscentralen, om händelsen enligt myndighetens bedömning kan bli föremål för utredning enligt denna lag. 
Anmälningspliktiga är även 
1) Trafiksäkerhetsverket, 
2) Trafikverket, 
3) Statens tillstånds- och tillsynsmyndighet, 
4) andra säkerhetsövervakande myndigheter inom myndighetens eget verksamhetsområde, 
5) den som har tagit emot en anmälan om en olycka eller ett tillbud, 
6) en juridisk person som är inblandad i en olycka eller ett tillbud som har inträffat i sådan trafik som avses i 2 § 1 mom. 2–4 punkten eller som uppenbart lider skada av en sådan olycka. 
En domstol som har tagit emot en sådan anmälan av en fartygsbefälhavare om sjöförklaring som avses i 18 kap. 7 § 2 mom. i sjölagen (674/1994) ska utan dröjsmål förmedla anmälan till Olycksutredningscentralen och ge centralen tillfälle att delta i sjöförklaringssammanträdet och att där ställa frågor. 
Bestämmelser om ikraftträdandet av denna lag utfärdas särskilt genom lag.  
17. 
Lag 
om ändring av 12 § i lagen om transport av farliga ämnen 
I enlighet med riksdagens beslut 
ändras i lagen om transport av farliga ämnen (719/1994) 12 §, sådan den lyder i lagarna 215/2005, 1240/2010 och 956/2013, som följer: 
12 §  
Transport och tillfällig förvaring i transportkedjan 
Vid planeringen av och i verksamheten på bangårdar, inom hamnområden, på flygplatser och i andra terminaler ska beaktas de faror som transport och tillfällig förvaring av farliga ämnen medför för människor, miljön och egendom. På bangårdar, inom hamnområden, på flygplatser och i andra terminaler får transporteras och tillfälligt förvaras endast sådana mängder farliga ämnen att de inte medför särskild fara. På dessa platser ska de områden som är avsedda för farliga ämnen samt utrustningen på områdena också vara sådana att ämnena inte vid transport eller tillfällig förvaring medför någon särskild fara. 
Om betydande mängder farliga ämnen transporteras via en hamn eller förvaras tillfälligt i hamnen, ska hamninnehavaren och den som utför lasthanteringstjänster i hamnen ha en uppdaterad säkerhetsutredning. Trafiksäkerhetsverket godkänner hamnarnas säkerhetsutredningar. Verket kan begränsa mängden farliga ämnen som tillfälligt får förvaras i hamnen och meddela andra för säkerheten behövliga begränsningar i fråga om tillfällig förvaring. 
Ett järnvägsföretag ska ha en uppdaterad säkerhetsutredning för en bangård som utsetts av Trafiksäkerhetsverket och genom vilken betydande mängder farliga ämnen transporteras. Trafikverket sammanställer och kompletterar en säkerhetsutredning för hela bangården och ser till att de funktioner som beskrivs i säkerhetsutredningen bildar en fungerande helhet när det gäller säkerheten. Trafiksäkerhetsverket godkänner säkerhetsutredningen för hela bangården.  
Säkerhetsutredningen ska innehålla en redogörelse för de åtgärder och förfaranden som säkerställer en säker transport och tillfällig förvaring av farliga ämnen samt en intern räddningsplan. Den interna räddningsplanen ska innehålla en plan för de åtgärder som vidtas vid olyckor. Räddningsmyndigheterna, landskapet och tillsynsmyndigheterna ska ha tillgång till säkerhetsutredningen.  
Närmare bestämmelser om farliga ämnen och tillfällig förvaring av dessa, om förebyggande av olyckor, om transport på bangårdar, inom hamnområden, på flygplatser och i andra terminaler och om säkerhetsutredningen får utfärdas genom förordning av statsrådet. Trafiksäkerhetsverket får meddela närmare föreskrifter om det praktiska genomförandet när det gäller dessa frågor samt om avskiljande av transportenheter och ämnesspecifika förfaranden och andra tekniska detaljer.  
Bestämmelser om ikraftträdandet av denna lag utfärdas särskilt genom lag. 
18. 
Lag 
om ändring av 5 kap. 6 § i vattenlagen 
I enlighet med riksdagens beslut 
ändras i vattenlagen (587/2011) 5 kap. 6 § som följer:  
5 kap 
Dikning 
6 § 
Anmälan om dikning 
Den projektansvarige ska göra en skriftlig anmälan till den statliga tillsynsmyndigheten om annan än obetydlig dikning minst 60 dygn innan dikningen inleds. Anmälan behöver dock inte göras om det har förordnats om dikningen i ett beslut enligt 3–5 §, en vägplan enligt lagen om trafiksystem och landsvägar HYPERLINK "https://www.finlex.fi/sv/laki/ajantasa/2005/20050503" \o "Uppdaterade lagen" (503/2005) eller en järnvägsplan enligt banlagen HYPERLINK "https://www.finlex.fi/sv/laki/ajantasa/2007/20070110" \o "Uppdaterade lagen" (110/2007). Anmälan ska innehålla uppgifter om den projektansvarige och en beskrivning av projektet, dess miljökonsekvenser och dess influensområde. Närmare bestämmelser om innehållet i anmälan får utfärdas genom förordning av statsrådet. 
Den statliga tillsynsmyndigheten ska vid behov uppmana den projektansvarige att ansöka om tillstånd enligt 3 § hos tillståndsmyndigheten eller om dikningsförrättning enligt 4 §. 
Denna lag träder i kraft den 20 . 
19. 
Lag 
om ändring av sjötrafiklagen  
I enlighet med riksdagens beslut 
ändras i sjötrafiklagen (463/1996) 15–18, 21, 22 och 23 §, sådana de lyder, 15 och 17 § delvis ändrade i lag 1294/2009, 16, 18 och 23 § i lag 1294/2009, 21 § delvis ändrad i lag 691/2000, 1294/2009 och 549/2014 samt 22 § i lag 1003/2015, som följer: 
15 §  
Regionala förbud och begränsningar 
Trafik med farkoster på ett visst vattenområde kan förbjudas för viss tid eller tills vidare eller begränsas, om förbudet eller begränsningen prövas vara behövlig till skydd för trafiken, miljön, fisket eller någon annan näring eller för allmänt nyttjande av naturen för rekreation eller något annat allmänt intresse. 
Beslut om förbud och begränsningar som gäller allmänna farleder fattas av Trafikverket och när det gäller andra vattenområden av Statens tillstånds- och tillsynsmyndighet.  
Förbuden eller begränsningarna, med undantag för hastighetsbegränsningar, gäller inte användningen av farkoster som behövs för arbetet eller på grund av bostadens läge och inte heller användningen av svårt rörelsehindrade personers farkoster, om inte något annat bestäms i beslutet av särskilt vägande skäl. Trafik som är nödvändig för utförande av tjänsteuppdrag, sjuktransporter och räddningsåtgärder eller av andra motsvarande orsaker är tillåten oberoende av förbud eller begränsningar. Detsamma gäller Försvarsmaktens verksamhet. 
16 §  
Förbud och begränsningar som gäller farkosttyper 
Om användningen av en viss motordriven farkosttyp medför särskilt betydande olägenheter för naturen eller den övriga miljön, fisket eller någon annan näring, allmänt nyttjande av naturen för rekreation eller något annat allmänt intresse, kan Statens tillstånds- och tillsynsmyndighet eller, om det är fråga om en farkost som används för handelssjöfart, Trafiksäkerhetsverket förbjuda eller begränsa användningen av denna farkosttyp på ett visst område. 
17 §  
Behandlingen av förbuds- och begränsningsärenden 
En framställan om att förbud eller begränsningar som avses i 15 och 16 § ska utfärdas kan göras av kommunen eller en kommunmedlem, av landskapet eller av en sådan myndighet, sammanslutning eller ägare till ett vattenområde som berörs av saken. En framställan om utfärdande av förbud eller begränsningar kan också göras av Trafikverket, Trafiksäkerhetsverket och Statens tillstånds- och tillsynsmyndighet.  
Innan förbud eller begränsningar utfärdas ska Trafikverket, Trafiksäkerhetsverket eller Statens tillstånds- och tillsynsmyndighet höra den kommun vars område förbudet eller begränsningen gäller samt ge landskapet och de myndigheter, sammanslutningar, ägare till vattenområden och andra som berörs av saken tillfälle att bli hörda.  
Utfärdas ett förbud eller en begränsning på framställan av kommunen, ska förbudet eller begränsningen utformas enligt framställningen, om det inte är behövligt att avvika från denna med hänsyn till principen om ett opartiskt bemötande av medborgarna eller med hänsyn till den regionala enhetligheten eller av andra särskilda orsaker. 
18 §  
Ikraftträdande av förbud och begränsningar 
Trafikverket, Trafiksäkerhetsverket eller Statens tillstånds- och tillsynsmyndighet kan bestämma att dess beslut om förbud eller begränsningar även om det överklagas ska träda i kraft på det sätt som bestäms i beslutet och efter det att beslutet har tillkännagivits. Besvärsinstansen kan dock förbjuda att beslutet verkställs. 
21 §  
Tillstånd till tävlingar och övningar 
För återkommande eller permanent anordnande av tävlingar eller övningar med motordrivna farkoster på ett och samma vattenområde ska, utöver det som någon annanstans i lag föreskrivs om tillståndsplikt, tillstånd sökas hos den kommunala miljövårdsmyndigheten. Tillstånd behövs dock inte för ett område som i en detaljplan har reserverats för ändamålet eller för ett område för vilket det har beviljats miljötillstånd enligt miljöskyddslagen (527/2014).  
Tillstånd ska också sökas för anordnande av ett enskilt evenemang, om evenemanget förväntas orsaka betydande olägenheter för miljön. Kommunen kan ta ut en avgift för tillstånd som avses i 1 och 2 mom. 
Tillstånd till en tävling eller övning som genomförs på flera kommuners område beviljas av Statens tillstånds- och tillsynsmyndighet.  
En förutsättning för tillstånd som avses i denna paragraf är att evenemanget i fråga uppfyller tillräckliga säkerhetskrav och att verksamheten inte medför oskäliga olägenheter för naturen eller den övriga miljön, fisket, allmänt nyttjande av naturen för rekreation eller något annat allmänt intresse. Tillstånd kan beviljas endast om vattenområdets ägare har gett sitt samtycke. Är vattenområdet samfällt, fattas beslutet om samtycke i enlighet med lagen om samfälligheter (758/1989).  
Tillstånd behövs dock inte för övningar som genomförs av brand- och sjöräddningsväsendet eller av Försvarsmakten eller Gränsbevakningsväsendet. 
22 §  
Ändringssökande 
Beslut som avses i denna lag får överklagas genom besvär hos förvaltningsdomstolen på det sätt som anges i förvaltningsprocesslagen (586/1996). Besvär som gäller ett beslut som Statens tillstånds- och tillsynsmyndighet eller Trafikverket har fattat med stöd av 15 § 2 mom. i denna lag, som Statens tillstånds- och tillsynsmyndighet eller Trafiksäkerhetsverket har fattat med stöd av 16 § eller som Statens tillstånds- och tillsynsmyndighet har fattat med stöd av 21 § 3 mom. i denna lag ska handläggas av den förvaltningsdomstol inom vars domkrets största delen av det vattenområde som beslutet gäller är beläget. I övrigt bestäms den behöriga förvaltningsdomstolen enligt den förvaltningsdomstols domkrets där den myndighet vars beslut överklagas har sitt verksamhetsställe. 
Förvaltningsdomstolens beslut i ärenden som gäller meddelande eller ändring av ett förbud eller en begränsning som avses i 15, 16 och 20 § får överklagas genom besvär på det sätt som anges i förvaltningsprocesslagen. Över andra beslut av förvaltningsdomstolen får besvär anföras endast om högsta förvaltningsdomstolen beviljar besvärstillstånd. 
23 §  
Tillsyn 
Den allmänna tillsynen över att denna lag iakttas ankommer på Trafikverket. När det gäller förebyggandet och bekämpningen av olägenheter för miljön utövar Statens- tillstånds- och tillsynsmyndighet den allmänna tillsynen över att lagen iakttas. Användningen av farkoster på vattenområden övervakas av Trafiksäkerhetsverket, polisen, Gränsbevakningsväsendet och Tullen. 
Bestämmelser om ikraftträdandet av denna lag utfärdas särskilt genom lag. 
20. 
Lag 
om ändring av 12 § i lagen om ersättning för miljöskador 
I enlighet med riksdagens beslut 
ändras i lagen om ersättning för miljöskador (737/1994) 12 §, sådan den lyder i lag 628/2011, som följer: 
12 § 
Tillämpning av lagen vid förfaranden enligt vissa andra lagar 
Om det vid ett förfarande enligt lagen om inlösen av fast egendom och särskilda rättigheter eller någon annan därmed jämförbar lag, lagen om trafiksystem och landsvägar (503/2005), lagen om enskilda vägar (358/1962), banlagen (110/2007) eller gruvlagen (621/2011) ska bestämmas ersättning för sådana miljöskador som avses i denna lag, tillämpas vad som i denna lag föreskrivs om ersättningsskyldighet och grunder för bestämmande av ersättning, dock inte 8–10 §. Om en verksamhet enligt en lag som nämns i denna paragraf orsakar personskada som ska betraktas som miljöskada, tillämpas denna lag. 
Denna lag träder i kraft den 20 .  
21. 
Lag  
om införande av lagen om ändring av landsvägslagen och vissa andra lagar 
I enlighet med riksdagens beslut föreskrivs: 
1 kap.  
Allmänna bestämmelser 
1 § 
Författningar som träder i kraft  
Följande lagar träder i kraft den 1 januari 2020: 
1) lag om ändring av landsvägslagen (/), till den del den inte har trätt i kraft med stöd av ikraftträdandebestämmelsen i lagen i fråga, 
2) lag om ändring av 2 § i lagen om Trafikverket (/) 
3) lag om ändring av 2 § i lagen om Trafiksäkerhetsverket (/) 
4) lag om ändring av lagen om flyttning av fordon (/) 
5) lag om ändring av 76 och 80 § i luftfartslagen (/) 
6) lag om ändring av lagen om transportservice (/) 
7) lag om ändring av 12 kap. 3 § i sjölagen (/) 
8) lag om ändring av miljöskyddslagen för sjöfarten (/) 
9) lag om ändring av banlagen (/), till den del den inte har trätt i kraft med stöd av ikraftträdandebestämmelsen i lagen i fråga, 
10) lag om ändring av 3 § i lagen om sättande i kraft av de bestämmelser som hör till området för lagstiftningen i fördraget med Ryssland om utarrendering av den del av Saima kanal som tillhör Ryssland och av det därtill hörande området till republiken Finland samt om fartygstrafiken genom Saima kanal och om tillämpning av fördraget (/) 
11) lag om ändring av 234 och 318 § i lagen om tjänster inom elektronisk kommunikation (/) 
12) lag om ändring av 16 § i lagen om säkerhetsutredning av olyckor och vissa andra händelser (/) 
13) lag om ändring av sjötrafiklagen (/) 
14) lag om ändring av 12 § i lagen om transport av farliga ämnen (/). 
2 § 
Tillämpningsområde 
I denna lag föreskrivs om överföring av uppgifter enligt de lagar som nämns i 1 §, nämligen uppgifter som avses i 6 § 1 mom. 14 punkten och 2 mom. 1 punkten i landskapslagen ( / ) samt om överföring av uppgifter i samband med statsunderstöd för mobilitetsstyrning enligt 6 § 1 mom. 15 punkten i den lagen. I denna lag föreskrivs dessutom om överföring av vissa uppgifter till aktiebolag som avses i 1 § 1 mom. i lagen om ombildande av Trafikverkets trafikstyrnings- och ledningstjänster till ett aktiebolag (/). I fråga om omständigheterna i samband med överföringen av uppgifter gäller dessutom vad som föreskrivs särskilt  
2 kap.  
Bestämmelser om överföringar till landskapen 
3 § 
Övergångsbestämmelser om landskapens uppgifter och behörighet 
Sådana uppgifter inom landskapens uppgiftsområde som avses i 6 § 1 mom. 14 eller 15 punkten eller i 6 § 2 mom. 1 punkten i landskapslagen och som enligt någon annan lag ska skötas av närings-, trafik- och miljöcentralerna, det utvecklings- och förvaltningscenter som avses i 3 a § i lagen om närings-, trafik- och miljöcentralerna (897/2009), nedan utvecklings- och förvaltningscentret, av länsstyrelserna eller av landskapsförbunden ska den 1 januari 2020 i enlighet med denna lag överföras till det behöriga landskapet.  
4 § 
Övergångsbestämmelser som gäller anhängiga ärenden samt uppgiftsrelaterade rättigheter och skyldigheter  
De ärenden som är anhängiga inom närings-, trafik- och miljöcentralernas trafikansvarsområden, vid utvecklings- och förvaltningscentret samt vid landskapsförbunden och som ska överföras enligt denna lag, ingångna avtal och förbindelser samt de rättigheter och skyldigheter som följer av dem ska den 1 januari 2020 överföras till landskapen.  
5 § 
Ställningen för den personal som övergår från staten 
Överföringen av uppgifter och stödtjänstuppgifterna till dem från staten till landskapen samt överföringen av den personal som sköter dessa uppgifter från närings-, trafik- och miljöcentralernas trafikansvarsområden och från utvecklings- och förvaltningscentret till landskapen och till landskapens nationella servicecenter som avses i 118 § i landskapslagen betraktas som överlåtelse av rörelse.  
En person av vars faktiska arbetsuppgifter åtminstone hälften ska överföras, övergår i landskapets tjänst.  
Landskapet svarar för semesterlöneskuld som har förfallit till betalning vid utgången av år 2019.  
Bestämmelserna i 1 och 2 mom. ska tillämpas också på överföring av uppgifter och anställda till en sammanslutning som hör till en landskapskoncern eller där landskapen har bestämmande inflytande och som bildas senast den 31 december 2021.  
6 § 
Tilläggspensionsskydd 
De sammanslutningar som hör till landskapskoncernen eller där landskapen har bestämmande inflytande ska, om de har bildats senast den 31 december 2021, se till att de personer som övergår till anställning hos sammanslutningarna med stöd av denna lag eller till följd av landskapsreformen från att ha varit anställda av staten, och vilkas anställning fortsätter i sammanslutningen utan avbrott fram till pensionsfallet, får behålla en tilläggspensionsandel på nivån enligt 8 § 2 mom. i lagen om införande av pensionslagen för den offentliga sektorn (82/2016).  
De som på grund av landskapsreformen övergår från staten till anställning hos en sammanslutning som hör till ett landskap eller en landskapskoncern eller där landskapen har bestämmande inflytande och som har bildats senast den 31 december 2021 bevarar rätten till tilläggspensionsskydd enligt 8 § 2 mom. i lagen om införande av pensionslagen för den offentliga sektorn, om  
1) anställningsförhållandet uppfyller kraven på kontinuitet enligt 9 § i denna lag före den 1 januari 2020, och  
2) anställningsförhållandet fortsätter så som avses i 1 punkten nämnda paragrafen utan avbrott hos ett medlemssamfund i Keva från den 1 januari 2020.  
7 § 
Överföring till landskapen av statens lösa egendom samt av avtal och ansvarsförbindelser 
Till landskapen övergår den 1 januari 2020 närings-, trafik- och miljöcentralernas trafikansvarsområdens lösa egendom, de rättigheter som gäller ägande, besittning och användning av den lösa egendomen samt de immateriella rättigheter och tillstånd som hör till den verksamhet som anknyter till landskapets i denna lag avsedda uppgifter. Om uppgifterna överförs från en närings-, trafik- och miljöcentrals trafikansvarsområde till flera än ett landskap, överförs egendomen i det förhållande som motsvarar överföringen av uppgifterna, om inte staten och landskapen avtalar om något annat. Staten och landskapen kan även avtala om överföringen av lös egendom på något annat sätt. 
De avtal som gäller organiseringen av uppgifter som överförs till landskapen från närings-, trafik- och miljöcentralernas trafikansvarsområden och från utvecklings- och förvaltningscentret överförs av staten till landskapen från den 1 januari 2020. Om det inte är möjligt att överföra eller dela upp ett avtal, ska staten och landskapet avtala om för-delningen av det ansvar som avtalet medför. 
Fram till den 31 december 2023 får landskapet utnyttja upphandlingsavtal som Senats-fastigheter, Hansel Ab, Statens center för informations- och kommunikationsteknik och Servicecentret för statens ekonomi- och personalförvaltning, närings-, trafik- och miljöcentralen samt utvecklings- och förvaltningscentret ingått samt ramavtal och upphandlingsavtal som Hansel Ab konkurrensutsatt. 
8 § 
Sammanställning över egendom och avtal som överförs från staten 
Närings-, trafik- och miljöcentralernas trafikansvarsområden ska för landskapen lägga fram en detaljerad sammanställning över den i 7 § avsedda lösa egendomen, de rättig-heter som gäller ägande, besittning och användning av den lösa egendomen samt immateriella rättigheter och tillstånd. Sammanställningen ska lämnas senast den 28 februari 2019. Informationen kan tas emot också av det servicecenter som avses i 13 §. 
Landskapet eller, på uppdrag av landskapet, det servicecenter som avses i 13 § kan av staten begära kompletterande utredningar och handlingar som det anser sig behöva. Om landskapet anser att de lokaler, den övriga egendom och de avtal som överförs i landskapets besittning enligt den sammanställning som avses i 1 mom. inte tryggar organiseringen av de uppgifter som överförs från staten till landskapet på området i fråga, ska landskapet förhandla med staten. 
Staten ska komplettera den sammanställning som avses i 1 mom. senast den 30 juni 2020, om det sker väsentliga förändringar i de lokaler, den lösa egendom som överförs eller de rättigheter som gäller ägande, besittning och användning av den lösa egendomen eller de immateriella rättigheterna eller tillstånden efter det att sammanställningen har lämnats och om landskapet anser att sammanställningen behöver kompletteras. 
9 § 
Landskapets beslut 
Landskapsfullmäktige ska behandla den sammanställning som avses i 8 § och utifrån den fatta beslut om överföring av de avtal och den lösa egendom som avses i 7 §, de rättigheter som gäller ägande, besittning och användning av den lösa egendomen, immateriella rättigheter och tillstånd till landskapet och för att omfattas av landskapets ansvar.  
10 § 
Nyttjanderätt till lokaler under tiden för sökande av ändring 
Landskapets beslut enligt 9 § får verkställas innan det har vunnit laga kraft om inte förvaltningsdomstolen till någon del förbjuder verkställighet. Vid ändringssökande förs statens talan av kommunikationsministeriet. 
Landskapet har rätt att ordna de tjänster som landskapet ansvarar för och som enligt denna lag överförs från staten till landskapet i de lokaler som förvaltas av staten och att använda den lösa egendom som staten äger eller besitter och som behövs för att ordna tjänsterna och andra uppgifter, innan förvaltningsdomstolens beslut i ärendet till dess att beslutet har vunnit laga kraft.  
11 § 
Statsborgen 
Statsrådet kan, utan att kräva motsäkerheter men annars på de villkor som det bestämmer, besluta ställa statlig proprieborgen för de förbindelser som framgår av den sammanställning som avses i 8 §, för ränteväxlings- och valutaväxlingsavtal i samband med dem och för andra motsvarande skyddsarrangemang samt som garanti för räntor och för uppfyllande av andra avtalsvillkor.  
Om det för tryggande av betalningen av en i 1 mom. avsedd skuld eller för fullgörande av någon annan i 1 § mom. avsedd förbindelse har ställts säkerhet, beviljas statsborgen med