Regeringens proposition
RP
89
2015 rd
Regeringens proposition till riksdagen med förslag till ändring av bokföringslagen och vissa lagar som har samband med den samt en ny lag om offentliggörande av sådana betalningar till myndigheter som gjorts av företag som är verksamma i utvinningsindustrin eller inom avverkning av naturskog
PROPOSITIONENS HUVUDSAKLIGA INNEHÅLL
I denna proposition föreslås ändringar i flera av bokföringslagens paragrafer Ändringarna är huvudsakligen baserade på Europaparlamentets och rådets årsbokslutsdirektiv från år 2013. Det centrala syftet med direktivet och lagförslagen är att minska den administrativa börda som bokslutsregleringen innebär i synnerhet för småföretag. 
Dessutom föreslås att bokföringslagen ändras med beaktande av IT-utvecklingen när det gäller den löpande bokföringen. I de bokföringstekniska ändringarna betonas den rapporterande enhetens ansvar för lagring av underliggande dokument och uppgifter. Propositionen främjar sålunda för sin del bekämpningen av grå ekonomi. I detta syfte har sanktionshotet för dokumentlagring utvidgats till att omfatta allt bokföringsmaterial. 
I syfte att genomföra direktivet föreslås att det stiftas också en ny separat lag om rapporteringskrav för företag med verksamhet som inbegriper utvinning av olja och naturgas samt avverkning av naturskog. Dessa företag ska land-för-land rapportera betalningar till respektive länders regeringar och myndigheter. Till följd av ändringar i bokföringslagen skulle i aktiebolagslagen och i lagen om andelslag genomföras mindre revideringar. I propositionen ingår även ändringar i kreditinstitutslagen och sparbankslagen, som har förberetts i finansministeriet och som är av teknisk natur.  
Syftet med propositionen är att förtydliga bokföringslagstiftningen i strukturellt hänseende. Den förnyade normstrukturen innebär att bestämmelserna om småföretag och mikroföretag tas in i en särskild förordning. Genom den får företagaren uttömmande information om vilka omständigheter som ska framgå av bokslutet.  
Årsbokslutsdirektivet ska genomföras genom nationella bestämmelser senast den 20 juli 2015. Enligt direktivet får medlemsstaterna dock bestämma att de nationella bestämmelserna ska tillämpas först under räkenskapsperioder som börjar den 1 januari 2016 och därefter.  
Avsikten att de föreslagna lagarna ska träda i kraft så att de tillämpas för första gången under den räkenskapsperiod som börjar den 1 januari 2016 eller därefter. Enligt förslagen ska de nya reglerna kunna tillämpas vid upprättande av bokslut efter att lagen trätt i kraft. Man kunde använda de förnyade regler redan i bokslut som förbereds efter lagens ikraftträdelse. 
ALLMÄN MOTIVERING
1
Nuläge
1.1
Lagstiftning och praxis
Finlands bokföringslag och -förordning (1339/1997) är huvudsakligen baserade på rådets fjärde bolagsrättsliga direktiv (78/660/EEG, nedan 1978 års redovisningsdirektiv) och sjunde bolagsrättsliga direktiv (83/349/EEG, nedan 1983 års koncernbokslutsdirektiv). Dessa upphävdes då det nya direktivet trädde i kraft (artikel 52). 
Bokföringslagen är en allmän lag som tillämpas på alla som driver rörelse eller utövar yrke, oberoende av rättslig form. Bokföringsskyldigheten har dessutom utsträckts bl.a. till stiftelser och föreningar samt till religionssamfund. 
Utöver bestämmelser om bokföringsskyldigheten innehåller lagen bestämmelser om bokföring av affärshändelser samt bokföringsmaterial och bokslutshandlingar, dvs. resultaträkning, balansräkning och noter samt om den verksamhetsberättelse som ska fogas till bokslutet och om koncernbokslut. 
I bokföringsförordningen samt i arbets- och i näringsministeriets förordningar har med tanke på verkställigheten och tillämpningen av lagen tagits in närmare bestämmelser om resultaträknings- och balansräkningsscheman och om vad som ska framgå av dem. De gällande ministerieförordningarna och -besluten gäller följande ämnesområden: 
- aktivering av utvecklingsutgifter (1066/2008), 
- metoder som ska användas vid bokföring (47/1998), 
- tillfällig förvaring av bokföringsmaterial utomlands (49/1998), och 
- värdering samt upptagning av finansiella instrument i bokslut och koncernbokslut (1315/2004). 
Bokföringslagen är inte den enda källa på lagnivå som innehåller bestämmelser om bokföring och bokslut. Utöver bokföringslagen gäller vad som föreskrivs i annan lag eller vad myndigheter har bestämt eller föreskrivit med stöd av annan lag (bokföringslagen 8 kap. 5 §). Specialbestämmelser om bokslut och verksamhetsberättelse finns bl.a. i aktiebolagslagen (624/2006) i andra bolagsrättsliga lagar. i speciallagstiftning exempelvis om försäkringsverksamhet och kreditinstitut samt i värdepappersmarknadslagen (746/2012). 
Bokföringsnämnden som verkar i anslutning till arbets- och näringsministeriet bestämmer innebörden av begreppet god bokföringssed. Bokföringsnämnden kan dessutom bevilja undantag från vissa av lagens bestämmelser. Enligt förordningen om bokföringsnämnden (784/1973) ska nämnden utöver sina lagstadgade uppgifter meddela allmänna råd och anvisningar om tillämpningen av bokföringslagen och om bokföring, då nämnden för främjande av enhetlig god bokföringssed anser skäl därtill föreligga. Vidare ska nämnden till handels- och industriministeriet göra nödigbefunna framställningar och på begäran ge utlåtanden i sådana frågor som nämns ovan. Nämnden har, utöver sina uppgifter enligt bokföringslagen och förordningen om bokföringsnämnden, i flera andra lagar och myndighetsbestämmelser bemyndigats att ge anvisningar och utlåtanden samt att bevilja undantag från bokslutsbestämmelser. 
Efter att bokföringslagen trätt i kraft har nämnden gett utlåtanden och beviljat undantag i sammanlagt 426 fall som också har publicerats (situationen den 15 juni 2015). Dessutom har nämnden under den nämnda tiden utfärdat sammanlagt 15 gällande allmänna anvisningar i syfte att förenhetliga bokföringspraxis. 
Nämndens verksamhet är viktig när det gäller att styra praxis, eftersom lagen ger förtroendeskydd för bokföringsskyldiga som stöder sig på nämndens anvisningar och utlåtanden (utlåtande 1719/2003). Nämndens ställningstaganden är inte förpliktande, men en bokföringsskyldig som avviker från anvisningarna har den faktiska bevisbördan när det gäller frågan om god bokföringssed har förverkligats. 
1.2
Bedömning av nuläget
Bokföringslagen och annan lagstiftning som har nära samband med den har inte varit föremål för en övergripande granskning sedan bokföringslagen stiftades. Den viktigaste revideringen gjordes år 2004 då bokföringslagstiftningen reviderades enligt internationell redovisningspraxis. 
Då genomfördes Europaparlamentets och rådets förordning 1606/2002 om tillämpning av internationella redovisningsstandarder (nedan IAS-förordningen) och det s.k. fair value -direktivet (2001/65/EG). Det blev då obligatoriskt att tillämpa internationella redovisningsstandarder (nedan även IFRS-standarder) i sådana företags koncernbokslut vilkas värdepapper var föremål för offentlig handel på en reglerad marknad. Ingenting hindrar emellertid att också andra grupper av bokföringsskyldiga tillämpar standarderna. Det enda villkoret är att den bokföringsskyldiga ska ha en CGR-revisor. I praktiken upprättar företagen sällan separata finansiella rapporter enligt IFRS-standarder, eftersom rapporterna med tanke på skattedeklarationen måste justeras i flera avseenden. Ett undantag i detta avseende utgör börsnoterade bokföringsskyldiga som inte upprättar koncernbokslut, eftersom bokföringslagens 7 a kap. ålägger dem att upprätta separata finansiella rapporter i enlighet med IFRS-standarderna. 
Under den nuvarande lagens giltighetstid har det i praktiken inte förekommit några större behov att se över bestämmelserna om bokslut och verksamhetsberättelse. En bidragande orsak torde vara att bestämmelserna om bokslut och verksamhetsberättelse i stor utsträckning är baserade på EU-bestämmelser. I och med internationaliseringen kommer finländska företag emellertid att allt oftare höra till koncerner som upprättar koncernbokslut enligt IFRS-standarderna. Eftersom en del av standardernas periodiserings- och värderingsbestämmelser – exempelvis när det gäller finansiella instrument och leasingkontrakt – skiljer sig från direktivet, måste man i dessa dotterföretag göra flera arbetsdryga korrigeringar och justeringar med tanke på IFRS-koncernbokslutet. 
Det nationella manöverutrymmet såväl i Finland som i övriga medlemsstater har varit begränsat, exempelvis i fråga om lättnader för småföretag. Den gällande lagen bygger i överensstämmelse med redovisningsdirektivet på prestationsprincipen, vilket innebär att en inkomst hänförs till det år under vilket motsvarande prestation överlåts. Detta förutsätter att den bokföringsskyldiga dels har överlåtit sin produkt eller någon annan prestation och dels mottagit den råvara, arbetsprestation eller någon annan produktionsfaktor som kostnaden hänför sig till. Intäkter och kostnader beaktas sålunda oberoende av vilket datum de relaterade betalningarna har gjorts. Avvikelser i detta avseende – exempelvis i fråga om den minsta typen av företag, dvs. nanoföretag – så att intäkter och kostnader beaktas i bokslutet enligt betalningsdatum, skulle i fråga om nanoföretag i aktiebolagsform strida mot direktivet. Detta gäller också sådana personbolag där endast aktiebolag är ansvariga bolagsmän. Lagen tillåter å andra sidan att kontantprincipen tillämpas i yrkesutövares bokföring. Dessa är inte heller skyldiga att upprätta bokslut. 
När den gällande lagen stiftades ansågs det också vara motiverat att motsvarande skyldigheter att upprätta och offentliggöra bokslut som de som föreskrivs i direktiven gäller också företag som inte direkt hör till direktivens tillämpningsområde. De krav som gäller t.ex. offentliggörande av andelslags bokslut och verksamhetsberättelser stämmer sålunda överens med kraven för aktiebolag. De resultaträknings- och balansräkningsscheman för vilka bokföringsnämnden har meddelat närmare anvisningar beaktar emellertid särdragen i fråga om olika former av företag och stiftelser. 
Bestämmelserna om bokföring och förvaring av bokföringsmaterial under räkenskapsperioden – dvs. innan bokslut och verksamhetsberättelse upprättas på basis av materialet – samt om förvaring av materialet efter att bokslutet upprättats, är å andra sidan i praktiken föråldrade i och med den utveckling som skett inom IT-branschen. Exempelvis möjligheten att utnyttja s.k. molntjänster fanns inte då bestämmelserna kom till. Med beaktande av den förväntade utvecklingen finns det behov av reglering på en mera allmän nivå, dvs. reglering som innebär att allt bokföringsmaterial, oberoende av vilka tekniska lösningar man gått in för, ska förvarars omsorgsfullt på ett sådant sätt att både revisorn och myndigheterna utan oskäligt dröjsmål får tillgång till materialet. 
2
Ändringsbehov
Det finns ett uppenbart EU-relaterat behov att revidera bokföringslagstiftningen. Europaparlamentets och rådets nya direktiv 2013/34/EU av den 26 juni 2013 ersätter 1978 års redovisningsdirektiv 78/660/EEG och 1983 års koncernbokslutsdirektiv (83/349/EEG). 
2.1
Tänk småskaligt först -principen: Medlemsstaterna åläggs att minska den administrativa bördan för småföretag
EU-reformen innebär att substansen i de tidigare redovisnings- och koncernbokslutsdirektiven till största del överförs till det nya direktivet. Infallsvinkeln har emellertid ändrats från stödjande av storföretag till stödjande av små och medelstora företag, bl.a. genom minskning av den administrativa bördan. I direktivets ingress kallas denna princip ”tänk småskaligt först” (punkt 1). Medlemsstaternas möjligheter att fastställa ytterligare förpliktelser begränsas kraftigt: medlemsstaterna får kräva att små företag i de finansiella rapporterna de utarbetar, lämnar och offentliggör upplysningar som går utöver kraven i direktivet, endast under förutsättning att alla sådana uppgifter samlas in inom ramen för ett enda registreringssystem och att upplysningskravet ingår i den nationella skattelagstiftningen enbart av skatteuppbördsskäl (artikel 4.6). 
Enligt propositionen ska också gränsvärdena för små företag justeras. Då den övre gränsen för ett små företag i den gällande bokföringslagens 3 kap. 9 § 2 mom. enligt balansomslutningen är 3,65 miljoner euro, enligt omsättningen 7,3 miljoner euro och enligt antalet anställda 50 personer, är motsvarande tröskelvärden enligt det nya direktivet 4 respektive 8 miljoner euro samt 50 anställda. En medlemsstat som så önskar kan ytterligare höja de två först nämnda värdekriterierna, dock högst en och en halv gång. Av dessa kriterier måste minst ett vara uppfyllt på balansdagen (artikel 3.2). 
Eftersom direktivet till denna del är tvingande är det nödvändigt att i samband med lagreformen i Finland höja tröskelvärdena för både balansomslutningen och nettoomsättningen i överensstämmelse med direktivet. Det nya direktivet tillåter å andra sidan inte, lika lite som 1978 års direktiv, att EU-staterna i sin nationella lagstiftning överskrider direktivets tröskelvärden. 
2.2
Förkortade noter för småföretag: Inga nationella tilläggskrav
Tänk småskaligt först -principen kommer till uttryck närmast så att det nya direktivet för småföretag uppställer en endast åtta punkters förteckning över obligatoriska noter (artiklarna 16.1 a - 16.1 h). Utöver dessa får medlemsstaterna om de så önskar kräva ytterligare fem andra uppgifter som nämns särskilt (artikel 16.2), men endast av sådana skattemässiga skäl som avses ovan. 
Begränsningen av kraven på tilläggsupplysningar motiveras i direktivets ingress med kostnadseffektivitet: ”De som använder finansiella rapporter har vanligtvis ett begränsat behov av tilläggsupplysningar från små företag, och det kan vara kostsamt för små företag att sammanställda dessa tilläggsupplysningar” (punkt 23). Det nya direktivet förutsätter å andra sidan, liksom 1978 års direktiv, att också småföretag vid behov lämnar ytterligare upplysningar i noterna (artikel 4.3): ”Om tillämpningen av detta direktiv inte räcker till för att ge en rättvisande bild av företagets tillgångar, skulder, ekonomiska ställning och resultat ska alla ytterligare upplysningar som är nödvändiga för att uppfylla detta krav lämnas i noterna till de finansiella rapporterna.” 
Den nationella behörigheten förblir oförändrad i fråga om andra dokument som hör till småföretags bokslut än noterna, dvs. i fråga om resultaträkningen och balansräkningen. Varje medlemsstat får självständigt besluta om den tillåter att små företag upprättar resultaträkningar eller balansräkningar i förkortad form (artiklarna 14.1 och 14.2). Motsvarande prövningsrätt gäller också i fråga om verksamhetsberättelsen: Medlemsstaterna får genom sin egen lagstiftning undanta små företag från skyldigheten att utarbeta förvaltningsberättelser, under förutsättning att de kräver att information om eventuella förvärv av egna aktier eller andelar lämnas i noterna till den finansiella rapporten (artikel 19.3). Å andra sidan får små företag inte åläggas att i sitt bokslut lämna upplysningar som går utöver det som krävs enligt direktivet (artiklarna 4.1 och 4.5). 
2.3
Medlemsstatsoption att bevilja mikroföretag ytterligare lättnader
Det är skäl att i det nya direktivet beakta också möjligheten att erbjuda medlemsstaterna särskilda lättnader för mikroföretag som inte överskrider följande gränsvärden: balansomslutning 0,35 miljoner euro, nettoomsättning 0,70 miljoner euro och genomsnittligen 10 anställda. Endast ett av dessa gränsvärden får överskridas på balansdagen för att det bokföringsskyldiga företaget ska anses vara ett mikroföretag (artikel 3.1). 
Mikroföretagsreglerna är emellertid ”endast” en medlemsstatsoption. Till åtskillnad från förfarandet i fråga om småföretag kan Finland och övriga EU-länder sålunda självständigt besluta om de ska införa mikroföretagslättnaderna i sin helhet eller endast till vissa delar. Dessa lösningar bör baseras på förhållandena i respektive land: ”Medlemsstaterna bör beakta de egna marknadernas specifika villkor och behov när de fattar beslut om hur eller huruvida de ska inrätta en särskild ordning för mikroföretag inom ramen för detta direktiv” (punkt 14 i ingressen). 
Ett EU-land kan bl.a. undanta mikroföretag från skyldigheten att upprätta noter eller verksamhetsberättelse, under förutsättning att följande uppgifter anges under balansräkningen (eng. at the foot of the balance sheet, artiklarna 36.1 b och 36.1 c): 
- det totala beloppet för ekonomiska åtaganden, garantier eller eventuella förpliktelser som inte är upptagna i balansräkningen, och en översikt över arten och formen för varje ställd säkerhet, 
- pensionsförpliktelser och förpliktelser mot koncernföretag eller intresseföretag ska anges särskilt, 
- storleken på de förskott och krediter som har beviljats ledamöterna i förvaltningsorganen, liksom åtaganden som har ingåtts för ledamöternas räkning i form av garantier av något slag, och 
- förvärv av egna aktier. 
Enligt medlemsstatsoptionen får mikroföretag nationellt ges också rätt att upprätta och offentliggöra en förkortad balansräkning, vilket innebär att i den inte redovisas förutbetalda kostnader och upplupna intäkter och inte heller upplupna kostnader och förutbetalda intäkter (artiklar 36.1 a och 36.2 a samt bilaga III). Ett mikroföretag kan också tillåtas offentliggöra sin resultaträkning i förkortad form med en särskild redovisning av åtminstone följande poster, i förekommande fall (artikel 36.2.b): nettoomsättning, övriga intäkter, kostnader för råvaror och förnödenheter, personalkostnader, värdejusteringar samt övriga kostnader och skatter. Undantagsmöjligheterna går t.o.m. så långt att en medlemsstat kan godkänna att resultaträkningen och noterna inte offentliggörs över huvud taget, vilket innebär att balansräkningen enbart tillställs registermyndigheten som en bokslutshandling (artikel 36.1.d). 
2.4
Safe harbour -principen för mikroföretag i fråga om en rättvisande bild
Till de viktigaste lättnaderna för mikroföretag hör safe harbour -principen i förhållande till kravet på en rättvisande bild. Enligt artikel 36.4 ska årsbokslut som upprättas för mikroföretag anses ge en sådan rättvisande bild som krävs enligt artikel 4.3. Det i den sist nämnda artikelns andra stycke nämnda allmänna kravet att alla ytterligare upplysningar som är nödvändiga ska lämnas för att ge en rättvisande bild, ska inte tillämpas i mikroföretag. Detta ska uppfattas så att ett mikroföretag inte kan klandras på grund av kravet att ge en rättvisaande bild, då det i företagets bokslut har lagts fram uppgifter som är förenliga med lättnader för mikroföretag. 
Safe harbour -principen ska emellertid tillämpas endast då medlemsstaten i fråga har beslutat utnyttja direktivets mikroföretagsoption och börjat tillämpa de lättnader som avses i direktivet. 
2.5
Väsentlighet som bokslutsprincip
Alla de bokslutsprinciper som gäller företag kompletteras i det nya direktivet med begreppet väsentlighet. Enligt artikel 6.1 j behöver de krav som anges i direktivet när det gäller redovisning, värdering, utformning, upplysning och koncernredovisning inte uppfyllas ”om följderna av att uppfylla dem är oväsentliga”. Principen innebär sålunda en lättnad. Den baseras emellertid i direktivet inte på kostnaderna för att upprätta bokslutet utan väsentligheten definieras från informationsmottagarens synpunkt (artikel 2.16) så att med begreppet väsentlig avses ”beskaffenheten på information som innebär att utelämnanden av eller felaktigheter i den rimligen kan förväntas påverka de beslut som användarna fattar på grundval av företagets finansiella rapporter.” 
Eftersom betydelsen av att information utelämnas eller är felaktig ska bedömas från mottagarens synpunkt har väsentlighetsprincipen uppenbarligen, liksom för närvarande, relevans för tolkningen av begreppet ”en rättvisande bild” som förutsätts i direktivets artikel 4.3. Bedömningen av frågan om årsbokslutet ger en rättvisande bild ska utgå ifrån huruvida det faktum att viss information utelämnats eller framställts på ett felaktigt sätt eventuellt har haft betydelse för dem som använder bokslutet. Artikelns ordalydelse ”rimligen kan förväntas” (eng. reasonably - - expected) innebär att denna bedömning ska göras på ett allmänt plan utifrån antagandet att läsaren är en person som förstår sig på bokslutsinformation. 
2.6
Undantag för små koncerner i fråga om koncernbokslut och verksamhetsberättelse
Från bolagsrättslig synpunkt är det skäl att beakta artikel 23.1 enligt vilken små koncerner ”ska undantas från skyldigheten att upprätta en koncernredovisning och en förvaltningsberättelse för koncern - -” (eng. shall be exempted). I direktivets ingress motiveras detta så att ”- - användarna av små företags finansiella rapporter inte har avancerade informationsbehov och det kan vara kostsamt att upprätta en koncernredovisning utöver årsboksluten för moderföretaget och dotterföretagen” (punkt 33). Bestämmelsen är förpliktande för medlemsstaterna då den skiljer sig från 1983 års koncernbokslutsdirektiv som hänförde motsvarande lättnadsmöjlighet till den nationella lagstiftarens prövning: ”- - får en medlemsstat föreskriva undantag - -” (artikel 6.1). 
Enligt det nya redovisningsdirektivet gäller för små koncerner kriterierna att balansomslutningen under räkenskapsperioden ska vara 4 miljoner euro, nettoomsättningen 8 miljoner euro och antalet anställda i genomsnitt 50. En medlemsstat får emellertid om den så önskar höja tröskelvärdena högst en och en halv gång (artikel 3.5). Den gällande bokföringslagens i euro fastställda gränser ligger på en lägre nivå än direktivets. Det undantag för små koncerner som föreskrivs i bokföringslagens 6 kap. 1 § 3 mom. gäller den situationen att såväl under den avslutade räkenskapsperioden som under den omedelbart föregående räkenskapsperioden högst en av de i 3 kap. 9 § 2 mom. fastställda gränserna har överskridits, räknade sammanlagt för både moderföretag och dess dotterföretag, dvs. balansomslutningen 3,65 miljoner euro, omsättningen eller motsvarande avkastning 7,3 miljoner euro och det genomsnittliga antalet anställda 50 personer. De två först nämnda tröskelvärdena i euro måste i samband med att det nya direktivet sätts i kraft höjas åtminstone till de nedre gränser som anges i direktivets artikel 3.5. Ordalydelsen i koncernundantaget är tvingande, vilket innebär att ingen EU-stat längre kan hålla fast vid eventuellt lägre tröskelvärden. 
2.7
Särskilda förpliktelser för företag med verksamhet inom utvinningsindustrin och avverkning av primärskog
Enligt direktivets artikel 42.1 ska medlemsstaterna kräva att stora företag och alla företag av allmänt intresse som är verksamma inom utvinningsindustrin eller avverkning av primärskog upprättar och offentliggör en årlig rapport om betalningar som gjorts till offentliga myndigheter. Förpliktelsen gäller affärsverksamhet både inom EU och i tredjeländer. I rapporten behöver man inte ta hänsyn till en betalning om beloppet understiger 0,1 miljoner euro under ett räkenskapsår (artikel 43.1). I de fall betalningar görs in natura ska de rapporteras i värde och, i förekommande fall, i volym (artikel 43.3). 
Rapportens utformning är inte närmare bestämd, vilket innebär att medlemsstaterna enligt prövning får hänföra rapporten till bokslutshandlingarna eller upprätta och offentliggöra den som ett självständigt dokument. I båda alternativen ska den i och för sig offentliggöras på samma sätt (artiklarna 30.1 och 45.1). Direktivet förutsätter likaså att företagsledningen ansvarar för att rapporten om betalningar till offentliga myndigheter utarbetas i enlighet med kraven i detta direktiv (45.2). Detsamma gäller enligt direktivet i fråga om bokslutshandlingarna (artikel 33.1). 
Begreppet ”stora företag” som avses i fråga om förpliktelsen definieras i artikel 3.4 så att åtminstone två av följande tre kriterier ska vara uppfyllda: balansomslutning 20 miljoner euro, nettoomsättning 40 miljoner euro och genomsnittligt antal anställda under räkenskapsåret 250. Med ”företag av allmänt intresse” avses alltid börsbolag vilkas värdepapper är föremål för handel på en reglerad marknad och likaså kreditinstitut och försäkringsföretag. Dessutom kan medlemsstaterna utse också andra typer av företag till företag av allmänt intresse, t.ex. med beaktande av affärsverksamhetens karaktär, företagets storlek eller antalet anställda (artikel 2.1). 
2.8
Bokföringsmetoder, material och förvaring
Bestämmelserna i bokföringslagens andra kapitel om bokföringsmetoder, material och förvaring är huvudsakligen oförändrade sedan lagen trädde i kraft 1997. Datatekniken har emellertid under denna tid utvecklats så mycket att det finns ett uppenbart behov av att modernisera bestämmelserna. 
Den terminologi som avses i kapitlet är i många avseenden föråldrad och motsvarar inte längre praxis inom branschen (t.ex. ”grundbokföring” och ”maskinläsbara datamedier”). Bestämmelserna om förvaring av bokföringsmaterial, geografiska begränsningar och undantagsförfaranden uppfyller inte längre sin funktion när det gäller att säkerställa granskning och revision. De ministeriebeslut (1998/47 och 1998/49) som utfärdats med stöd av lagens bemyndigande om hantering och förvaring av material, är i stor utsträckning föråldrade. 
Det finns ett uppenbart behov att uppdatera lagen så att den dels tillåter användning av modern teknologi i full utsträckning, automatisering av bokföringen samt elektronisk dataöverföring mellan de bokföringsskyldiga och myndigheterna, och dels säkerställer möjligheterna att granska och revidera materialet under alla förhållanden, så att det finns förutsättningar att effektivt genomföra revisionen och bekämpa grå ekonomi. Det är skäl att göra detta på ett sådant sätt att de bokföringsskyldiga inte orsakas onödiga extra kostnader utan snarare får en lättare administrativa börda. 
3
Målsättning och de viktigaste förslagen
3.1
Lagstiftningens struktur
Det föreslås att den gällande bokföringslagen uppdateras i överensstämmelse med det nya direktivets krav och likaså att bokföringsmetoderna utvecklas i tekniskt hänseende. 
De föreslagna ändringarna av bokföringsbestämmelserna genomförs tekniskt genom ändringar i den gällande lagen. Trots att det blir fråga om ett relativt stort antal justeringar är denna lösning mera ändamålsenlig än alternativet att upphäva den gällande lagen och stifta en helt ny lag. Förfarandet motiveras närmare nedan. 
Bokföringslagens bestämmelser har ett omfattande användningsområde i samhället. Målet är att undvika onödiga administrativa kostnader som förändringar åsamkar företagen och samhället. Trots att det är fråga om ett relativt stort antal enskilda ändringar är det ändamålsenligt att utgå ifrån att de i praktiken mest tillämpade bestämmelserna kvarstår i kända lagrum och att den nuvarande strukturen bibehålls i detta avseende. Denna lösning innebär att de tidsrelaterade kostnaderna för genomförandet av direktivet hålls på en betydligt lägre nivå, eftersom man inte söka efter nya lagrum för grundläggande bestämmelser som det ofta hänvisas till. 
Eftersom lagens struktur förblir oförändrad när det gäller både kapitlens och paragrafernas ordningsföljd innebär detta att man direkt med hjälp av propositionens parallelltext kan se de ändringar som föreslås i en bestämmelse, eftersom paragrafnumreringen inte ändras. Också i kommentarerna till lagförslaget har den föreslagna grundläggande lösningen ansetts vara bra – det föreslås inte att en ny lag ska stiftas. Det valda förfarandet motsvarar t.ex. det som man gått in för vid regleringen av näringsbeskattningen. Bokföringslagen är också en lag som det hänvisas till i många andra lagar, framför allt i annan lagstiftning om företag och stiftelser. Genom den lösning som nu valts kan man också undvika onödiga ändringar i andra lagar. 
Lagstiftningens struktur blir avsevärt mycket bättre då det enligt förslaget ska utfärdas en särskild förordning om småföretag och mikroföretag, där det föreskrivs om alla krav som gäller dessas bokslut. I fråga om sådana småföretag och mikroföretag som avses i direktivet gäller bestämmelserna om bokslutets innehåll. Bestämmelserna om resultaträkningens och balansräkningens uppställning och noter avskiljs sålunda till en egen förordning. Den nya förordningen sammanfattar alla de omständigheter som ska framgå av sådana företags bokslut. Förordningen kan således användas som en ”checklista” när det gäller informationskraven då bokslut upprättas för små- eller mikroföretag. Företagaren får genom förordningen fullständig information om vad som ska framgå av bokslutet. 
Av den nya förordningen framgår också EU-kravet att medlemsstaterna inte nationellt får uppställa andra förpliktelser än de som direktivet tillåter när det gäller små- och mikroföretags bokslutsinformation. I Finland kommer förpliktelserna att framgå av förordningen och på motsvarande sätt inskränks den gällande bokföringsförordningens tillämpningsområde till att omfatta andra bokföringsskyldiga än små- och mikroföretag. Denna precisering gör det lättare att förstå bokslutskraven för små- och mikroföretag, vilket är förenligt med tänk småskaligt först principen som enligt ovanstående avsnitt 2.1 är en av direktivets grundläggande principer. 
Bokföringslagstiftningens struktur förtydligas också så att de gällande ministerieförordningar som nämns ovan i avsnitt 1.1 föreslås bli upphävda. En del av bestämmelserna överförs till lagen. Också denna ändring är ägnad att göra lagstiftningen mer överskådlig. 
Specialbestämmelserna om storföretag med verksamhet inom utvinningsindustrin och avverkning av primärskogar har sammanställts i en separat lag. Trots att lagen baseras på det nya bokslutsdirektivet är bestämmelserna av en klart annan karaktär än de bokslutsbestämmelser som gäller bokföringsskyldigas ekonomiska ställning och resultat. Också i ett antal andra EU-stater planerar man att stifta nationella speciallagar, åtminstone i Storbritannien och Sverige. Den offentliga utfrågning som ordnades av arbetsgruppen som beredde genomförandet av direktivet visade på ett enhälligt stöd för alternativet att ta in bestämmelserna i en särskild lag, i stället för ett på lägre hierarkisk nivå utfärdat ministeriebeslut med stöd av ett bemyndigande i bokföringslagen. 
3.2
Lättnader för småföretag
Upprättandet av bokslut för småföretag underlättas genom att undantag av det slag som får göras enligt direktivet tas i bruk i så stor utsträckning som möjligt. De gränsvärden som gäller för småföretag har sålunda höjts till de övre gränser som anges i direktivet. 
Vidare utnyttjas direktivets möjligheter att bevilja särskilda lättnader för mikroföretag. Sålunda kommer den allmänna bestämmelsen i lagens 3 kap. 2 § om ytterligare upplysningar, då det behövs för att ge en rättvisande bild, inte att tillämpas i mikroföretag. Dessa specialbestämmelser anger på ett uttömmande sätt vilka krav som ställs på mikroföretags bokslutsinformation. 
De undantagsmöjligheter som beskrivs ovan i avsnitten 2.1 - 2.4 har å andra sidan under beredningen vägts mot det egentliga syftet med bokslutsbestämmelserna, dvs. kravet på en rättvisande bild. För att målet ska kunna nås uppställs i den nya förordningen för små- och mikroföretag skyldighet att informera om eventuella arrangemang utanför balansräkningen och likaså om transaktioner med intressenter, trots att direktivet ger medlemsstaterna möjlighet att undanta sådana företag från dessa informationskrav. 
Som motvikt till de ovan nämnda kraven ingår i den nya små- och mikroföretagsförordningen flera lättnader som är tillåtna enligt direktivet och inte äventyrar målsättningen att ge en rättvisande bild. En omständighet som i praktiken underlättar upprättandet av bokslut är bl.a. att små- och mikroföretag – till åtskillnad från större bokföringsskyldiga – inte behöver specificera ändringar i bestående aktiva under räkenskapsperioden. Den särskilda förordningen innehåller också en presumtionsbestämmelse om bokslutsprinciperna enligt vilken små- och mikroföretag vid behov i noterna ska specificera sina värderings- och periodiseringsprinciper endast om dessa avviker från de som vanligen iakttas. 
Målet att ge en rättvisande bild är orsaken också till att man inte slopat skyldigheten att offentliggöra resultaträkningen, trots att det nya direktivet skulle tillåta ett sådant undantag i fråga om små- och mikroföretag. För sådana företag tillåts å andra sidan också enligt de nya bestämmelserna att resultaträkningen och balansräkningen offentliggörs i förkortad form. 
Att resultaträkningen och bokslutet ska offentliggöras kan också förstås som en motvikt till ägarnas begränsade ansvar för företagsrelaterade skulder, bl.a. när det är fråga om bokföringsskyldiga med verksamhet i aktiebolagsform. Enligt den gällande lagen behöver yrkesutövare å andra sidan inte upprätta och offentliggöra bokslut, eftersom de ansvarar för företagsverksamhetens åtaganden med hela sin egendom. Denna lättnad utsträcks enligt bokföringslagens nya bestämmelse också till affärsidkare. 
Finansieringssystemet bygger på att bokslutsinformationen är offentlig. Offentligheten innebär att finansinstituten får heltäckande information om företagens lönsamhet i olika branscher. Detta hjälper dem att prissätta den finansiering som de ordnar. Ju bättre kunskaper finansinstituten har desto mindre riskpremier behöver de beakta i sina avkastningskrav. Om ett finansinstitut saknar tillräcklig information om den allmänna lönsamhetsnivån är detta ägnat att höja priset på lånefinansiering, trots att företaget självt ställer sina egna bokslutsuppgifter till institutets förfogande som grund för lånebeslut. 
Bokslutsuppgifternas offentlighet kan å andra sidan också ha betydelse från konkurrenssynpunkt. Om en bokföringsskyldig bedriver en viss typ av verksamhet kan bokslutet berätta mer om delfaktorerna i resultatet när det gäller en viss bransch än bokslutet för ett konglomerat. Bokslutets offentlighet gör det också möjligt att utnyttja konkurrenters bokslutsuppgifter då t.ex. ett konglomerat planerar sin prissättning och andra konkurrensåtgärder. En förutsättning för att resultaträkningens och övriga bokslutshandlingars offentlighet ska kunna begränsas är sålunda också att det görs en helhetsbedömning av de normer som finansieringen baseras på, exempelvis insolvenslagstiftningen, samt olika konkurrensaspekter i förhållande till informationsskyldigheten. I samband med detta lagberedningsprojekt har emellertid en så omfattande granskning inte varit aktuell. Enligt lagen är huvudregeln i överensstämmelse med direktivet fortfarande att bokslutet ska upprättas enligt prestationsprincipen. Detta betyder att transaktioner ska bokföras på den räkenskapsperiod under vilken den bokföringsskyldiga har levererat sin produkt till kunden. Prestationsprincipen gäller utan undantag företag som hör till tillämpningsområdet för direktivet, dvs. aktiebolag och personbolag där endast aktiebolag är ansvariga bolagsmän. 
Det är inte heller motiverat att nationellt jämfört med aktiebolag särbehandla andra former av juridiska personer som bedriver företagsverksamhet. Sålunda ska prestationsprincipen liksom enligt den gällande lagen fortfarande tillämpas i andelslag och personbolag. 
3.3
Särskilda lättnader för fysiska personer samt för mikroföreningar och -stiftelser
Trots att prestationsprincipen i EU:s bokföringslagstiftning hör till de centrala kännetecknen på aktiebolag, finns det inga hinder för att kontantprincipen, som redan nu enligt den gällande lagen gäller för yrkesutövare, utsträcks också till affärsidkare. Liksom när det gäller yrkesutövare separeras en affärsidkares personliga ekonomi inte från de åtaganden som härrör från förvärvsverksamheten. Trots att förvärvsverksamheten bokförs separat och trots att för den eventuellt har registrerats en särskild firma, uppnår den i rättsligt hänseende inte en status som kan jämföras med ett separat bolag. En fysisk person som bedriver yrkes- eller affärsverksamhet svarar för därmed sammanhängande åtaganden med all sin egendom, också med sin personliga egendom. I och med detta ansvar kan ett bokslut som upprättas för en rörelse eller ett yrke inte på samma sätt beskriva en med ett självständigt separat bolag jämförbar ekonomisk helhets förmögenhetsställning och resultat, vilket innebär att det inte är motiverat att ålägga en privatperson skyldighet att upprätta bokslut då dennas verksamhet volymmässigt underskrider mikrogränsen. I den gällande lagen har en sådan skyldighet inte uppställts för yrkesutövare. 
De ovan beskrivna omständigheter som gäller rörelseidkare motiverar å andra sidan att man i bokföringslagen upphäver den nationella undantagsbestämmelse som generellt tillåter att kontantprincipen tillämpas i lantbrukares bokslut, oberoende av om verksamheten bedrivs i företagsform eller inte. Eftersom aktiebolag som bedriver lantbruk hör till direktivets tillämpningsområde, har undantaget klart stått i strid med direktivet. 
Bokslut som upprättas enligt kontantprincipen blir ett möjligt alternativ också för stiftelser och föreningar som storleksmässigt hör till mikroklassen. Till åtskillnad från rörelseidkande företag är föreningars och stiftelsers förvärvsverksamhet efterställd i förhållande till deras egentliga verksamhet. Med hänsyn till mikroföreningars och -stiftelsers bokföringskunskaper och resurser är det sålunda ändamålsenligt att tillåta att de upprättar tekniskt sett enkla bokslut enligt kontantprincipen. 
Enligt kontantprincipen är det – liksom vid bokföring enligt prestationsprincipen – inte relevant när en produktionsfaktor tas emot, utan när den betalas. Detta innebär att produktionsfaktorer som köpts på skuld inte ska bokföras förrän de betalts och att sådana skulder inte ska tas upp i huvudbokföringen. Motsvarande regel gäller försäljning på kredit och därmed sammanhängande fordringar. På denna grund förutsätts det att mikroföreningar och -stiftelser som upprättar bokslut enligt kontantprincipen i noterna ska uppge sådana leverantörsskulder och försäljningsfordringar som inte antecknats i balansräkningen, om de är väsentliga. Av samma orsak gäller kravet på anteckningar i noterna också ändringar i omsättningstillgångarna och i bestående aktiva, liksom även räntor på främmande kapital och semesterlönereserveringar enligt prestationsprincipen. 
3.4
Väsentlighetsprincipen
I den gällande lagen föreskrivs inte om väsentlighetsprincipen. Denna princip är emellertid en av de centrala principerna för finländsk bokföringspraxis och till den hänvisas upprepade gånger också i bokföringsnämndens ställningstaganden. Väsentlighetsprincipen ingår inte i det nya direktivets optioner för medlemsstaterna, vilket innebär att lagen måste kompletteras i detta avseende. Principens betydelse understryks genom att den får komplettera skyldigheten att ge en rättvisande bild av verksamheten. När bokslutet upprättas är det sålunda skäl att lägga särskild vikt vid omständigheter som har betydelse för en rättvisande bild. Frågan om en viss uppgift som utelämnats eller framställts på ett felaktigt sätt har haft betydelse måste bedömas av en person som förstår sig på bokslutsinformation. 
Väsentlighetsprincipen utgör inte ett undantag från regeln att bokföringen ska vara heltäckande. I stycke 17 i direktivets ingress understryks det att väsentlighetsprincipen inte bör ”påverka eventuella nationella skyldigheter att upprätta fullständiga förteckningar över affärstransaktioner och ekonomisk ställning”. Alla affärstransaktioner som berör den bokföringsskyldiga samt övriga omständigheter som är av intresse för resultatet och den ekonomiska ställningen ska sålunda utan undantag anges i bokföringen, liksom enligt gällande lag. 
Att väsentlighet ingår i bokslutsprinciperna torde inte heller ha någon betydelse för god bokföringssed. Redan under den nuvarande lagens giltighetstid har bokföringsnämnden i sina ställningstaganden ansett att det är fråga om en väsentlig betydelse då utelämnande eller felaktig angivelse av poster för sig eller tillsammans kunde påverka ekonomiska beslut som användarna fattar i fråga om storleken och karaktären av en viss post i en given situation separat värderad (den allmänna anvisningen 16.10.2007 om avskrivningar enligt plan, punkt 11.1). 
Väsentlighetsprincipen ställs också i proportion till det bokföringsskyldiga företagets storlek samt omfattningen och arten av affärsverksamheten. Sålunda kan man t.ex. inte generellt ange en viss gräns i euro under vilken mindre värdefulla transaktioner alltid skulle vara oväsentliga för alla bokföringsskyldiga. Också detta stämmer överens med den nuvarande tolkningen av begreppet god bokföringssed. Bokföringsnämnden har bl.a. ansett att frågan om vilket belopp på en tillgång som hör till bestående aktiva som ska anses vara av ringa värde måste bedömas på basen av omfattningen av den bokföringsskyldiges verksamhet och den totala volymen bestående aktiva (den allmänna anvisningen 16.10.2007 om avskrivningar enligt plan, punkt 2.7 samt utlåtande 1838/2009). 
Väsentlighetsprincipen är betydelsefull i synnerhet när det gäller periodisering av inkomster och utgifter samt i bokföringsmässiga avgöranden som gäller värdering av tillgångar. Bokföringsnämnden har t.ex. konstaterat att bokföringen av bestående aktiva, som gäller maskiner, inventarier och andra liknande lösa tillgångar, med beaktande av väsentlighetsprincipen även kan uppläggas per tillgångsgrupp, om sammanslagningen endast har mindre inverkan på planavskrivningarnas storlek, trots att separat värdering av tillgångar hör till de bokslutsprinciper som föreskrivs i bokföringslagen (den allmänna anvisningen 16.10.2007 om avskrivningar enligt plan, punkterna 9 och 11.4.1). 
I praktiken har också skattemyndighetens ställningstaganden betydelse för tolkningen av väsentlighetsprincipen och dess förhållande till informationsproduktion ur ett kostnads-nytta – perspektiv. Detta är fallet t.ex. då en bokföringsskyldig överväger att i sin helhet bokföra utgiften för en ringa inventarieanskaffning som en kostnad för räkenskapsperioden, trots att inventarien kommer att ge avkastning också i framtiden. 
Enligt 33 § i lagen om beskattning av inkomst av näringsverksamhet (360/1968) kan anskaffningsutgiften för förslitning underkastade lösa anläggningstillgångar avskrivas under det skatteår då tillgångarna har tagits i bruk, om den sannolika ekonomiska brukstiden är högst tre år eller om anskaffningsutgiften är högst 850 euro. Om anskaffningsutgiften har varit så liten att den i överensstämmelse med nämnda lagrum får avskrivas i beskattningen för respektive räkenskapsperiod, är det inte ändamålsenligt att tolka väsentlighetsprincipen på ett strängare sätt i bokföringen och när bokslutet upprättas på basis av den, på så sätt att anskaffningsutgiften måste aktiveras till den del som den beräknas ge avkastning i framtiden. Tillämpningen av väsentlighetsprincipen på detta sätt stämmer också överens med direktivets princip tänk småskaligt först som innebär att orimliga administrativa bördor ska undvikas för småföretag (ingressen, punkt 10). 
3.5
Bokföringsmetoder, material och förvaring
Det föreslås att de i lagen använda begreppen som avser bokföringsmetoderna ska harmoniseras och uppdateras så att de är teknologineutrala och motsvarar vedertaget språkbruk och praxis inom branschen.  
Vidare föreslås det att ministerieförordningarnas detaljerade reglering av teknologiska lösningar ska frångås. De bestämmelser som behövs om saken överförs till lagen så uppdaterade att de gäller oberoende av teknologiska lösningar. På detta sätt säkerställs det att lagen inte släpar efter i utvecklingen och inte heller utgör ett onödigt eller ofrivilligt hinder för framtida utveckling. 
Ett nytt krav är att de beräkningar och dokument som ligger till grund för bokslutsnoterna ska hanteras och förvaras som verifikationer till noterna. På detta sätt säkerställs granskningen av boksluten och en täckande verifieringskedja också i fråga om noterna. Detta har visat sig vara nödvändigt då noterna fått en allt större betydelse för att säkerställa en rättvisande bild. 
Fastställandet av verifieringskedjan förtydligas och de krav som ställs på den utsträcks till att omfatta också skattedeklarationer och andra myndighetsrapporter som regelbundet ska ges på basis av bokföringen, exempelvis periodiska arbetsgivardeklarationer. De tidigare, tekniskt föråldrade detaljerade bestämmelserna om det tekniska genomförandet av bokföringssystemet ersätts till stor del med tydligare och noggrannare krav på verifieringskedjan. Genom att utsträcka kraven på verifieringskedjan från bokslutet till att gälla också periodiska moms- och arbetsgivarsdeklarationer samt andra motsvarande meddelanden till myndigheterna säkerställs det att granskningsmöjligheten bibehålls också i dessa avseenden. På detta sätt undviks också situationer där ändringar av tidigare periodiska redovisningar kan försvåra granskningsmöjligheterna och uppföljningen av verifieringskedjan under perioden. 
Kravet att balansboken ska upprättas i pappersform slopas. Däremot föreslås en förteckning över redovisningar och material som omfattas av motsvarande ansvar för ordnande av tillförlitlig förvaring som när det gäller upprättandet av själva bokslutet. På detta sätt säkerställs det att bokföringen kan kontrolleras och granskas också efter perioden. 
I propositionen föreslås det att de detaljerade krav slopas som gäller den tekniska formen för förvaring och hantering av bokföringsmaterial och att även de geografiska kraven slopas. Däremot föreslås det att alla redovisningar och allt material i Finland utan obefogat dröjsmål måste kunna granskas på klarspråk. Verifieringskedjan måste kunna fastställas under alla förhållanden. De bokföringsskyldigas ansvar för omsorgsfull behandling och förvaring av bokföringsböcker betonas med hot om påföljder. Detta är nödvändigt för att lagen inte ska utgöra ett hinder för effektiv automatisk databehandling och elektronisk dataöverföring. Samtidigt förbättras emellertid möjligheterna att granska och kontrollera bokföringsmaterialet, vilket för sin del också främjar bekämpandet av ekonomisk brottslighet. 
3.6
Öppna bokföringstekniska lösningar
För att den administrativa bördan ska kunna minskas är det viktigt att inte ställa upp andra regler och bestämmelser än sådana som är nödvändiga för att förverkliga bokföringslagens faktiska syften. Bokföringslagens två faktiska syften är för det första att säkerställa att affärstransaktioner på ett tillförlitligt sätt redovisas i bokföringen och för det andra att det på basis av bokföringen i enlighet med direktivet upprättas ett bokslut som ger en rättvisande bild av verksamheten. Vår bokföringslagstiftning har inte utsträckts till att omfatta bokföringsskyldigas interna redovisning eller styrningssystem och den har inte heller reglerat innehållet i eller utformningen av affärs- och handelstransaktioner. Finland har inga traditioner när det gäller obligatorisk användning av en gemensam kontoplan. 
Under beredningen av lagen har väckts tanken att alla bokföringsskyldiga ska åläggas att använda vissa kontoplaner eller filformat i sina ekonomiförvaltningssystem samt för dataöverföring internt och med myndigheter. Man har diskuterat möjligheterna att använda XBRL-baserade filformat som utvecklats för bokslut samt XML-standardformat för huvudboken. 
Bokföringslagen gäller i tillämpliga delar alla bokföringsskyldiga, från enskilda näringsidkare och enbostads bostadsaktiebolag till multinationella storföretag, såväl bolag som har sitt huvudkontor i Finland som utländska företags dotterbolag som är etablerade här. Tanken att på lagnivå reglera kontoplanerna eller filformaten för alla dessa aktörer är inte genomförbar. Det är snarare motiverat att i lagen eliminera alla hinder för att den datatekniska utvecklingen ska kunna utnyttjas fullt ut. Det finns sålunda inget behov att i bokföringslagen ta ställning till frågan om vilka tekniska lösningar och detaljerade förfaranden som ska användas eller tillåtas nu och i framtiden. Lagens nya bestämmelser om bokföringsmetoder och -material reglerar på en teknologineutral nivå de minimikrav som bokföringssystemen ska uppfylla för att säkerställa granskningsmöjligheterna och skapa fungerande förutsättningar för bekämpning av grå ekonomi. 
Bokföringssystemens teknologiska lösningar och detaljer, exempelvis filformaten för bokföringsmaterial och bokslut, datatrafiken mellan bokföringsskyldiga samt mellan dem och myndigheterna, är inte omständigheter som ska regleras i bokföringslagen. Under beredningen har det emellertid konstaterats att en flexibel automatisering av bokföringen kunde främjas och den administrativa bördan minskas genom ett antal relativt självklara åtgärder i myndigheternas system och praxis. Flera åtgärder förbereds redan inom ramen för en nationell projektering av databuss-kabelnät och andra utvecklingsplaner i anslutning till integreringen av myndigheternas datasystem. 
Då myndigheternas datasystem och förfaranden utvecklas är det motiverat att undvika att det ofrivilligt skapas hinder för företagens internationalisering eller för etableringar i Finland. Den finländska ekonomin är liten, både globalt och med europeisk måttstock, och synnerligen beroende av en fungerande internationell handel. En lagstiftning som innebär att nationella lösningar, exempelvis vissa filformat, blir obligatoriska kan i någon mån underlätta myndigheternas verksamhet, men kan å andra sidan avsevärt försvåra både utländska företags investeringar i Finland och inhemska företags internationaliseringTyngdpunkten bör läggas vid filformat, databehandling och framför allt förfaranden som innebär att de bokföringsskyldiga erbjuds flexibla, lätthanterliga och situationsanpassade alternativ och metoder att lämna och förvara information som lagstiftningen kräver. 
3.7
Kapitallån i balansräkningen
Enligt aktiebolagslagens (624/2006) gällande 12 kap. 2 § 4 mom. ska kapitallån i balansräkningen tas upp ”som en särskild post”. Motsvarande bestämmelse finns också i lagen om andelslag (421/2013, 12 kap. 2 § 4 mom.). Dessa lagrum ger inte någon närmare vägledning om huruvida kapitallån ska tas upp som främmande eller eget kapital bland balansräkningens aktiva. 
Enligt förarbetena till aktiebolagslagen (regeringens proposition 109/2005 s. 121): ”- - föreslås inte att kapitallån definieras som en kapitalpost i det egna kapitalet. Behandlingen av kapitallån i bokföringen är sålunda beroende av vilka bokföringsbestämmelser som tillämpas. Detta beror huvudsakligen på att kapitallån enligt IFRS-standarderna i allmänhet inte kan betraktas som eget kapital. Vid tillämpningen av bokföringslagen är utgångspunkten den att kapitallån betraktas som främmande kapital för vilket gäller de i lagen stadgade särskilda begränsningarna. Ändringen har ingen större praktisk betydelse eftersom kapitallån betraktas som eget kapital enligt bestämmelserna om förlust av kapital i lagförslagets 20 kap. 23 § 2 mom.” 
Efter att aktiebolagslagen trätt i kraft har bokföringsnämnden gett utlåtandet 1787/2006 samt den allmänna anvisningen 21.11.2006 om presentationen av resultat- och balansräkning, som innebär att kapitallån ska upptas som en skild post i balansräkningen. Också enligt EU-kommissionens tolkningsmeddelande 98/C 16/04 (punkt 16 andra meningen ”Skuldförbindelser med efterställd rätt till betalning” [eng. subordinated loans] får kapitallån inte redovisas under rubriken ”Kapitalreserver”. Kommissionen definierar kapitallån på följande sätt: ”Skuldförbindelser med efterställd rätt till betalning är lån som, i händelse av likvidation av det bolag som tagit upp lånet, återbetalas efter det att alla övriga fordringsägare har erhållit ersättning men före eventuell utdelning till aktieägare” (punkt 15). 
Den arbetsgrupp som beredde lagändringarna bedömde behandlingen av kapitallån på basis av den senaste tidens utveckling. Majoriteten i arbetsgruppen var av den åsikten att det inte fanns någon grund för att i lagen ta in en ny bestämmelse som ändrar rådande bokföringspraxis. IAS 32 -standarden kompletterades 2008 med bestämmelser om finansiella instrument som för respektive företag i en upplösningssituation är förenade med återbetalningsskyldighet eller rätt till en andel av företagets nettotillgångar. Dessa finansiella instrument ska med stöd av standarden redovisas som eget kapital. 
Arbetsgruppens majoritet var av den åsikten att kapitallån dock inte är av den karaktär som beskrivs ovan utan i första hand har karaktären av främmande kapital. För den som beviljar ett kapitallån är detta i princip en obligationsrättslig fordran, vilket innebär att låntagaren får en återbetalningsskyldighet som den inte kan påverka. Då företaget inte har någon ovillkorlig rätt att undvika betalning för att uppfylla den avtalsbaserade skyldigheten, är det fråga om en skuld. Den omständigheten att kapitallånet är efterställt i förhållande till övriga skulder är inte relevant i detta avseende. Kännetecknande för placeringar i eget kapital är å andra sidan att placeraren riskerar att förlora sin placering. Man ingår inte heller på förhand något avtal om ersättning för eget kapital. Kapitallånet kan visserligen också förenas med olika options- och andra villkor enligt aktiebolagslagen eller lagen om andelslag. Arbetsgruppens majoritet drar sålunda slutsatsen att då ett kapitallån klassificeras som främmande eller eget kapital är det nödvändigt att granska samtliga faktiska avtalsvillkor. Endast en sådan granskning ger en rättvisande bild av verksamheten enligt bokföringslagen och uppfyller den i lagen fastställda principen att innehållet går före formen. 
Arbetsgruppen var inte enig i detta avseende. Minoriteten ansåg att det hade varit motiverat att i bokföringslagen ta in en bestämmelse enligt vilken kapitallån som avses i aktiebolagslagen och lagen om andelslag uttryckligen definieras som en post i eget kapital. En sådan klassificering hade enligt minoriteten varit förenlig med aktiebolagslagens 8 kap. 2 § enligt vilken som en post under eget kapital får tas upp ”annan investering av eget kapital” för vars återbetalning får användas endast utdelningsbart fritt kapital. I balansräkningen ska posten tas upp i ”Fonden för inbetalt fritt eget kapital”. En likalydande bestämmelse om inbetalt fritt eget kapital finns också i 8 kap. 2 § i lagen om andelslag. Ett kapitallån ger inte i likhet med inbetalt fritt eget kapital beviljaren delägarstatus i aktiebolaget eller andelslaget. 
Minoriteten hänvisade också till bokföringsnämndens avgörande 1721/2003 om kännetecknen på eget kapital, där det särskilt påpekas att delägarnas ställning vid upplösning av en livränteanstalt är efterställd i förhållande till anstaltens borgenärer. Dessutom har delägarna uteslutande beslutanderätt att bestämma bl.a. om anstaltens lägre organisation samt om dess direktion och verkställande direktör. På dessa grunder ansåg nämnden att räntefonden skulle tas upp i livränteanstaltens eget kapital. Fonden intog motsvarande ståndpunkt i sitt tidigare utlåtande 457/1997 om bostadsrättsavgifter. 
Under den fortsatta beredningen har man beslutat föreslå att kapitallån får redovisas som eget kapital om lånet enligt det bokföringsskyldiga aktiebolagets eller andelslagets egen bedömning har karaktären av värdepapper i eget kapital, på samma grunder som enligt IFRS-regleringen. Förfarandet är då i fråga om företag som tillämpar bokföringslagen detsamma som för aktörer som tillämpar IFRS-normerna. 
3.8
Små- och mikroföretag undantas från kravet på koncernbokslut
Enligt den gällande aktiebolagslagens 8 kap. 9 § 2 mom. första meningen ska moderbolaget alltid upprätta ett koncernbokslut om det betalar ut medel till sina ägare som utdelning eller på något annat sådant sätt som avses i aktiebolagslagens 13 kap. Trots att en koncerns ekonomiska situation inte formellt är något kriterium för utdelning, kan den enligt lagens förarbeten ha betydelse både för ett utdelningsbeslut och för en eventuell efterhandsbedömning av beslutet (regeringens proposition 109/2005 s. 97 och 238/2009 s. 11). Motsvarande skyldighet föreskrivs för moderandelslag enligt 8 kap. 9 § 2 mom. i lagen om andelslag. 
Eftersom aktiebolagslagen är en speciallag åsidosätter dess 8 kap. 9 § 2 mom. den gällande bokföringslagens 6 kap. 1 § 3 mom., dvs. bestämmelserna om lättnader för småföretag. Såsom konstateras ovan i avsnitt 2.7 är det nya bokslutsdirektivets ordalydelse emellertid till denna del förpliktande för medlemsstaterna, vilket innebär att det i fråga om småföretag inte är möjligt att fortsättningsvis tillämpa aktiebolagslagens 8 kap. 9 § 2 mom. eftersom denna bestämmelse är strängare än direktivet. I punkt 7 i direktivets ingress konstateras uttryckligen att ”bestämmelserna i detta direktiv ska endast tillämpas i den mån de inte är oförenliga med - - gällande bestämmelse när det gäller fördelningen av ett företags kapital som fastställs i andra gällande lagstiftningsakter som antagits av en eller flera unionsinstitutioner”. Aktiebolagslagens ovan nämnda 8 kap. 9 § 2 mom. ingår dock i Finlands nationella lagstiftning som inte är direkt baserad på EU-bestämmelserna om fördelningen av kapital, varmed i första hand torde avses artikel 17 om utdelning i direktiv 2012/30/EU. 
Det nya redovisningsdirektivet är å andra sidan inte direkt förpliktande för andelslag, eftersom dessa inte hör till direktivets tillämpningsområde, till åtskillnad från aktiebolag och sådana personbolag där endast aktiebolag är ansvariga bolagsmän (artikel 1.2). I princip kunde man sålunda i Finlands lag om andelslag hålla kvar kravet på koncernbokslut som en förutsättning för småföretags utdelning av medel, trots att detta krav frångås i aktiebolagslagen. Detta är emellertid inte ändamålsenligt med tanke på olika företagsformers konkurrensförutsättningar, vilket innebär att skyldigheten att upprätta koncernbokslut sålunda upphävs också för små- och mikroandelslag. 
3.9
Tillämpning av internationella redovisningsstandarder vid redovisning av finansiella instrument, förvaltningsfastigheter och finansiella leasingavtal
Det nya redovisningsdirektivet innebär lättnader framför allt i regleringen av småföretags bokslut. Större bokföringsskyldiga företags verksamhet underlättas bl.a. genom bestämmelserna om direkt tillämpning av de internationella IFRS-redovisningsstandarder som EU antagit enligt principen om att innehållet går före formen vid värdering av värdepapper och övriga finansiella instrument samt förvaltningsfastigheter. De kan sålunda i enlighet med IFRS-standarderna redovisas till sitt verkliga värde. Detta alternativ är enligt direktivet tillåtet trots att det avviker från förfarandet som är baserat på den ursprungliga anskaffningsutgiften. Möjligheten att värdera enligt IFRS innebär en avsevärd lättnad i bokslutsarbetet, i synnerhet för börsnoterade och andra koncerner som ska upprätta IFRS-baserade koncernbokslut enligt lagens 7 a kap. Tillämpningen av IFRS-alternativet innebär att redovisningen av finansiella instrument och förvaltningsfastigheter i dotterbolag förenhetligas med de förfaranden som tillämpas på koncernbokslutet, vilket innebär att man slipper arbetskrävande åtgärder för konvertering av separata bokslut då koncernbokslutet ska upprättas. 
Det som anförs ovan gäller också finansiella leasingavtal. IFRS-standarderna innebär att maskiner eller anordningar som finansierats med sådana avtal måste tas upp i bokslutet för det företag som anskaffat dem, trots att företaget inte sakrättsligt sett har äganderätt till dem. 
4
Propositionens konsekvenser
4.1
Ekonomiska konsekvenser
4.1.1
På direktivet baserade konsekvenser
Enligt EU-kommissionen väntas direktivet minska företagens administrativa bördor, i och med att det i medlemsstaterna ställs mindre krav på den ekonomiska rapporteringen. Enligt kommissionens uppskattning kommer besparingen på EU-nivån att uppgå till ca 1,7 miljarder euro. Detta belopp fördelas så att de enhetliga reglerna för småföretag och de därmed minskade kraven sannolikt resulterar i en besparing på ca 1,5 miljarder euro medan de höjda gränserna för företagsstorleken ger en årlig besparing på ca 0,2 miljarder euro. 
I Finland blir det fråga om marginella besparingar till följd av de obligatoriska ändringar som direktivet förutsätter. De bokslutsregler som gäller småföretag kommer inte att ändras i någon större utsträckning, eftersom de lättnader som de gällande direktiven möjliggör redan i stor utsträckning redan tillämpas i Finland. 
Besparingar kommer i och med de reviderade bokslutsbestämmelserna att uppkomma för sådana företag som till följd av de högre gränsvärdena hänförs till kategorin små- och mikroföretag. Enligt uppgifter från Statistikcentralen fanns det i Finland år 2012 sammanlagt 281 254 företag. Då man räknar bort banker, försäkringsanstalter, primärproducenter och organisationer samt aktörer inom den offentliga förvaltningen och likaså företag som inte upprättar balansräkning, dvs. yrkesutövare, återstår 219 234 jämförbara företag. Tillämpning av de maximikriterier för småföretag som direktivet tillåter ger följande statistik: 
- balansomslutning högst 6 miljoner euro och omsättning 12 miljoner euro: 213 453 företag, 
- balansomslutning högst 6 miljoner och högst 50 anställda: 213 015 företag, och 
- omsättning högst 12 miljoner euro och högst 50 anställda: 215 220 företag. 
Statistiken visar att hela 97,2 - 98,2 % av företagen underskrider direktivets tröskelvärden. Om å andra sidan kriterierna för balansomslutningen och omsättningen sänks till den miniminivå som direktivet förutsätter blir statistiken följande: 
- balansomslutning högst 4 miljoner euro och omsättning 8 miljoner: 211 378 företag, 
- balansomslutning högst 4 miljoner euro och högst 50 anställda: 211 463 företag, och 
- omsättning högst 8 miljoner euro och högst 50 anställda: 214 409 företag. 
Av företagen underskrider 96,4 - 97,8 % dessa gränser. Eftersom relativt få företag placerar sig mellan direktivets högsta respektive lägsta tröskelvärden är det i våra förhållanden ändamålsenligt att höja den gällande lagens gränser för småföretag så att de stämmer överens med direktivets högsta tröskelvärden. 
Merparten av Finlands småföretag uppfyller å andra sidan också kriterierna för mikroföretag. De direktivbaserade tröskelvärdena för mikroföretag resulterar utifrån de ovan nämnda databasuppgifterna i följande statistik: 
- balansomslutning högst 0,35 miljoner euro och omsättning 0,7 miljoner euro: 167 654 företag, 
- balansomslutning högst 0,35 miljoner euro och högst 10 anställda: 171 622 företag, och 
- omsättning högst 0,7 miljoner euro och högst 10 anställda: 186 487 företag. 
Av denna statistik framgår att hela 76,5 - 85,1 % av de finländska företagen är sådana mikroföretag som avses i direktivet. 
4.1.2
Konsekvenserna av de reviderade bestämmelserna om bokföringsförfaranden
De ändringar gällande bokföringsmaterial, metoder och förvaring av material som huvudsakligen föreslås i lagens andra kapitel, kommer för bokföringslagstiftningens vidkommande att undanröja alla hinder för automatisering av bokföringen och rapporteringen samt för utnyttjande av datatekniken fullt ut. Samtidigt säkerställs myndigheternas förutsättningar att bekämpa grå ekonomi genom förtydligande av kravet att verifieringskedjan utöver bokslutet ska omfatta också skattedeklarationer och övriga rapporter till myndigheterna, samt precisering av kravet att myndigheterna och revisorerna ska ha möjlighet att i Finland granska bokföringar och bokföringsmaterial utan obefogat dröjsmål. 
Ändringarna i det andra kapitlet innebär ytterst små tilläggskostnader för de bokföringsskyldiga. För merparten av de bokföringsskyldiga, vilkas bokföringssystem uppfyller de tidigare kraven, orsakas eventuella tilläggsarbeten endast av ändringen som innebär att verifikationer till noterna ska specificeras och förvaras på samma sätt som de egentliga verifikationerna. Eftersom det nästan undantagslöst endast är fråga om att ordna redan existerande beräkningar och handlingar i egna mappar – fysiskt eller logiskt – och eftersom verifikationerna till noterna är få till antalet i förhållande till de egentliga verifikationerna, blir det också fråga om mycket små arbetsinsatser och kostnader. 
Den långt gående automatisering av bokföringen och med tillhörande dataöverföringar som ändringarna öppnar för kommer att generera betydande synergieffekter och kostnadsbesparingar också i ett nationalekonomiskt perspektiv. Det skulle emellertid inte vara ändamålsenligt att i detta sammanhang bedöma konsekvenserna i euro. Lagändringarna kommer inte att få några konsekvenser omedelbart utan först då datasystemen och praxis, såväl i fråga om de bokföringsskyldiga som myndigheterna, utvecklas med utnyttjande av de möjligheter som lagändringarna öppnar. Detta kommer att ta flera år i anspråk och utgöra en del av en större och mycket komplex helhet, dvs. digitaliseringen av samhället inklusive projektering av databuss-kabelnät. Det är sålunda inte möjligt att utifrån denna enskilda lagändring bedöma konsekvenserna i euro. 
En vidareutveckling av bestämmelserna om precisering och utvidgning av de krav som ställs på verifieringskedjan och likaså av bestämmelserna om förvaring av material bedöms inte medföra direkta ändringsbehov när det gäller sådana bokföringssystem som uppfyller kraven enligt den gällande lagen. Sålunda kommer de bokföringsskyldiga inte heller att åsamkas några direkta extra kostnader. Vidareutvecklingen av systemen leder eventuellt till betydande synergieffekter och kostnadsbesparingar. Samtidigt ges myndigheterna och revisorerna bättre möjligheter att i olika situationer och i realtid flexibelt få tillgång till material, vilket också leder till att myndigheterna får bättre verksamhetsförutsättningar. Det är inte heller i detta sammanhang möjligt eller önskvärt att bedöma konsekvenserna i euro, i synnerhet med beaktande av att många tidigare konsekvensbedömningar i anslutning till bekämpning av grå ekonomi med fog har kritiserats. Konsekvenserna är emellertid klart positiva, både från myndigheternas och de bokföringsskyldigas synpunkt. 
4.1.3
Bekämpning av ekonomisk brottslighet
De nya procedurbestämmelserna – exempelvis om skyldigheten att förvara bokföringsmaterial så att det eventuellt kan granskas av myndigheter och revisorer utan obefogat dröjsmål och oberoende av förvaringssättet – främjar för sin del också bekämpningen av ekonomisk brottslighet. Justeringen av de tekniska bestämmelserna betonar också företagarens ansvar för förvaring av det egna bokföringsmaterialet. Hotet om påföljder för förvaringsrelaterade försummelser utsträcks sålunda till att omfatta bokföringsmaterialet i dess helhet. 
Projektet för att möjliggöra mottagning av elektroniska bokslutsdata (XBRL) har inletts och målet är att systemet ska tas i bruk 2016. Den föreslagna uppdateringen av bokföringslagstiftningens tekniska bestämmelser så att de motsvarar dagens teknologi är ägnad att främja också genomförandet av XBRL-projektet. De bokföringsrättsliga bestämmelserna har emellertid en begränsad allmän betydelse för bekämpningen av ekonomisk brottslighet. De som begår sådana brott sätter sig vanligen över lagen. De kan underlåta att över huvud taget upprätta någon bokföring. Professionella aktörer använder sig bl.a. av företag med kort livscykel. Sådana förfaranden kan inte förebyggas genom ändringar i bokföringsbestämmelserna – de måste bekämpas med andra metoder. 
4.2
Konsekvenser för statsekonomin och myndigheterna
Förslagen bedöms inte få några betydande konsekvenser för statsekonomin. Patent- och registerstyrelsen åsamkas emellertid kostnader för att ordna registreringen av årsrapporter om utvinningsindustrin och avverkning av naturskogar. 
5
Beredningen av propositionen
5.1
Beredningsskeden och -material
Arbets- och näringsministeriet tillsatte den 7 augusti 2013 en arbetsgrupp för utredning av behoven av ändringar i bokföringslagen och annan sektorlagstiftning i anslutning till den, med beaktande framför allt av den senaste tidens utveckling av redovisningsnormerna inom EU. Uppdraget bestod huvudsakligen i att lägga fram ett förslag till genomförande av det nya redovisningsdirektivet. I detta arbete skulle emellertid beaktas målsättningen att förenkla bokförings- och bokslutsförfarandena. Till arbetsgruppens uppdrag hörde dessutom att utreda och föreslå andra åtgärder för att rationalisera bokföringsbestämmelserna. Arbetsgruppen överlämnade sitt betänkande den 14 oktober 2014. 
5.2
Yttranden
Arbets- och näringsministeriet sände i oktober 2014 arbetsgruppens betänkanden på en omfattande remiss. Då tidsfristen gick ut i januari 2015 hade 28 yttranden kommit in till ministeriet. Yttrandena lades i mars 2015 ut på ministeriets webbsidor. 
Arbetsgruppens grundläggande riktlinjer, dvs. syftet att minska den administrativa bördan för framför allt de minsta bokföringsskyldiga företagen, ansågs allmänt vara en ändamålsenlig utgångspunkt. Det ansågs att förslagen ökade företagens valfrihet då de innebar nya alternativ för upprättande av bokföring och bokslut. 
Ändringsförslagen som gällde fysiska personers bokföringsskyldighet ansågs vara lyckade då de ledde till en minsking av den administrativa bördan. Med tanke på situationer då en yrkesutövares eller affärsidkares verksamhet är så omfattande att den överskrider t.ex. mikrogränserna föreslog arbetsgruppen att alternativet med obligatoriskt upprättande av bokslut tas till övervägande. 
Förslaget att en separat reglering av mikroföretag ska erbjudas de bokföringsskyldiga som ett alternativ fick ett omfattande understöd. Man motsatte sig inte heller förslaget att räntegränserna för mikroföretag justeras till en nivå som stämmer överens med direktivet. Aktörer inom finansieringsbranschen ansåg emellertid att mikroföretag ska lämna mera omfattande balansräkningsdata än vad som föreslås i betänkandet. Man ifrågasatte också bl.a. förslaget att företagen ska ges möjlighet att ur resultaträkningen utelämna uppgifter om omsättningen. Till denna del föreslogs i betänkandet emellertid ingen ändring i det nuvarande rättsläget, då också den gällande lagen tillåter att sådan information utelämnas i ett s.k. förkortat resultaträkningsschema. 
Förslaget att göra metodbestämmelserna i bokföringslagen mera flexibla välkomnades allmänt. I yttrandena föreslogs emellertid vissa preciseringar i bestämmelserna om införande och ändring av bokföringsanteckningar. 
Man var oenig om behandlingen av kapitallån i bokslutet. Å enda sidan föreslog man att kapitallån ska hänföras till det egna kapitalet som en separat post men å andra sidan framfördes också den motsatta åsikten, dvs. att kapitallån alltid ska betraktas som främmande kapital. 
I vissa yttranden ansågs det också att de föreslagna lättnaderna var otillräckliga och att längre gående reformer bör införas, exempelvis så att också nanoföretag i aktiebolagsform ges möjlighet att upprätta bokslut enligt kontantprincipen. Vidare föreslogs det att bokslutsinformationens offentlighet ska begränsas jämfört med betänkandets förslag, närmast enligt en modell som motsvarar nuläget. 
I yttrandena understöddes utan undantag förslaget att en separat lag ska stiftas om offentlighet för avgifter som företag inom utvinningsindustrin och avverkning av naturskogar betalar till olika länders myndigheter. 
Efter remissomgången har förslaget under våren och sommaren 2015 beretts vid arbets- och näringsministeriet. Yttrandena har beaktats under den fortsatta beredningen. Ändringar har gjorts bl.a. i fråga om kraven på bokföringsskyldiga privatpersoners bokslut, procedurbestämmelserna om ändring av bokföringsanteckningar, balansräkningsscheman för mikroföretag, definitionen för företag av allmänt intresse (PIE-definitionen) och redovisning av kapitallån. Dessutom har tekniska ändringar gjorts i bestämmelsernas innehåll för att göra dem tydligare. I motiveringstexten har gjorts kompletteringar. Ändringarna behandlas närmare i detaljmotiveringen. 
6
Samband med andra propositioner
Lagförslagen har samband med förslag om ändring av bestämmelserna om bokföring i försäkringsbranschen. I social- och hälsovårdsministeriet har en separat proposition beretts för att ändra de lagar som hör till ministeriets ansvarsområde så att de överensstämmer med de ändringar som föreslås i bokföringslagen. Dessa separata propositioner ska därför sammanjämkas. Förslagen har inget samband med andra lagförslag som behandlas samtidigt i riksdagen. 
Vid arbets- och näringsministeriet bereds som bäst en revidering av revisionslagstiftningen på basis av Europaparlamentets och rådets direktiv 2014/56/EU av den 16 april 2014 om ändring av direktiv 2006/43/EG om lagstadgad revision av årsbokslut och sammanställd redovisning. I revisionssammanhang är det viktigt att beakta de skyldigheter som regleras i bokföringslagstiftningen, men detta lagförslag har ingen betydelse för revideringen av revisionslagen, som kommer att gälla bl.a. revisorns skyldigheter, genomförande av revision och tillsyn över revisionssystemet. 
DETALJMOTIVERING
1
Lagförslag
1.1
Bokföringslag
1 kap. Allmänna bestämmelser
Bokföringsskyldigheten innebär en förpliktelse att utöver denna lag iaktta bokföringsförordningen och den nya förordning som ska utfärdas om uppgifter som ska tas upp i små- och mikroföretags bokslut. Lagändringen innebär å andra sidan att alla tidigare ministeriebeslut upphävs som obehövliga. Definitionen av begreppet bokföringsskyldighet har i kapitlet lagtekniskt delats upp i tvåparagrafer, dvs. i 1 § om juridiska personer och i 1 a § om fysiska personer. 
I kapitlets 2 § föreskrivs om en av huvudreglerna, dvs. om dubbel bokföring. Tidigare gällde detta krav samtliga bokföringsskyldiga med undantag för yrkesutövare. Samma undantag utsträcks nu till att gälla också rörelseidkare. Liksom i fråga om yrkesutövning har rörelsen inte avskilts från den fysiska rörelseidkarens egna tillgångar, vilket innebär att rörelseidkaren med hela sin personliga förmögenhet svarar för de skyldigheter och åtaganden som sammanhänger med verksamheten. Trots undantaget som gäller dubbel bokföring ska rörelseidkare och yrkesutövare alltid ha en sådan bokföring som verkställandet av beskattningen och andra deklarationer till myndigheterna förutsätter. Dessutom måste det vara möjligt att via bokföringen kontinuerligt följa beloppet av leverantörsskulder och kundfordringar. 
I kapitlet föreskrivs om god bokföringssed (3 §), dvs. om en princip som har betydelse både för den löpande bokföringen under räkenskapsperioden och för upprättandet av bokslut. I kapitlet har också tagits in flera nya definitioner i syfte att genomföra direktivet. De viktigaste av dessa är begreppen småföretag och mikroföretag (4 a och 4 b §). Till de centrala definitionerna hör fortfarande också definitionen av begreppet bestämmande inflytande i 5 §, som det hänvisas till i aktiebolagslagen (624/2006) och i annan associationslagstiftning. I kapitlet ingår dessutom definitioner som hänför sig till upprättande av koncernbokslut enligt 6 kap., bl.a. om ägarintresseföretag och intresseföretag (7 och 8 §). 
1 §.Juridiska personers bokföringsskyldighet. Bestämmelserna om hur långt bokföringsskyldigheten sträcker sig har förtydligats. Paragrafen gäller sålunda juridiska personer medan bestämmelserna i den följande nya paragrafen gäller fysiska personer. Denna skillnad framgår också av paragrafernas rubriker. 
Enligt paragrafens 1 mom. 1 punkten baseras bokföringsskyldigheten för det första på den juridiska identiteten i privaträttsligt hänseende. En juridisk person kan få rättigheter och själv bli förpliktad. En juridisk person har också rättshandlingsförmåga, dvs. är behörig att utöva sina rättigheter och vidta åtgärder som har rättsliga verkningar. Till kategorin privaträttsliga juridiska personer hör sådana kommersiella aktörer som aktiebolag och andelslag och likaså civilrättsliga aktörer som föreningar och stiftelser. Till kategorin juridiska personer hör också placeringsfonder enligt lagen om placeringsfonder (480/1987). För sådana fonders bokföring svarar i praktiken fondbolag som avses i lagen. 
Utformningen av denna punkt motsvarar 3 § 2 mom. i företags- och organisationsdatalagen (2001/244). Någon mera omfattande förteckning med exempel på olika typer av juridiska personer än den som ingår i den gällande bestämmelsens andra mening behövs inte. De juridiska personer som avses där hör till lagens tillämpningsområde utan att de behöver räknas upp särskilt. 
I momentets 2 punkt föreskrivs liksom i 5 a punkten i det gällande momentet dock för tydlighetens skull att sådana religionssamfund är bokföringsskyldiga som har grundats i enlighet med 2 kap. i religionsfrihetslagen (453/2003). Denna 2 punkt gäller inte Finlands evangelisk-lutherska kyrka och inte heller det ortodoxa kyrkosamfundet. Enligt 15 kap. 9 § 1 mom. i kyrkoordningen (1055/1993) för den evangelisk-lutherska kyrkan gäller i fråga om församlingens bokföringsskyldighet, bokföring och bokslut i tillämpliga delar vad som föreskrivs i bokföringslagen. Motsvarande förpliktelse gäller också enligt 61 § i kyrkoordningen för ortodoxa kyrkan (174/2007Liksom enligt den gällande bestämmelsen utesluts i 2 mom. för tydlighetens skull offentliga samfund från bokföringsskyldigheten. Ett offentligt samfund kan emellertid vara bokföringsskyldigt med stöd av någon annan lag. Exempelvis enligt 67 § i kommunallagen (365/1997) gäller i fråga om kommunens bokföringsskyldighet, bokföring och bokslut i tillämpliga delar bokföringslagen. Detsamma gäller Nordiska Investeringsbanken och Nordiska projektexportfonden. 
Från momentet har överförts undantagsbestämmelsen om lantbrukare till nya 1 a § 1 mom. eftersom bestämmelsen från systematisk synpunkt hör hemma i paragrafen om yrkesutövare och rörelseidkare. Undantaget i fråga om lantbrukares bokföringsskyldighet stämmer överens med gällande lag. För att förtydliga rättsläget utsträcks samma undantag också till fiskare. Bokföringsskyldighet uppkommer först då man börjar idka lantbruk eller fiske i företags- eller stiftelseform. 
Vissa juridiska personer ”kommer till” i rättslig bemärkelse först då de registreras i patent- och registerstyrelsens handelsregister eller i något annat motsvarande offentligt register. Genom registreringen får den juridiska personen rättskapacitet, vilket innebär att den kan inneha rättigheter och åläggas skyldigheter, medan rättshandlingsförmåga innebär att den juridiska personen kan ingå avtal och vidta andra rättsliga åtgärder och dessutom kära och svara i domstolar. Till denna kategori av juridiska personer hör aktiebolag, andelslag, registrerade ideella föreningar och stiftelser. 
Den första meningen i paragrafens nya 3 mom. utsträcker lagens tillämpningsområde till tiden före registreringen fr.o.m. grundandet. Bokföringsskyldighet uppkommer i och med att avtalet om att grunda företaget undertecknas eller då någon annan sådan åtgärd för att grunda företaget vidtas. För tillämpningen av lagen har det sålunda inte någon betydelse om den juridiska personen uppkommer först genom registreringen och inte heller om det har gjorts en sådan grundanmälan som avses i 2 § i handelsregisterlagen (129/1979). Det saknar sålunda betydelse om ansvaret för de affärshändelser som ligger till grund för bokföringsanteckningarna övergår till den juridiska person som inrättas i och med den konstitutiva registreringen eller inte. Bestämmelsen motsvarar ställningstagandet i bokföringsnämndens tidigare utlåtande 1757/2005. 
Dödsbon och konkursbon är inte självständiga juridiska personer. Sålunda baseras också deras bokföringsskyldighet på att verksamheten fortsätts enligt andra meningen i 3 mom. Detta motsvarar konkursombudsmannens ställningstagande 4/96 om bokföring och granskning av konkursbon: Om konkursboet fortsätter verksamheten fortsätter också bokföringsskyldigheten. Konkursboet är emellertid inte bokföringsskyldigt i en situation där det endast realiserar gäldenärens rörelsetillgångar eller slutför arbeten, om man för verksamheten inte skaffar nya omsättningstillgångar i någon betydande utsträckning. 
Av paragrafens nya 4 mom. framgår å andra sidan att bokföringsskyldigheten enligt denna lag i sin helhet gäller endast företag och stiftelser som är registrerade i Finland. Bokslutsinformationens offentlighet utsträcks dock med stöd av handelsregisterlagen (129/1979), som det hänvisas till i momentet, till utländska näringsidkares filialer som är etablerade i Finland. 
Enligt 2 § 1 mom. i lagen angående rättighet att idka näring (122/1919) avses med filial en sådan del av en utländsk sammanslutning eller stiftelse som i Finland, från ett fast driftställe beläget här i landet, fortlöpande bedriver rörelse eller utövar yrke i den utländska sammanslutningens eller stiftelsens namn och för dess räkning. 
1 a §.Fysiska personers bokföringsskyldighet. Enligt 1 mom. första meningen i denna nya paragraf utsträcks bokföringsskyldigheten till fysiska yrkesutövares och rörelseidkares verksamhet. Skyldigheten begränsas inte till finska medborgare utan den gäller alla yrkesutövare och rörelseidkare i Finland. 
Bestämmelsen innebär inte någon ändring i yrkesutövares skyldigheter. I fråga om yrkesutövare är bokföringens centrala uppgift att fungera som en grund för beskattningen. Så som konstateras ovan i motiveringen till 1 § räknaslantbrukare och fiskare inte till kategorin bokföringsskyldiga. Innehållsmässigt motsvarar momentet den gällande bestämmelsen så att den för tydlighetens skull utsträcks till att gälla också fiske. 
I 1 mom. andra meningen föreskrivs på motsvarande sätt som i 1 § 3 mom. andra meningen att bokföringsskyldighet gäller också dödsbon och konkursbon som fortsätter yrkesutövares och rörelseidkares verksamhet. 
Av 2 mom. första meningen framgår att informationsinnehållet i en fysisk persons bokföring i första hand bestäms utifrån beskattningens behov. Detta innebär i praktiken att av en yrkesutövares bokföring ska framgå de uppgifter som förutsätts i 24 § i Skatteförvaltningens beslut om deklarationsskyldighet och anteckningar (A173/200/2013). Dessutom måste beloppet av leverantörsskulder och kundfordringar kontinuerligt kunna utredas. Detta är nödvändigt för att man dels ska få reda på hur mycket och till vem en yrkesutövare är skyldig på grund av sitt yrke samt vilka fordringar och på vem yrkesutövaren har på grund av sin verksamhet. Skyldigheten kan i praktiken uppfyllas genom exempelvis s.k. mappreskontra för alla obetalda inköps- och försäljningsfakturor. 
Av momentets andra mening framgår att privatpersoner inte behöver ha dubbel bokföring om de i momentet angivna gränserna för verksamhetens omfattning inte överskrids. Gränserna motsvarar de som i revisionslagens (459/2007) 4 § föreskrivs i fråga om revisionsskyldigheten. Också en yrkesutövare eller rörelseidkare vars verksamhet inte överskrider de angivna gränserna kan å andra sidan, om den så önskar, ha dubbel bokföring. 
Då verksamheten utvidgas kommer bokslut att behövas bl.a. med tanke på samhällets informationsbehov. I 3 mom. åläggs sålunda fysiska personer, vilkas yrkesverksamhet eller rörelse till omfattningen motsvarar minst ett mikroföretag, att upprätta bokslut med iakttagande av de bestämmelser som gäller mikroföretagBokslut kan alltid också upprättas på frivillig grund, eftersom ett bokslut kan vara en förutsättning t.ex. för extern finansiering. Man måste då se till att det dokument som kallas bokslut har det informationsinnehåll som krävs, eftersom det bl.a. ska ge en sådan rättvisande bild som avses i 3 kap. 2 §. 
Skatteförvaltningens beslut om deklarationsskyldighet och anteckningar, som nämns ovan, gäller utöver yrkesutövare också juridiska personer som är rörelseidkare. Undantagsbestämmelsen i 2 och 3 mom. måste följaktligen utsträckas också till sådana personer. I detta avseende skiljer sig bestämmelsen från gällande lag. 
I lagstiftningen anges inte entydigt hur yrkesutövning i fråga om fysiska personer ska skiljas från rörelseidkande. Yrkesutövning bygger i regel på personliga färdigheter utan betydande kapital, så som framgår t.ex. av bokföringsnämndens utlåtande 996/1988, men också affärsverksamhet kan drivas utan att företagaren har några nämnvärda medel bundna till verksamheten. Trots att ett kännetecken på en rörelse å andra sidan vanligen är ett fast driftställe, kan från beskattningens synpunkt också en bostad anses vara ett sådant. Att en rörelseidkare har ett driftställe är sålunda inte ett tillräckligt kriterium för att skilja rörelsen från yrkesutövning. Dessutom förutsätter inte heller verksamhet som rörelseidkare nödvändigtvis att företagaren i sin anställning har utomstående arbetskraft, vilket innebär att företagaren likaväl som en yrkesutövare kan driva sin verksamhet ensam. En omständighet som med beaktande av denna svåra gränsdragning är ägnad att öka rättssäkerheten är att en rörelseidkare i fråga om sina bokföringsmässiga skyldigheter jämställs med en yrkesutövare. Att de behandlas likvärdigt kan motiveras också med bekämpningen av grå ekonomi. 
I sitt utlåtande 1663/2001 tar bokföringsnämnden också upp frågan om en fysisk persons bokföringsskyldighet för sin affärsverksamhet. Ställningstagandet gällde en privatperson som månatligen i fyra års tid sålt en eller två personbilar, med en omsättning som uppgick till sammanlagt ca en halv miljon mark. Trots att försäljningen skedde hemifrån utan avlönande arbetstagare uppfylldes kännetecknen på en rörelse, eftersom personen i fråga aktivt försökt nå kundkretsen med tidningsannonser och verksamheten var förenad med ekonomisk risk. Personen hade köpt bilarna för egen räkning från en bilaffär och sålt dem vidare i förtjänstsyfte. Bokföringsnämnden ansåg följaktligen att personen var bokföringsskyldig. 
I ett tidigare utlåtande 1630/2000 ansågs en enskild person inte vara bokföringsskyldig för värdepapperstransaktioner eftersom de utfördes i form av anonym börshandel där motparten utgjordes av en värdepappersförmedlare. Verksamheten krävde inte anskaffning av produktionsmedel som skulle ha medfört ekonomisk risk. Transaktionerna var i och för sig betydande från ekonomisk synpunkt: försäljningen hade ett år överskridit sex miljoner mark och antalet transaktioner hade varit fler än 90 under ett år. 
I ett fall som gällde inköp och försäljning av mynt beaktade bokföringsnämnden verksamhetens volym. Utlåtandet 1803/2007 gällde en situation där en privatpersons försäljning av euromynt under ett år omfattade ca 500 transaktioner. Försäljningen uppgick årligen till 58 000 - 76 000 euro. Nämnden ansåg att affärerna uppfyllde kännetecknen på näringsverksamhet. Av det tidigare utlåtandet 1796/2007 framgår å andra sidan att bokföringsskyldighet inte uppkommer på grund av myntförsäljning i mindre skala utan någon särskild ekonomisk risk. I det fall som detta utlåtande handlar om hade privatpersonen inte heller främjat sin verksamhet med betalda annonser. 
Att man försöker nå kunder är i sig inte nödvändigtvis relevant, om själva verksamheten drivs i liten skala. I utlåtandet 1697/2003 ansågs en privatperson inte vara bokföringsskyldig trots att han på annan plats än i sin bostad hade haft en försäljningsutställning. Han hade emellertid årligen målat endast 5 - 10 tavlor och verksamheten hade inte varit kontinuerlig. Intäkten hade varit ca 100 euro per tavla.  
En privatpersons medborgarskap är inte relevant för bokföringsskyldigheten. Enligt 1 § 1 mom. 1 punkten i lagen angående rättighet att idka näring (122/1919) får näring idkas av fysiska personer som är bosatta inom Europeiska ekonomiska samarbetsområdet. Enligt 2 mom. i samma paragraf kan patent- och registerstyrelsen bevilja också personer som är bosatta utom det ekonomiska samarbetsområdet samma rätt. Bokföringsskyldigheten enligt lagen omfattar sålunda också verksamhet som i Finland drivs av främmande staters medborgare. 
Paragrafens 4 mom. innehåller en informativ hänvisning till myndighetsreglering av särskilda branscher, vilket innebär att det av tillsynsskäl kan vara nödvändigt att uppställa bokföringsmässiga förpliktelser också för fysiska personer. 
2 §.Dubbel bokföring. Liksom enligt den gällande bestämmelsen innebär paragrafen en förpliktelse att ha dubbel bokföring, vilket innebär att varje transaktion till samma belopp ska noteras på minst två konton, på debet- respektive kreditsidan. I och med att bestämmelserna i lagens 7 kap. upphävs har i paragrafen tagits in en mot gällnade 7 kap. 1 § svarande undantagsbestämmelse som tillåter fysiska personer att ha enkel bokföring. En förutsättning är emellertid då att verksamheten till sin omfattning inte överskrider de gränser som anges i lagrummet. Liksom enligt föregående 1 a § gäller detta undantag, utöver yrkesutövare, också fysiska personer som driver rörelse. 
4 §.Räkenskapsperiod. 
I paragrafens 3 mom. föreskrivs i överensstämmelse med första meningen att räkenskapsperioden för yrkesutövare och rörelseidkare alltid är ett år. När verksamheten inleds går den första räkenskapsperioden alltid ut i slutet av det kalenderår då yrkesutövningen eller rörelsen inleddes. 
4 a §.Småföretag. Denna paragraf är baserad på artikel 3.2. Den bygger på medlemsstatsoptionen i artikelns andra stycke, enligt vilken de i pengar angivna tröskelvärdena får höjas högst en och en halv gång. De nämnda bestämmelserna lyder: 
- ”Små företag är företag som på balansdagen inte överskrider gränsvärdena i åtminstone två av följande tre kriterier: a) Balansomslutning: 4 000 000 EUR, b) Nettoomsättning: 8 000 000 EUR, c) Genomsnittligt antal anställda under räkenskapsåret: 50. (artikel 3.2 första stycket). 
- ” Medlemsstaterna får fastställa tröskelvärden som överstiger tröskelvärdena i leden a och b i första stycket. Tröskelvärdena får dock inte överskrida 6 000 000 EUR för balansomslutningen och 12 000 000 EUR för nettoomsättningen. (artikel 3.2 andra stycket). 
I paragrafen används termen ”småföretag” som utöver rörelsedrivande företag, exempelvis personbolag, aktiebolag och andelslag, omfattar också andra bokföringsskyldiga som uppfyller kriterierna i bestämmelsen. Sålunda kan t.ex. en förening eller en stiftelse vara ett sådant småföretag som avses i bestämmelsen. 
Granskningsperioden när det gäller överskridning av tröskelvärdena är i enlighet med den gällande lagens 3 kap. 9 § två på varandra följande räkenskapsperioder. Om gränsvärdena överskrids vardera perioden blir det fråga om en ändring av klassificeringen. Bestämmelsen stämmer överens med artikel 3.10 (eng. [..] that fact shall affect the application of the derogation provided for in this directive only if it occurs in two consecutive financial years). 
I oktober 2013 uppgav Statistikcentralen att det i Finland 2012 fanns sammanlagt 281 254 företag. Då från dessa räknades bort banker och försäkringsanstalter, primärproduktion och organisationsverksamhet samt aktörer inom den offentliga förvaltningen och företag som inte upprättar balansräkning, dvs. yrkesutövare, återstår 219 234 jämförbara företag. Då paragrafens kriterier tillämpas på dessa erhålls följande statistik: 
- balansomslutning högst 6 miljoner euro och omsättning 12 miljoner euro: 213 453 företag, 
- balansomslutning högst 6 miljoner euro och högst 50 anställda: 213 015 företag, och 
- omsättning högst 12 miljoner euro och högst 50 anställda: 215 220 företag. 
Av statistiken framgår att hela 97,2 - 98,2 % av företagen underskrider de i momentet angivna gränsvärdena. Om kriterierna för balansräkningen å andra sidan beräknas på den miniminivå som direktivet tillåter blir statistiken följande: 
- balansomslutning högst 4 miljoner euro och omsättning 8 miljoner euro: 211 378 företag, 
- balansomslutning högst 4 miljoner euro och högst 50 anställda: 211 463 företag och, 
- omsättning högst 8 miljoner euro och högst 50 anställda: 214 409 företag. 
Dessa gränser underskrids av 96,4 - 97,8 % av företagen. Eftersom antalet företag mellan paragrafens övre gränsvärden och direktivets nedre gränsvärden är relativt litet, är de övre gränser som anges i momentet ändamålsenliga för våra förhållanden. Detta innebär dessutom att lättnaderna för småföretagen omfattar ett så stort antal företag som möjligt, vilket innebär att de administrativa lättnaderna maximeras. 
Medlemsstaternas frihet att uppställa ytterligare nationella skyldigheter för småföretag är snävt begränsade i direktivet. Artikel 4.5 lyder: ” Medlemsstaterna får kräva att andra företag än små företag lämnar upplysningar i sina årsbokslut som går utöver det som krävs enligt detta direktiv”. Medlemsstaterna får inte i sin egen lagstiftning skärpa informationskraven när det gäller småföretags noter, bokslut och verksamhetsberättelser som avses i direktivet, utom när det gäller skattemässiga syften. Artikel 4.6 lyder: ” Med avvikelse från punkt 5 får medlemsstaterna kräva att små företag utarbetar, lämnar och offentliggör upplysningar i de finansiella rapporterna som går utöver kraven i detta direktiv, förutsatt att alla sådana uppgifter samlas in inom ramen för ett enda registreringssystem [eng. are gathered in a single filing system] och att upplysningskravet ingår i den nationella skattelagstiftningen enbart av skatteuppbördsskäl. De upplysningar som krävs enligt denna punkt ska ingå i den relevanta delen av de finansiella rapporterna [eng. for the strict purposes of tax collection]. 
4 b §.Mikroföretag. Denna paragraf är ny. Dess 1 mom. är baserat på artikel 3.1 som lyder: ” Vid tillämpningen av en eller flera av de möjligheter som anges i artikel 36 ska medlemsstaterna definiera [eng. shall define] begreppet mikroföretag som företag som på balansdagen inte överskrider gränsvärdena i åtminstone två av följande tre kriterier: a) Balansomslutning: 350 000 EUR. b) Nettoomsättning: 700 000 EUR. c) Genomsnittligt antal anställda under räkenskapsåret: 10.” 
Enligt en strikt tolkning av ordalydelsen i artikel 3.1 är gränsvärdena tvingande. Mikroföretagsundantaget enligt artikeln gäller emellertid redan enligt det s.k. mikrodirektivet (2012/6/EU), enligt vilket medlemsstaterna kan fastställa lägre gränser för mikroföretag än dessa maximigränser (enligt artikel 2 kan mikroundantagen införas helt eller endast delvis). Eftersom avsikten med redovisningsdirektivet inte är att ändra innehållet i det s.k. mikrodirektivet kan man tolka situationen så att medlemsstaterna fortsättningsvis i mikrodirektivets anda kan fastställa mikrogränserna på en lägre nivå än direktivets gränser. Kommissionen har varit enig om saken vid sina möten om tolkningen av direktivet. Detta betyder bl.a. att gränsvärdena inte behöver ändras i medlemsstater där lägre mikrogränser redan gäller. Varje EU-land kan enligt sin egen prövning fritt välja 
- om den nationellt ska tillämpa bestämmelserna om mikroföretag i artikel 36, 
- vilka av de lättnader för mikroföretag som avses i artikel 36 det är ändamålsenligt att ta i bruk, och 
- om den reglerar sådana lättnader för mikroföretag som avses i artikeln 36 lika heltäckande som direktivet tillåter eller om den begränsar lättnaderna ― en sådan begränsning är tillåten eftersom det i den nämnda artikeln är fråga om en medlemsstatsoption. Å andra sidan får begränsningen inte vara snävare än vad direktivbestämmelsen tillåter i fråga om småföretag, eftersom mikroföretagen utgör en underkategori av småföretag (artikel 36.6: ”Utan att det påverkar tillämpningen av den här artikeln [36] ska medlemsstaterna säkerställa att mikroföretag i övrigt betraktas som små företag.”) 
Såsom nämns ovan i samband med 4 a § fanns det i Finland år 2012 sammanlagt 281 254 företag. Av dessa kan 219 234 betraktas som sinsemellan jämförbara då man räknat bort banker och försäkringsanstalter, primärproduktion och organisationsverksamhet samt aktörer inom den offentliga förvaltningen och likaså företag som inte upprättar balansräkning, dvs. yrkesutövare. Direktivets gränsvärden för mikroföretag ger följande statistik: 
- balansomslutning högst 0,35 miljoner euro och omsättning 0,7 miljoner euro: 167 654 företag, 
- balansomslutning högst 0,35 miljoner och högst 10 anställda: 171 622 företag, och 
- omsättning högst 0,7 miljoner euro och högst 10 anställda: 186 487 företag. 
Av statistiken framgår att hela 76,5 - 85,1 % av företagen enligt artikel 3.1 hör till kategorin mikroföretag. Eftersom andelen mikroföretag av Finlands samtliga företag är relativt stor är det motiverat att förhålla sig restriktivt till alternativet att fullt ut på bokslut tillämpa de mikroföretagslättnader som enligt artikel 36 är tillåtna som medlemsstatsoptioner. För att minska den administrativa bördan är det å andra sidan motiverat att ett så stort antal företag som möjligt får dra nytta av de undantag för mikroföretag som beskrivs nedan. Mikrogränserna fastställs sålunda som maximigränser enligt direktivet. 
Lättnaderna för mikroföretag räknas upp i artikel 36.1: ”Medlemsstaterna får undanta mikroföretag från någon eller samtliga av följande skyldigheter”. Såsom ovan redan nämnts får medlemsstaterna själv välja om de beviljar mikroföretag som lyder under deras lagstiftning samtliga dessa lättnader eller endast en del av dem. I fråga om mikroföretag gäller sålunda inte motsvarande EU-baserade skyldigheter som för småföretag. när det gäller de undantag som avses i direktivet. 
4 c §.Storföretag. Den nya definitionen motsvarar artikel 3.4 som lyder: ” Stora företag är företag som på balansdagen överskrider gränsvärdena i åtminstone två av följande tre kriterier:a) Balansomslutning: 20 000 000 EUR. b) Nettoomsättning: 40 000 000 EUR. c) Genomsnittligt antal anställda under räkenskapsåret: 250”. 
Enligt direktivets artikel 3.3 är det möjligt att införa också kategorin ”medelstora företag”. Denna definition kan indirekt härledas från definitionen av storföretag, dvs. ” Medelstora företag är företag som inte är mikroföretag eller små företag och som på balansdagen inte överskrider gränsvärdena i åtminstone två av följande tre kriterier: a) Balansomslutning: 20 000 000 EUR. b) Nettoomsättning: 40 000 000 EUR. c) Genomsnittligt antal anställda under räkenskapsåret: 250.” I Finland finns för närvarande inte någon sådan företagskategori. Eftersom direktivet inte är tvingande i detta avseende införs kategorin medelstora företag inte i lagen. Den skulle i onödan komplicera företagsklassificeringen utan att ge motsvarande nytta. 
4 d §.IAS-förordningen. Denna paragraf innehåller en ny lagteknisk definition av den s.k. IAS-förordningen, som det hänvisas till i 5 kap. 2 a § 1 mom. och 2 b §, 6 kap. 1 § 5 mom. 1 punkten och 7 a kap. 1 §. 
5 §.Bestämmande inflytande. Denna paragraf är baserad på artikel 22 som motsvarar artikel 1 i det tidigare sjunde direktivet. Den nämnda artikeln lyder: ” Medlemsstaten ska föreskriva att varje företag som lyder under dess nationella lagstiftning ska upprätta en koncernredovisning och en förvaltningsberättelse för koncern, om företaget (ett moderföretag) 
a) innehar majoriteten av aktieägarnas eller delägarnas röster i ett annat företag (ett dotterföretag), 
b) har rätt att utse eller entlediga en majoritet av ledamöterna i förvaltnings-, lednings- eller tillsynsorganet i ett annat företag (ett dotterföretag) och samtidigt är aktieägare eller delägare i detta företag, 
c) har rätt att utöva ett bestämmande inflytande över ett företag (ett dotterföretag) i vilket det är aktieägare eller delägare enligt ett avtal som är slutet med det företaget eller enligt en bestämmelse i det företagets urkund eller bolagsordning, om den lagstiftning som dotterföretaget lyder under tillåter sådana avtal eller bestämmelser. 
En medlemsstat behöver inte föreskriva att moderföretaget ska vara aktieägare eller delägare i dotterföretaget; de medlemsstater där lagarna inte täcker sådana avtal eller klausuler behöver inte tillämpa denna bestämmelse, eller 
d) är aktieägare eller delägare i ett företag, och 
i) en majoritet av de ledamöter i företagets (dotterföretagets) förvaltnings-, lednings- eller tillsynsorgan som har utfört sitt uppdrag under räkenskapsåret, under det föregående räkenskapsåret och fram till tidpunkten för upprättandet av koncernredovisningen, har utsetts enbart på grund av den nämnde aktieägarens eller delägarens sätt att utöva sin rösträtt, eller 
ii) till följd av avtal med andra aktieägare eller delägare i företaget (dotterföretaget) ensam förfogar över en majoritet av rösterna för aktierna eller andelarna i det företaget. Medlemsstaterna får införa mer detaljerade föreskrifter angående form och innehåll för sådana avtal. 
Medlemsstaterna ska åtminstone införa den i led ii angivna ordningen. De får för tillämpningen av led i kräva att rösträtten motsvarar minst 20 % av de totala rösträttigheterna. 
Bestämmelserna i led i ska dock inte tillämpas om en tredje part innehar sådana rättigheter i det företaget som avses i led a, b eller c.” 
Med stöd av paragrafens 1 mom. 1 punkten som motsvarar den gällande bestämmelsen, innebär ett koncernförhållande alltid att den bokföringsskyldiga innehar mer än hälften av rösterna för samtliga aktier eller övriga andelar i målföretaget. Det räcker sålunda inte med en majoritetsandel t.ex. av ett aktiebolags samtliga aktier, om inte detta ägande samtidigt ger majoritet också av samtliga röster som aktiestocken medför. 
Utöver ägandet räcker det att röstmajoriteten grundar sig på ägande, medlemskap, bolagsordningen, bolagsavtalet eller därmed jämförbara stadgar eller på något annat avtal. Med andelar som är jämförbara med aktier avses både medlemsandelar och bolagsandelar. Av ordalydelsen framgår att förutsättningarna ska tolkas extensivt (regeringens proposition 173/1997). 
I EU-kommissionens tolkningsmeddelande (98/C 16/04, punkt 52) preciseras detta ytterligare på följande sätt: ” När det gäller definitionen av den ekonomiska relationen mellan moder- och dotterbolag skall majoriteten av rösterna för aktier och andelar alltid avse en enkel majoritet av samtliga rösträtter i bolaget. Detta gäller även om det enligt lagen, stiftelseurkunden eller bolagsordningen krävs att alla eller vissa beslut i ett bolag endast skall fattas på grundval av en kvalificerad majoritet. Relationen mellan moder- och dotterbolag påverkas inte av bestämmelser i lagen, stiftelseurkunden eller bolagsordningen som begränsar en aktie- eller andelsägares röststyrka till en viss procentandel av de totala rösträtterna i bolaget som är lägre än majoriteten av samtliga rösträtter, oberoende av storleken av aktie- eller andelsinnehavet och de medföljande rösträtterna.” 
I momentets 2 punkt föreskrivs att den bokföringsskyldiga har rätt att utse eller avsätta flertalet av ledamöterna i målföretagets styrelse eller motsvarande organ eller i ett organ som har denna rätt, om rätten grundar sig på samma omständigheter som den röstmajoritet som avses i 1 punkten. Detta gäller också stiftelser och föreningar. Status som dotterföretag innebär att den bokföringsskyldiga enligt stadgarna eller ett separat avtal har rätt att utse eller avsätta flertalet av ledamöterna i föreningens eller stiftelsens styrelse eller medlemmarna i motsvarande organ eller majoriteten av ledamöterna i ett organ som utser styrelsen. 
Enligt EU-kommissionens tolkningsmeddelande ska bestämmelsen tolkas snävt enligt ordalydelsen (98/C 16/04, punkt 56): ” Denna bestämmelse täcker i princip inte situationen där ett bolag, med avseende på annat bolag eller på grundval av stiftelseurkunden eller bolagsordningen, har rätt att utse en minoritet av ledamöterna i en av de ovan nämnda bolagsorganen och där den minoriteten innehar en majoritet av rösträtterna i det ifrågavarande bolagsorganet. Sammanställd redovisning (konsolidering) krävs endast i de fall rätten att utse eller avsätta en majoritet av styrelseledamöterna finns.” 
I bokföringsnämndens allmänna anvisning 7.11.2006 om upprättande av koncernbokslut (punkt 1.2) anses det att i en situation då ett företag förefaller höra till två skilda koncerner ska det räknas höra till den koncern vars företag har rätt att utnämna eller avsätta majoriteten av medlemmarna i styrelsen eller motsvarande organ. 
Utgångspunkten för tolkningen av lagrummet är enligt det som anförs ovan att endast en aktör vid en given tidpunkt kan ha bestämmande inflytande, dvs. den som har starkare rätt än andra att utse eller avsätta majoriteten av medlemmarna i styrelsen eller motsvarande organ utövar också bestämmande inflytande i målföretaget. Frågan om vem som har bestämmande inflytande ska tolkas i enlighet med denna paragraf då man bedömer skyldigheten att i enlighet med 6 kap. upprätta koncernbokslut. I en situation där den bokföringsskyldiga upprättar koncernbokslut på det sätt som avses i 7 a kap. i enlighet med de internationella IFRS-redovisningsstandarderna, i stället för i enlighet med bestämmelserna i 6 kap., ska frågan om vem som har bestämmande inflytande bedömas utifrån definitionen i redovisningsstandarderna. 
I syfte att förtydliga regleringen av bestämmande inflytande har i 3 punkten tagits in en mot gällande 3 mom. svarande bestämmelse som är baserad på medlemsstatsoptionen i artiklarna 22.2 och 22.7 samt på de därtill anslutna artiklarna 22.8 och 22.9. Motsvarande möjlighet gällde också enligt det sjunde direktivet (artikel 12). De nämnda artiklarna lyder: 
Artikel 22.2: ” - - får medlemsstaterna kräva att ett företag som lyder under deras nationella lagstiftning upprättar en koncernredovisning och en förvaltningsberättelse för koncern om 
a) företaget (ett moderföretag) har befogenhet att utöva eller faktiskt utövar ett bestämmande inflytande eller kontroll över ett annat företag (dotterföretaget), eller 
b) företaget (ett moderföretag) och ett annat företag (dotterföretaget) står under moderföretagets gemensamma ledning.” 
Artikel 22.7: ”Utan att det påverkar tillämpningen av denna artikel eller artiklarna 21 och 23 får en medlemsstat kräva att ett företag som lyder under dess lagstiftning upprättar en koncernredovisning och en förvaltningsberättelse för koncern, om 
a) detta företag och ett eller flera andra företag som företaget inte är närstående enligt beskrivningen i punkt 1 eller 2, står under enhetlig ledning i enlighet med 
i) avtal som ingåtts med det förstnämnda företaget eller 
ii) dessa andra företags stiftelseurkund eller bolagsordning, eller 
b) förvaltnings-, lednings- eller tillsynsorganen i detta företag och ett eller flera andra företag med vilka det förstnämnda företaget inte har något sådant samband som avses i punkt 1 eller 2, till större delen består av samma personer vilka har fullgjort sitt uppdrag under räkenskapsåret och fram till dess att den koncernredovisningen upprättas.” 
Artikel 22.8: ” Om den möjlighet för medlemsstaterna som avses i punkt 7 utnyttjas ska företag enligt beskrivningen i den punkten och alla deras dotterföretag omfattas av en koncernredovisning om ett eller flera av företagen är etablerade i någon av de företagsformer som förtecknas i bilaga I eller bilaga II.” 
Artikel 22.9: ” Punkt 6 i denna artikel och artiklarna 23.1, 23.2, 23.9, 23.10 och 24–29 ska tillämpas på den koncernredovisning och den förvaltningsberättelse för koncern som avses i punkt 7 i den här artikeln med följande ändringar: 
a) Hänvisningar till moderföretag ska anses vara hänvisningar till alla de företag som avses i punkt 7 i denna artikel. 
b) Utan att det påverkar tillämpningen av artikel 24.3 ska vad som i koncernredovisningen ingår under posterna ”Eget kapital”, ”Överkurs vid emission”, ”Uppskrivningsfond”, ”Kapitalreserver”, ”Balanserad vinst eller förlust” och ”Årets vinst eller förlust” utgöra de sammanlagda beloppen för de i punkt 7 i den här artikeln angivna företagen.” 
Syftet med punkt 3 är att täcka sådana finansierings- och säkerhetsarrangemang och övriga enheter som inrättats för särskilda ändamål (eng. special purpose entities) vilka leds på samma sätt som dotterföretag trots avsaknaden av ägar- eller medlemskapsrelaterade samband, till åtskillnad från sådana situationer som avses i 1 och 2 mom. 
Med sådana arrangemang som avses i punkten är det sålunda inte möjligt att kringgå skyldigheten att i koncernbokslutet inkludera enheter som hör till samma ekonomiska helhet. I motiveringen till det gällande lagrummet understryks uttryckligen att det är ändamålsenligt att också i Finlands lagstiftning beakta enheter som inrättats för ett särskilt ändamål (regeringens proposition 126/2004). Vid bedömningen av frågan om bestämmande inflytande accentueras sålunda principen ”innehållet går före formen” vilket innebär att samtliga omständigheter i anslutning till arrangemanget ska utredas och bedömas från fall till fall, med tonvikt på helheten. (bokföringsnämndens utlåtande 1775/2006 om tillämpningen av principen om innehållsbetoning i bokslut). 
Delägarna eller medlemmarna i en bokföringsskyldig aktör kan i praktiken ha ett direkt ägande också i ett annat företag för vilkets vidkommande ska bedömas frågan om den bokföringsskyldigas bestämmande inflytande. Bokföringsnämnden anser i utlåtandet 1791/2007 att sådant ägande ska beaktas då en delägare i företaget i fråga är styrelseledamot eller annars utövar faktiskt bestämmande inflytande i företaget. Bestämmande inflytande kan också framgå så att en bokföringsskyldig eller personer i dess dotterföretags förvaltningsorgan eller anställning gemensamt utövar på majoritetsställningen baserat inflytande i företaget. 
Detta betyder inte att persondelägaren i fråga själv ska anses vara bokföringsskyldig och sålunda också skyldig att upprätta koncernbokslut. En enskild person kan inte själv bli bokföringsskyldig enbart för att han eller hon på grund av aktiemajoriteten eller av någon annan motsvarande orsak har bestämmande inflytande över den bokföringsskyldiga (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 2.1). 
Frågan om de förutsättningar som föreskrivs i momentet är uppfyllda i ett företag gäller till sin karaktär bevisning av faktiska förhållanden. På det hela taget kan de också tala emot existensen av ett sådant bestämmande inflytande. Bokföringsnämnden har emellertid ansett att den på ägandet baserade röstandelens storlek då har betydelse för i vilken utsträckning ytterligare uppgifter ska läggas fram för att i enlighet med 3 kap. 2 § ge en rättvisande bild av de omständigheter på grund av vilka ett annat företag i egenskap av dotterföretag inte är sammanställt med den bokföringsskyldigas koncernbokslut. Om den bokföringsskyldigas röstandel, ensam för sig eller tillsammans med detta koncernföretag, är större än någon annan ägaraktörs andel i företaget, ska den bokföringsskyldiga i noterna uppge de faktiska omständigheter med stöd av vilka den anser att den trots sitt innehav inte har sådant bestämmande inflytande som grundar ett koncernförhållande (bokföringsnämndens utlåtande 1791/2007). 
Artikel 22.7 är dispositiv. Det är sålunda ett nationellt val att i lagen hålla kvar det moment som motsvarar artikeln. Det ansågs motiverat att sätta i kraft det nuvarande momentet också av den anledningen att artikeln eliminerade skillnaden mellan redovisningsdirektiven och de internationella redovisningsstandarderna, eftersom skyldigheten att upprätta koncernbokslut tidigare inom EU var snävare än standarderna (regeringens proposition 126/2004). Syftet med bestämmelsen är att försvåra kringgående av koncernbestämmelserna. 
6 a §.Små koncerner och stora koncerner. Den föreslagna paragrafens 1 mom. 1 punkten är baserad på artikel 3.5, 2 punkten på artikel 3.7 och 3 punkten på artikel 3.6. I punkt 1 föreskrivs i överensstämmelse med artikel 3.5 andra stycket om medlemsstatsoptionen enligt vilken tröskelvärdena för definitionens belopp får höjas en och en halv gång. 
Paragrafens 2 mom. är en teknisk precisering som motsvarar de artiklar som ligger till grund för 1 mom. 
8 §.Intresseföretag. Begreppet ”betydande inflytande” i paragrafens 1 mom. har preciserats i överensstämmelse med direktivet. Detta betyder att den bokföringsskyldiga har möjlighet att påverka det andra företagets ekonomiska och operativa beslut men att den bokföringsskyldiga dock inte har ett sådant bestämmande inflytande som är kännetecknande för ett koncernförhållande (bokföringsnämndens allmänna anväsning 7.11.2006 om upprättande av koncernbokslut, punkt 9.1). 
Momentet är baserat på artikel 2.13: ”intresseföretag: ett företag i vilket ett annat företag har ett ägarintresse och över vars operativa och finansiella politik detta andra företag utövar betydande inflytande. Ett företag anses utöva ett betydande inflytande över ett annat företag om det innehar minst 20 % av röstvärdet för aktierna eller andelarna i det andra företaget.” En liknande bestämmelse ingick i det fjärde direktivets (artikel 59.1) och även i det sjunde direktivet (artikel 33.1). 
I bokföringspraxis ska frågan om ett företag är ett ägarintresseföretag eller ett intresseföretag i regel bedömas utifrån de gränser som nämns ovan (regeringens proposition 173/1997).  
Till åtskillnad från det gällande momentet innebär ett innehav på minst en femtedel alltid ett intresseföretagsförhållande. Den bokföringsskyldiga kan sålunda inte åberopa den omständigheten att innehavet inte ger motsvarande inflytande. I bokföringsnämndens ställningstagande om tolkningen av det gällande lagrummet anses det att ett betydande inflytande kan saknas trots att den bokföringsskyldiga har över en femtedel av röstetalet, till exempel då alla andra aktier eller andelar ägs av en instans eller om ägandet endast är avsett att förbli kortvarigt (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 9.1). 
I momentets andra mening förutsätts emellertid inte ovillkorligen ett innehav eller en röstandel på minst en femtedel. För ett intresseföretagsförhållande räcker med andra ord en ägarandel som medför en permanent förbindelse mellan företaget och den bokföringsskyldiga och som är avsedd att främja den bokföringsskyldigas verksamhet, om denna samtidigt också har ett betydande inflytande både på styrningen och på finansiering av detta företag. Detta är emellertid endast en grundläggande presumtion: bestämmelsen innebär att den bokföringsskyldiga kan visa att det inte föreligger något intresseföretagsförhållande. I enlighet med god bokföringssed måste sådan bevisning dokumenteras. 
En bokföringsskyldig som har ägarandelar i ett eller flera intresseföretag, men inte i ett enda dotterföretag, utgör ingen koncern och upprättar sålunda inte heller koncernbokslut (bokföringsnämndens allmänna anvisning 7.11.2006 om upprättande av koncernbokslut, punkt 2.1). En sådan bokföringsskyldig ska enligt 2 kap. 9 § 1 § 1 punkten i bokföringsförordningen i fråga om ett företag där ägarandelen utgör en femtedel eller mera, i noterna ange namn, hemort och ägarandel samt det egna kapitalet och räkenskapsperiodens vinst eller förlust enligt det senast upprättade bokslutet. 
Den bokföringsskyldiga kan ha ett betydande inflytande också tillsammans med eller via sina dotterföretag. I paragrafens 2 mom. föreskrivs med tanke på den situationen att ett intresseföretagsförhållande uppkommer också då en bokföringsskyldig tillsammans med ett eller flera dotterföretag eller då ett dotterföretag till den bokföringsskyldiga ensamt eller tillsammans med andra företag har ett betydande inflytande och en sådan ägarandel i företaget som motsvarar vad som i 7 § förutsätts i fråga om ägarintresseföretag. Detta gäller också den situationen att ett sådant inflytande och en sådan ägarandel som avses ovan i alla avseenden är indirekt, dvs. att den bokföringsskyldigas dotterbolag agerar antingen ensamt eller tillsammans med andra dotterföretag. 
9 §.Företag av allmänt intresse. Denna paragraf är ny. Den baserar på artiklarna 2.1 a, 2.1 b och 2.1 c, där företag av allmänt intresse räknas uppI direktivet uppställs strängare krav på företag av allmänt intresse än på andra företag. Dessa krav avser i Finland för det första sådana börsbolag och andra företag enligt 1 kap. 7 § i värdepappersmarknadslagen (746/2012) vars värdepapper i eget eller främmande kapital är föremål för handel på en medlemsstats reglerade marknad. 
Enligt momentets 2 punkt utsträcks de särskilda bokslutskraven gällande föremål av allmänt intresse till sådana bokföringsskyldiga som avses i kreditinstitutslagen (121/2007) och 3 punkten till bokföringsskyldiga som avses i försäkringsbolagslagen (521/2008). 
Momentets 4 punkt är baserad på artikel 2.1 d enligt vilken ”företag av allmänt intresse är utsedda av medlemsstaterna till företag av allmänt intresse, till exempel företag som är av betydande allmänt intresse på grund av arten av sin verksamhet, sin storlek eller antalet anställda.” 
På EU-nivå har begreppet företag av allmänt intresse (eng. Public Interest Entity, nedan PIE) ursprungligen införts i revisionslagstiftningen. Sedermera har man börjat hänvisa till PIE-begreppet i flera EU-sammanhang (inom utvinningsindustrin eller avverkning av primärskogar verksamma företags årliga rapportering om betalningar som gjorts till offentliga myndigheter, rapportering av icke-kommersiella uppgifter i verksamhetsberättelser, tillämpningsområdet för revisionsförordningen samt regler för upprättande av koncernbokslut). 
Den grundläggande definition av PIE-företag på EU-nivå som avses ovan omfattar börsbolag, kreditinstitut och försäkringsbolag (artikel 2.1). Dessutom tillåter direktivet att medlemsstaterna i sin egen nationella lagstiftning utsträcker PIE-definitionen till företag inom andra branscher. I Finlands bokföringslag är det emellertid endamålsenligt att hålla sig till en sådan grundläggande definition av PIE-företag som motsvarar direktivet. Förfarandet att avhålla sig från en nationell utvidgning av den förestående nya EU-reglering som i större utsträckning är baserad på PIE-definitionen, orsakas inga oförutsedda och onödiga behov av ändringar i lagstiftningen. Detta regleringsalternativ möjliggör ett flexibelt och exakt förfarande då man nationellt har konstaterat ett särskilt behov att på andra företagsgrupper tillämpa enskilda krav som ställts på PIE-företag. En sådan situation kommer i framtiden att vara för handen t.ex. då man i Finland eventuellt i lagstiftningen måste lösa problemet med att eventuellt tillämpa revisionsförordningen bl.a. i värdepappersföretag och försäkringskassor. Om sådan tillämpning blir aktuell är det möjligt att uttryckligen föreskriva om den i speciallagstiftning utan att företagen i fråga definieras som PIE-företag, då de i andra avseenden än i fråga om tillämpningen av revisionsförordningen inte skulle beröras av PIE-förpliktelserna. På detta sätt undviks oförutsedda tolkningsproblem till följd av att dessa bokföringsskyldiga kategoriskt definieras som PIE-företag. Det är bl.a. fråga om huruvida ett koncernbokslut ska upprättas i och med att ett företag som hör till en liten koncern - för vilken annars inte upprättas något koncernbokslut - i och med syftet med lagstiftningen i övrigt blir definierat som ett PIE-företag. 
Genom att man håller fast vid direktivets grundläggande definition av PIE-företag främjar man också syftet att minska den onödigt tunga administrativa bördan. Det finns inget behov av en reglering utöver direktivets grundläggande nivå, eftersom man med en exaktare reglering branschvis kan uppnå de syften som lagstiftaren anser vara ändamålsenliga. 
Också direktivet definieras i 1 mom
Pragrafen innehåller en teknisk definition, enligt vilken med direktivet i denna lag avses 2013 års redovisningsdirektiv som 29.6.2013 publicerades i Europeiska unionens officiella tidning. I lagens övriga paragrafer är det sålunda lagtekniskt möjligt att hänvisa till detta direktiv. Definitionen används nedan bl.a. i 3 kap 4 §. 
I kapitlet har inte tagits in de definitioner av begreppen investmentföretag och finansiella holdingföretag som ingår i direktivets artiklar 2.14 och 2.15, eftersom det i Finland inte finns något behov av specialbestämmelser om sådana företags bokföring. 
2 kap. Bokföring av affärshändelser samt bokföringsmaterial
I lagens 2 kap. föreskrivs om bokföring av affärshändelser under räkenskapsperioden, om verifikationer som bokföringen ska baseras på samt om förvaring av verifikationer och annat bokföringsmaterial. Direktivet gäller inte direkt dessa omständigheter, vilket innebär att bestämmelserna är nationella till sin karaktär. I direktivets ingress (punkt 17) konstateras uttryckligen att väsentlighetsprincipen inte bör påverka eventuella nationella skyldigheter att upprätta fullständiga förteckningar över affärstransaktioner och ekonomisk ställning. Kapitlet gäller alla bokföringsskyldiga, också de som enligt 1 kap. 1 a § inte behöver upprätta bokslut och verksamhetsberättelse samt de som i enlighet med internationella standarder upprättar bokslut på det sätt som avses i 7 a kap. 2 § eller 3 §. 
Avsikten med att utveckla bestämmelserna i detta kapitel och andra sådana bestämmelser som har nära samband med dem är att indispositiva bestämmelser som gäller bokföringsskyldiga ska överföras till bokföringslagen från ministeriebeslut som utfärdats med stöd av den gällande lagen. Vidare ska normerna utformas så att de kan iakttas oberoende av bokföringssystemets teknologi och uppbyggnad. Genom att man upphäver ministeriebesluten, med deras detaljerade och på grund av den tekniska utvecklingen snabbt föråldrade och detaljerade tekniska bestämmelser om bokföringssystemen, får de bokföringsskyldiga och systemutvecklarna möjlighet att skapa konkurrenskraftiga lösningar och utveckla teknologin på en mera tillförlitlig grund. Samtidigt kan bokföringsnämnden styra god bokföringssed genom sina allmänna anvisningar och utlåtanden och lyfta fram goda lösningsmodeller, vilket dock inte utesluter andra och eventuellt bättre alternativ. En målsättning är också att se över läget från lagteknisk synpunkt och att sålunda minska den administrativa bördan för de bokföringsskyldiga. 
En bokföring som är tillförlitlig och utan svårighet kan granskas är dels en förutsättning för att ge en rättvisande bild och dels är bokföringen viktig som grund för skattedeklarationer och annan rapportering till myndigheterna. En fungerande automatisering av dessa deklarationer och rapporter har liksom också elimineringen av överlappande funktioner, en nyckelroll när det gäller minskning av den administrativa bördan. Samtidigt är det skäl att beakta att säkerställandet av bokföringens och den därpå baserade rapporteringens tillförlitlighet och granskningsbarhet är en grundläggande förutsättning för bekämpningen av grå ekonomi. I detta kapitel har strukits alla bestämmelser som utgör hinder för automatiserad bokföring och därpå baserad rapportering samt för utnyttjande av modern datateknik. Samtidigt har kraven på bokföringskedjans integritet samt på förvaringen av bokföringsmaterial och materialets granskningsbarhet förtydligats och preciseras bl.a. för att möjliggöra effektiv bekämpning av grå ekonomi. 
De ändringar som föreslås i detta kapitel innebär sammantaget en klar minskning av de bokföringsskyldigas administrativa börda och förbättrar myndigheternas möjligheter att bekämpa grå ekonomi. I detta skede är det inte möjligt att göra någon noggrannare konsekvensanalys, eftersom de föreslagna ändringarna inte direkt eller omedelbart inverkar på de bokföringsskyldigas förfaranden. Verkningarna kommer till synes först då ekonomiförvaltningens datasystem samt myndigheternas datasystem och förfaranden vidareutvecklas på det sätt som bestämmelserna ger möjlighet till. 
2 §.Bokföringskonton, kontoplan och bokföringar1 mom. som i stort sätt överensstämmer med den gällande bestämmelsen förutsätter att varje affärshändelse ska bokföras enligt sin art på motsvarande konto. Valet av konto är en viljeyttring som visar hur respektive affärshändelse ska förstås i bokföringsmässigt hänseende. För tydlighetens skull definieras bokföringen av en affärshändelse som en notering, vilket förtydligar momentets ordalydelse. 
För att inkomstbildningen och den ekonomiska ställningen ska kunna jämföras under olika räkenskapsperioder föreskrivs i momentet också att varje konto fortlöpande ska bibehållas oförändrat till innehållet. Kontots innehåll kan ändras endast av särskild anledning. 
Till paragrafen har fogats ett nytt 3 mom. med definition av begreppen huvudbokföring och delbokföring. I och med ändringar har de tidigare definitionerna av begreppen grundbokföring och huvudbokföring i 4 § strukits. 
Med huvudbokföring avses en sådan logisk del av bokföringssystemets högsta nivå från vars saldon bokslutet härleds och till vilken som sammanställningar överförs uppgifter om eventuella delbokföringar. 
En delbokföring kan bestå av många slags överföringar sorterade i kronologisk ordning, men i praktiken förhåller det sig nästan undantagslöst så att ett bokföringssystem med delbokföringar har byggts upp på basis av transaktionsslag så att exempelvis kundreskontra och lagerbokföring utgör skilda delbokföringar. Också när det är fråga om bokföring i liten skala är en ofta förekommande och viktig form av delbokföring ett sådant kontoutdrag för en finansieringsanstalt som på sedvanligt sätt kan behandlas som delbokföring. 
Det gällande ministeriebeslutet 47/1998 innehåller följande definition: ” Med delbokföring avses bokföring från vilken uppgifter maskinellt förs över till huvudbokföringen i form av affärshändelser eller sammanställningar av sådana eller genom att sammanställningar av noteringarna i delbokföringen registreras. Från delbokföringen får uppgifter även överföras till huvudbokföringen via en annan delbokföring.” 
I bokföringsnämndens allmänna anvisning om bokföringsmetoder och bokföringsmaterial (1.2.2011) punkt 1.4 definieras begreppet delbokföring på följande sätt: 
”Med delbokföring avses bokföring, från vilken uppgifter maskinläsbart överförs till huvudbokföringen som en sammanställning eller annat sammandrag. Till exempel kundreskontran, från vilken fakturorna eller prestationerna överförs som sammanställningar till huvudboken, 6 är en delbokföring. Delbokföringen utgör en del av bokföringen och den ska förvaras på samma sätt som huvudbokföringen. 
Datasystemet utgör dock inte en delbokföring, om uppgifterna överförs från systemet affärshändelse för affärshändelse till huvudbokföringen eller till en annan delbokföring och om det finns en sammanhängande verifieringskedja från verifikationsmaterialet till huvudbokföringen. Till exempel ett elektroniskt hanteringssystem för leverantörsfakturor, från vilket inköpsnoteringarna skilt för varje affärshändelse överförs till huvudbokföringen eller till leverantörsreskontran och leverantörsfakturorna till ett maskinläsbart datamedium, utgör inte delbokföring om det finns en sammanhängande verifieringskedja mellan de leverantörsfakturor som lagrats på ett maskinläsbart datamedium och de noteringar som på basis av dem har överförts till huvudbokföringen. I så fall utgör dessa en del av huvudbokföringen.” 
Paragrafens rubrik har ändrats i överensstämmelse med det förnyade innehållet. 
3 §.Bokföringsgrunder. Med uttrycket bokföringsmogen avses i vilket skede en affärshändelse anses vara ”mogen” att noteras i bokföringen. Mogenheten i detta avseende avgör sålunda på vilket datum en viss transaktion noteras. De grunder som avses i paragrafen är alternativa sätt att bestämma mogenheten. Bokföringsgrunden är en annan sak än tidpunkten då noteringen tekniskt utförs, som det föreskrivs i 4 § i detta kapitel. 
Paragrafens nya 2 mom. tillåter, utöver den gällande bestämmelsens kontantprincip, den s.k. faktureringsprincipen, som innebär att en transaktion ska noteras i bokföringen enligt faktureringsdatum. Syftet med momentet är att underlätta det praktiska bokföringsarbetet eftersom faktureringsprincipen har godkänts också för mervärdesbeskattningen. Bokföringen utnyttjas också för beräkning och redovisning av mervärdesskatt. Enligt 136 § 1 mom. första meningen i mervärdesskattelagen (1501/1993) får under räkenskapsperioden skatt hänföras ”till den kalendermånad under vilken köparen har debiterats för den levererade varan eller den utförda tjänsten” och på motsvarande sätt föreskrivs i 142 § 1 mom. första meningen att under en räkenskapsperiod får avdrag som ”hör till räkenskapsperioden hänföras till den kalendermånad under vilken den som är berättigad till avdraget har debiterats för den levererade varan eller den utförda tjänsten.” 
4 §.Bokföringsordning och bokföringstid. Enligt paragrafens 1 mom. ska bokföringen ordnas så att noteringarna kan granskas kronologiskt och systematiskt. Med det sist nämnda kravet avses systematisk notering av transaktionerna på konton som motsvarar innehållet. Den föregående paragrafen handlar om bokföring både kronologiskt och systematiskt. I praktiken görs noteringar varken i datasystem eller ens i små pappersbaserade bokföringar på två olika ställen, utan i bokföringen antecknas både datum och kontoföringar. Datasystemet och de rapporter som det producerar gör det möjligt att granska uppgifterna både kronologiskt och systematiskt. Utformningen av momentet har ändrats så att det motsvarar detta sakförhållande. Tidigare nämndes inom parenteser begreppen grundbokföring och huvudbokföring. Dessa har strukits som obehövliga eftersom de har fått en mycket liten betydelse i bokföringspraxis. Grundbokföring är en term som numera knappast alls används för att beskriva kronologiska noteringar (mera allmänt s.k. journal) och huvudbokföringen är enligt dagens språkbruk dels systematiskt, dvs. kontovis ordnad bokföring och dels också den logiska del på bokföringssystemets högsta nivå från vars kontosaldon härleds bokslutsrapporterna och till vilken som sammanställda noteringar överförs uppgifter från delbokföringarna. Begreppen huvudbokföring och delbokföring definieras i 2 § 3 mom. 
I detta moment och i flera andra paragrafer i detta kapitel talas om granskning av bokföringen och annat material. Det som avses är läsning av eller sökning i materialet, antingen manuellt eller med ett program eller gränssnitt eller tillfällig konvertering av materialet i en form som gör detta möjligt. Pappersbaserade bokföringar låter sig naturligtvis sökas i och läsas manuellt i samma form. I fråga om mera omfattande bokföringsmaterial görs ofta olika typer av databassökningar och konverteringar för att gallra, sammanställa och ordna materialet i en ändamålsenlig form. Avsikten är inte att slå fast tekniska lösningar för olika bokföringssystem och inte heller hur de ska genomföras, eftersom de i praktiken med fog kan vara uppbyggda på mycket varierande sätt. På ett allmänt plan uppställs kravet att data måste finnas tillgängliga på något från teknisk synpunkt nationellt sätt i en viss situation. 
Momentets ändrade utformning leder inte till några ändringsbehov i bokföringssystem som stämmer överens med gällande lagstiftning. I paragrafens 2 mom. har tidigare föreskrivits både om noteringarnas kronologiska noggrannhet och hur snabbt noteringarna ska göras. För tydlighetens skull har bestämmelserna om hur snabbt noteringarna ska göras överförts till paragrafens nya 4 mom., medan det i 2 mom. enbart föreskrivs om kronologin. 
Enligt momentets första mening ska kontantbetalning noteras i bokföringen för varje dag. I meningen har i överensstämmelse med ändringarna i 1 mom. strukits omnämnandet om den kronologiska ordningen, som inte i sig hade något självständigt innehåll. Då noteringar ska göras varje dag blir följden av kravet i 1 mom. att de måste kunna granskas kronologiskt med en dags noggrannhet. Noteringar som avser betalningar som inte gjorts kontant får å andra sidan göras per månad eller periodiserad på motsvarande sätt. Med ”en motsvarande period” avses fyra eller fem veckor. Det är ofta mera ändamålsenligt att vid beräkningen utgå från en vecka och inte från en kalendermånad (regeringens proposition 126/2004). 
Till paragrafen har fogats ett omnämnande om noteringar och sammanställningar av delbokföringar i huvudbokföringen. I dessa avseenden tillämpas samma tidsfrister som annars, utom när det gäller notering av kontanta transaktioner. Denna bestämmelse har på grund av sin karaktär för tydlighetens skull från det gällande ministeriebeslutet 47/1998 lyfts upp till lagnivå, trots att sammanställningar av delbokföringar i huvudbokföringen också hör till klassen ”noteringar av andra än kontantbetalningar”. Tekniskt sett hör upptagande av delbokföringar i huvudbokföringen emellertid till den kategori av noteringar som inte direkt är baserade på egentliga verifikationer utan på bokföringar på lägre nivå, dvs. noterringar som skiljer sig från verifikationer bl.a. i fråga om kraven på förvaringstid. Samma principer ska tillämpas på sammanställda noteringar av delbokföringar på följande lägre nivå i bokföringssystem som är uppbyggda i flera nivåer. 
Paragrafens gammal 3 mom. upphävs. Ministeriebeslutet 47/1998 innehåller detaljerade bestämmelser om avstämning av sammanställda överföringar och delbokföringar samt tekniskt genomförande. Bestämmelsen har ersatts så att 6 § om verifieringskedjan har preciserats. Det tekniska genomförandet av verifieringskedjan är på ett avgörande sätt beroende av med vilken uppbyggnad och teknologi bokföringssystemet har förverkligats. Bokföringsnämnden kan också i denna fråga vid behov ge allmänna anvisningar och utlåtanden om god bokföringssed. 
I paragrafens nya 3 mom. föreskrivs om tidsfristerna för noteringar. Liksom enligt gällande lag förutsätts att kontantbetalningar ska bokföras utan dröjsmål. Den gällande lagens krav att andra än kontanttransaktioner ska bokföras inom fyra månader efter periodens utgång ersätts med en preciserad bestämmelse som bättre beaktar de bokföringsskyldigas varierande förhållanden. 
Nästan alla bokföringsskyldiga som bedriver affärsverksamhet måste på grund av tidtabellerna för momsdeklarationer uppdatera åtminstone merparten av sin bokföring månatligen eller med högst två månaders mellanrum. Mervärdesbeskattningen förutsätter i fråga om andra kontanttransaktioner för många bokföringsskyldigas vidkommande kortare noteringsintervall än vad som föreskrivs i det gällande momentet, eftersom mervärdesskatt enligt huvudregeln ska betalas till staten senast den 12 dagen den andra månaden efter respektive kalendermånad (147 § 1 mom. i mervärdesskattelagen). Alla bokföringsskyldiga som har ordinarie anställda måste också för att uppfylla sina plikter som arbetsgivare månatligen uppdatera sin lönebokföring. Dessutom måste det beaktas att eftersom kontantbetalningar i varje fall måste noteras utan dröjsmål och kontoutdrag på sedvanligt sätt behandlas som delbokföringar för vilka sammanställda noteringar får göras i huvudbokföringen, så ska de bokföringsskyldiga i fråga om hela betalningstrafiken i praktiken göra kontinuerliga noteringar. I praktiken har bokföringsskyldiga, som bedriver affärsverksamhet och är arbetsgivare, av dessa skäl utan undantag gjort sin bokföring månatligen, vilket innebär att den gällande bestämmelsen om en fyra månaders period har förblivit en död bokstav. 
Det finns å andra sidan en stor grupp bokföringsskyldiga, bl.a. många små föreningar, bostadsaktiebolag med ett eller två hus, vilande aktiebolag samt företag av typen holdingbolag, som inte utöver registrering av bokslut och inlämnande av skattedeklaration behöver ge myndigheterna andra upplysningar. Också i fråga om dessa bokföringsskyldiga ska emellertid alla betalningstransaktioner utan dröjsmål införas i delbokföringen antingen genom bankens eller, i fråga om kontantbetalningar, genom den bokföringsskyldigas försorg. Detsamma gäller t.ex. bokföringsskyldiga som gör värdepappersinvesteringar för egen räkning, vilket innebär att de rapporter som produceras av mäklarens system fungerar som ständigt uppdaterade delbokföringar som motsvarar kontoutdrag. Antalet verifikationer och överföringar till huvudboken är för dessa bokföringsskyldiga nästan alltid så litet att själva bokföringen är en mycket snabb åtgärd. När det är fråga om en bokföringsskyldig vars ekonomiska ställning inte är så svag att den skulle kräva särskilda uppföljningsberäkningar under räkenskapsperioden, har noteringarna i huvudbokföringen också medan den gällande lagen varit i kraft ofta gjorts en gång per år, innan bokslutet och skattedeklarationen upprättats. Alla noteringar ska naturligtvis alltid göras innan bokslutet upprättas. Om man på basis av bokföringen i enlighet med lagen eller en bestämmelse som är baserad på lagen ger rapporter till myndigheterna, ska noteringarna göras i så god tid att dessa rapporter kan upprättas och ges i tid. Sådana rapporter är t.ex. momsdeklarationer, arbetsgivaranmälningar och motsvarande. Så som framgår av 6 § gäller kravet på verifieringskedjan också dessa rapporter. 
Oberoende av om bokföringsbaserade rapporter ska ges till myndigheterna under räkenskapsperioden ålägger momentets sista mening den bokföringsskyldiga att under perioden hålla sin bokföring uppdaterad på sätt att dess förvaltningsorgan kan uppfylla sin tillsynsskyldighet. Detta blir aktuellt t.ex. då ett aktiebolags likviditet är hotad eller om bolaget löper risk att förlora sitt eget kapital eller om det annars finns någon anledning att misstänka att dess förmåga att uppfylla sina åtaganden kan ifrågasättas. I sådana situationer måste bokföringen vara uppdaterad för att företagets förvaltningsorgan ska kunna få den information som krävs för de beslut som lagstiftningen förutsätter och vidta nödvändiga åtgärder. Sålunda kan man t.ex. i en konkurssituation inte åberopa att det inte var nödvändigt att hålla bokföringen uppdaterad och att det sålunda inte fanns att få information om företagets situation. 
Enligt det nya momentet ska bokföringen uppdateras senast då och till de delar som den behövs som grund för rapporten eller bokslutet eller för att förvaltningsorganet ska kunna uppfylla sin tillsynsskyldighet. Detta förtydligar den bokföringsskyldigas förpliktelser och innebär en klar förbättring jämfört med den gällande bestämmelsen som för en stor del av de bokföringsskyldiga har varit onödig eller som en del av dem av praktiska orsaker inte har tillämpat. Tillsammans med de ändringar som föreslås i 6 och 7 § förbättrar det nya momentet möjligheterna att granska materialet under perioden, samtidigt som det gör det möjligt att skapa bokföringsprocesser och -förfaranden för olika typer av bokföringsskyldigas specifika situationer. 
De följande bestämmelserna om verifieringskedja (6 §) och bokföringsmaterial (7 §) har anpassats till ändringarna i denna paragraf. Kravet på verifieringskedjan har utsträckts också till rapporter som avses i detta moment. Dessutom ska bokföringsmaterial som uppkommit under perioden, inklusive verifikationer och delbokföringar som inte ännu noterats i huvudbokföringen, förvaras omsorgsfullt så att materialet vid behov kan granskas utan svårighet. 
Det bör observeras att denna paragraf inte eliminerar eller minskar själva bokföringsskyldigheten. Dessutom kan myndigheterna inom branscher som tillämpar speciallagar eller står under tillsyn ålägga sina tillsynsobjekt snävare tidsgränser för bokföringen, trots att särskilda myndighetsrapporter inte nödvändigtvis behöver ges under perioden. Detta kan komma i fråga t.ex. för att underlätta Finansinspektionens tillsyn över små värdepappersföretag. Dessa är emellertid sektorrelaterade specialbehov som inte behöver regleras i en sådan allmän lag som bokföringslagen. 
5 §.Verifikation. Bokföringen baseras på sådana skriftliga verifikationer av affärshändelser som avses i 1 mom. En verifikation beskriver med andra ord en affärshändelse. I detta syfte ska av verifikationen enligt momentet vara daterad och systematiskt numrerad och av den ska dessutom framgå utfärdarens namn och affärshändelsens innehåll samt penningbeloppet. 
Momentets första mening som tidigare föreskrev att verifikationen skulle vara numrerad har moderniserats så att den bättre motsvarar dagens praxis och föreskriver nu att verifikationen ska vara systematiskt numrerad eller specificerad på motsvarande sätt. I praktiken numreras och specificeras verifikationerna inom stora bokföringssystem i många olika kategorier och serier och verifikationen av en affärshändelse kan vara en sammanställning av flera olika handlingar och datafält. 
Det är av en central betydelse att en verifikation som ligger till grund för en viss notering till alla delar tillförlitligt kan specificeras så att det är möjligt att granska den information som ligger till grund för bokföringen. Numreringen är emellertid inte det enda sättet för att uppfylla detta krav. Hänvisning till enskilda rader i allmänt använda databasbaserade bokföringssystem görs med söknycklar. I system som bygger på XML-teknologi eller s.k. NoSQL-databaser kan filer och delar av filer specificeras med hjälp av logiska länkar eller matematiska koder. Sådana datatekniska lösningar som genomförs på rätt sätt specificerar verifikationer lika väl som manuell numrering av skriftliga verifikationer. 
Bokföringen inbegriper å andra sidan åtgärder som inte alla förutsätter verifikatunderlag. Sådana åtgärder är bl.a. kontoöppning och redovisning av räkenskapsperiodens resultat i balansräkningen samt, beroende på hur bokföringssystemet är uppbyggt, överföringar av noteringar och poster mellan olika delar av systemet. 
Noteringar som görs på basis av verifikationer är den bokföringsskyldigas viljeyttring om karaktären av en affärshändelse som ligger till grund för verifikationen. Den gällande bestämmelsen om konteringsanteckningar på verifikationer har, om det inte framgår av bokföringen hur verifikatet bokförts, ersatts med ett mera allmänt utformat krav enligt 6 § (verifieringskedjan) i detta kapitel enligt vilket sambandet mellan affärshändelsen, verifikationen och bokföringen måste kunna konstateras utan svårighet. Detta krav kan i och för sig härledas från utformningen av 6 §, men det har för tydlighetens skull tagits in också i 5 §. Det är fortfarande möjligt att uppfylla kravet genom konteringsanteckningar på verifikationerna, men detta torde sällan vara det mest praktiska alternativet eller ens ett rekommenderbart alternativ. Verifieringskedjan förverkligas i det avseendet normalt på så sätt att i samband med en bokföring specificeras motsvarande verifikation, vanligen med dess nummer, dvs. det som antecknats också på själva verifikationen. Sambandet mellan verifikationen och affärshändelsen framgår av verifikationens innehåll. 
Den information som behövs för en bokföring framgår i allmänhet av flera handlingar eller databaser. I sådana situationer kan upprätthållandet av verifikationskedjan ofta förutsätta att i samband med noteringen skapas ett slags innehållsförteckning varav framgår vilka separata verifikationer som innehåller informationen som ligger till grund för noteringen. En verifikation som hör till en räkenskapsperiods verifikationsmaterial behöver emellertid inte kopieras för att kunna läggas till grund för en notering, utan det räcker med en tydlig hänvisning till verifikationen. I bokföringsnämndens allmänna anvisning om bokföringsmetoder och bokföringsmaterial (1.2.2011) behandlas detta i punkt 2.3 på följande sätt: 
”En verifikation kan bestå av ett eller flera dokument, filer eller delar av dessa. En verifikation kan till exempel vara en pappersfaktura, webbfaktura i XML- eller html-filformat, en skannad bildfil, en textfil eller en datahelhet som lagrats i databasen från vilken verifikationens uppgifter kan produceras. Om verifikationen består av flera dokument eller filer eller övriga delar ska en tydlig beskrivning finnas av kopplingen mellan dessa så att verifikationens sakinnehåll kan granskas som en helhet. Detta krav ska beaktas även vid den permanenta förvaringen av bokföringsmaterialet.” 
Enligt 2 mom., som i stort sett motsvarar gällande bestämmelse, ska av en utgiftsverifikation framgå den mottagna produktionsfaktorn och av en inkomstverifikation den överlåtna prestationen. Dessutom ska tidpunkten för mottagandet av en produktionsfaktor och överlåtelsen av en prestation kunna visas med hjälp av en verifikation. Dessa tidsuppgifter behövs för konstaterande av att prestationsprincipen enligt 3 § 1 mom. i detta kapitel uppfylls, då bokslutet i enlighet med denna princip upprättas på det sätt som förutsätts i 3 kap. 3 § 1 mom. 5 punkten. 
Momentets andra mening har preciserats. Omnämnandet om en bilaga eller på något annat sätt har strukits i syfte att förtydliga terminologin. Eftersom denna information behövs för bokföringen ska informationskällan enligt definitionen utgöra en del av en verifikation som ligger till grund för bokföringen. 
Den som är skyldig att betala mervärdesskatt ska också iaktta mervärdesskattelagens (1501/1993) bestämmelser om vilka anteckningar som ska göras på verifikationer. Också i 35 och 36 § i lagen om förskottsuppbörd (1118/1996) samt i 5 kap. i förordningen om förskottsuppbörd (1124/1996) finns bestämmelser som verifikationer. 
Paragrafens 6 mom. upphävs eftersom det enligt 7 § 2 mom. och 4 § 4 mom. nu är tillåtet att göra ändringar i bokföringen innan bokslutet upprättas. 
5 b §.Verifikation till noter. Denna nya paragraf utvidgar verifikationsbegreppet till att omfatta också dokument och beräkningar som ligger till grund för bokslutsnoter. Noternas betydelse för att säkerställa en rättvisande bild har under den gällande lagstiftningen ytterligare accentuerats. Noter ska i regel lämnas om omständigheter vilkas utelämnande skulle innebära att bokslutet inte nödvändigtvis ger en i väsentliga avseenden rättvisande bild av den bokföringsskyldigas ekonomiska ställning och resultat. En enskild not är sålunda viktigare för att ge en rättvisande bild än mången enskild affärshändelse som skrivs in i bokföringen och vars inverkan på bokslutet på det hela taget kan vara liten. 
I praktiken är så gott som samtliga noter som anger penningbelopp redan nu baserade på dokument eller beräkningar som påminner om verifikationer och som enligt nuvarande lagstiftning uppenbarligen skulle betraktas som verifikationer om de lades till grund för noteringar i den egentliga bokföringen. Liksom beträffande affärshändelser kan det vara fråga om dokument från utomstående, exempelvis dokument över ansvarsförbindelseer eller om en promemoria eller beräkning som den bokföringsskyldiga själv upprättat eller om ett innehåll som härletts från flera olika dokument eller databaser. 
För att säkerställa bokslutens tillförlitlighet och granskningsbarhet är det ändamålsenligt att noternas underliggande dokument, databaser och beräkningar behandlas och förvaras som bokföringsverifikat och att verifieringskedjan mellan dem och noterna utan svårighet kan konstateras. Det finns emellertid också sådana förklaringar till noter, exempelvis gällande värderings- och periodiseringsprinciper, som inte uppenbart är baserade på verifikationer. Av denna anledning har paragrafen utformats så att noterna ska baseras på verifikationer, om grunden inte annars är uppenbar. Detta kapitels övriga paragrafer om verifikationer och förvaring av sådana ska tillämpas också på verifikationer av noter, till den del som det är möjligt. 
Utvidgningen av verifikationsbegreppet till att omfatta material som ligger till grund för noter bedöms på sin höjd orsaka mycket små extrakostnader för de bokföringsskyldiga, eftersom det endast är fråga om en ny kategorisering av redan nu existerande dokument och databaser. De kan sannolikt numreras eller specificeras på motsvarande sätt och utan större besvär förvaras på samma sätt som verifikaten till den egentliga bokföringen, i synnerhet då man beaktar att de är få till antalet i förhållande till antalet verifikationer av affärshändelser. 
6 §.Verifieringskedja. Varken revision eller skattekontroll kan utföras om inte sambandet mellan bokföring och bokslut kan konstateras. Paragrafens innehåll har förtydligats och utvidgats i förhållande till den gällande lagen. Verifieringskedjans existens och funktion är inte uteslutande beroende av bokslutsnoteringarna utan det är i praktiken fråga om hur bokföringssystemet är planerat och genomfört. Av denna anledning har hänvisningen till bokslutsanteckningar ersatts med ett mera allmänt krav på att bokföringen ska ordnas med tanke på verifieringskedjan. 
Så som framgår av 5 § 1 mom. om de krav som ställs på verifikationer, är sambandet mellan en affärshändelse och en verifikation en väsentlig del av verifieringskedjan, vilket innebär att också denna del har tagits med i definitionen av verifieringskedjan. Om man utgår från verifieringskedjan är en affärshändelse, en verifikation av denna (som kan bestå av flera dokument, eller databasdelar) och en bokföring som gjorts på basis av den en helhet som behandlas i 4 § 1 mom. 
I enlighet med de ändringar som gjorts i detta kapitels 4 § har hänvisningen till grundbokföring ändrats så att den avser delbokföring. Begreppen huvudbokföring och delbokföring används också här numera i överensstämmelse med vedertagna definitioner som behandlas i samband med motiveringarna till 4 §. 
Hänvisningen till den i 3 kap. 1 § avsedda resultaträkningen och balansräkningen har ersatts med en mera allmän hänvisning till bokslutet, som kan inkludera också andra handlingar, exempelvis en finansieringsanalys Det är också skäl att observera att dessa bestämmelser i 2 kap. enligt 7 a kap. gäller också bokföringsskyldiga som iakttar internationella redovisningsstandarder och som enligt 7 a kap. 4 § inte berörs av 3 kap. 3 § 1 - 3 mom. 
Bokföringsanteckningarna utgör också grund för skattedeklarationer och myndighetsrapporter. De momsdeklarationer och arbetsgivaranmälningar som ska ges under räkenskapsperioden utgör för de flesta bokföringsskyldiga den kvantitativt största och i praktiken viktigaste delen av dessa. Dessa och andra motsvarande rapporters tillförlitlighet och granskningsbarhet är viktig både med tanke på den bokföringsskyldigas löpande ekonomiförvaltning och med tanke på bekämpningen av grå ekonomi. Därför nämns de i bestämmelsen, utöver bokslutet. Trots att en fysisk person inte med stöd av undantagsbestämmelsen i 1 kap. 1 a § behöver upprätta bokslut, gäller kravet på verifieringskedjan i fråga om skattedeklarationer och andra rapporter till myndigheterna också fysiska personer. 
I detta moment avses sådan regelbunden rapportering till skatte- och andra myndigheter som är regelbunden och på förhand känd av den bokföringsskyldiga. Skyldigheten gäller också sådana lagstadgade rapporter som månatligen och varje år ska lämnas till försäkrings- och arbetspensionsanstalterna. Med tanke på rapporter som upprättats för särskilda ändamål kan verifieringskedjan å andra sidan i praktiken inte på förhand säkerställas på systemnivå, vilket innebär att dessa rapporter inte omfattas av bestämmelsen. 
Bokföringsskyldiga som bedriver affärsverksamhet i mer än ringa utsträckning måste ge momsdeklarationer och arbetsgivaranmälningar under räkenskapsperioden antingen månatligen eller i vissa fall kvartalsvis. Det krav som verifieringskedjan innebär för dessa rapporter betyder i praktiken att om man senare under perioden ändrar eller korrigerar sådana tidigare gjorda noteringar som redan lagts till grund för rapporter, måste detta göras med hjälp av en korrigeringsverifikation eller en tydlig anteckning så att verifieringskedjan inte bryts, både när det gäller den givna rapporten och det bokslut som upprättats på basis av den och den senare ändrade informationen samt övriga meddelanden och rapporter. Förfarandet behandlas nedan i samband med 7 § 2 mom. 
Till momentet har för tydlighetens skull fogats kravet att verifieringskedjan måste kunna följas i vardera riktningen, dvs. såväl från affärshändelsen, verifikationen och noteringen via bokslutet och myndighetsrapporterna som i motsatt riktning, så att det kan verifieras på vilka noteringar, verifikationer och affärshändelser en viss post eller rad i bokslutet eller i en enskild rapport är baserad. Det är inte möjligt att utföra en revision om bokföringssystemet inte är uppbyggt på detta sätt. 
Trots att den nya utformningen av bestämmelsen utvidgar kraven på verifieringskedjan kommer detta sannolikt inte att medföra några betydande extra kostnader för de bokföringsskyldiga. Också bokföringssystemen enligt de nuvarande bestämmelserna bör i praktiken uppfylla paragrafens krav, och efterlevnaden av dessa krav är en förutsättning för att bokföringen ska kunna granskas. 
7 §.Bokföringsmaterial. Rubriken för denna paragraf har getts en mera allmän utformning som en del av strävandet att förtydliga kapitlets struktur och ge bestämmelserna en sådan utformning att de kan tillämpas som sådana, oberoende av hur bokföringen genomförs i tekniskt hänseende. 
I överensstämmelse med detta strävande har paragrafens 1 mom. utvidgats till en mera allmän bestämmelse enligt vilken allt bokföringsmaterial utan svårighet måste kunna granskas i läsbar form och vid behov skrivas ut, om det inte finns att tillgå i pappers- eller motsvarande form (t.ex. som pdf-filer). Detta gäller både material som ska behandlas under räkenskapsperioden och material som ska förvaras senare, inklusive verifikationer från den pågående räkenskapsperioden och sådana delbokföringar som inte ännu lagts till grund för noteringar i huvudbokföringen. Bestämmelsen gäller också materialets innehåll, men den ställer inga krav på den tekniska utformningen. 
Paragrafens 2 mom. har ändrats så att verifikationer, bokföringar och annat bokföringsmaterial inte får ändras innehållsmässigt eller utelämnas efter att bokslutet upprättats. Enligt momentets andra mening får ändringar eller utelämnanden inte heller göras efter att materialet lagts till grund för annan rapportering. Detta innebär att det inte längre är tillåtet att göra ändringar i bokföringsanteckningar efter sådan skattedeklaration som avses t.ex. i 6 § andra meningen. Detsamma gäller också t.ex. tiden efter att ett mellanbokslut upprättats samt den situationen att den bokföringsskyldiga har gett en utomstående tillgång till något annat motsvarande dokument som den bokföringsskyldiga upprättat på basis av materialet. Det är tillåtet att göra ändringar i bokföringsanteckningar och bokföringen till dess att bokslutet upprättats, om det inte varit nödvändigt att dessförinnan separat lämna en skattedeklaration eller någon annan rapport till myndigheterna. Detta motsvarar gällande praxis och 4 § 4 mom. och 5 § 6 mom. samt innehållet i det tredje kapitlet i ministeriebeslutet 47/1998 som utfärdats med stöd av lagen. En förutsättning är emellertid enligt 6 § att verifieringskedjans överensstämmelse säkerställs i det fall att ändringar eller korrigeringar görs. Omnämnandet om att en notering inte får göras otydlig har strukits på grund av att det är onödigt. Det är här fråga om en underkategori av ändringar i noteringarna. Innehållet i en verifikation som fåtts från en utomstående aktör får inte heller i fortsättningen egenmäktigt ändras under räkenskapsperioden. Det skulle i så fall vara fråga om en gärning som motsvarar urkundsförfalskning. Om innehållet i en verifikation som den bokföringsskyldiga själv upprättat ändras, kompletteras eller korrigeras under räkenskapsperioden, måste verifieringskedjan säkerställas i enlighet med 6 § om noteringar redan har gjorts på basis av verifikationen. Detsamma gäller situationer där innehållet i en verifikation som fåtts från en utomstående kompletteras genom den bokföringsskyldigas försorg eller om en felaktig verifikation som erhållits från en utomstående ersätts med en ny. Det måste alltid finnas en klar gräns mellan information som erhållits från en utomstående respektive informationsinnehållet i en verifikation som den bokföringsskyldiga själv har upprättat. 
Det gällande ministeriebeslutet 47/1998 gör skillnad mellan ursprungliga bokföringsanteckningar och rättelseanteckningar som gjorts efteråt men före bokslutet. Utgångspunkten är den att även om rättelser kan göras utan en separat verifikation måste de skilja sig från ursprungliga bokföringsnoteringar, vilket i praktiken är en förutsättning för att revision ska kunna göras redan under räkenskapsperioden. Detta krav förverkligas nu på ett mera heltäckande sätt i och med nya 6 §, eftersom verifieringskedjan ska förverkligas också i fråga om skattedeklarationer och övriga rapporter till myndigheterna. Om verksamhetens omfattning t.ex. förutsätter momsdeklarationer och arbetsgivaranmälningar under räkenskapsperioden är en förutsättning för att verifieringskedjan ska hålla också i fråga om redan givna rapporter, att eventuella senare ändringar och rättelser görs på ett så tydligt sätt att verifieringskedjan kan följas både från tidigare information till rapporter som givits på basis av den och även till sådana bokslut och rapporter till myndigheterna som upprättats senare på basis av den ändrade informationen. I fråga om bokföringsskyldiga vilkas verksamhet är så småskalig att de inte under räkenskapsperioden behöver lämna in skattedeklarationer eller arbetsgivaranmälningar, är också bokföringens omfattning i regel så anspråkslös att det inte finns något behov av revision under räkenskapsperioden. Eftersom enligt 4 § 4 mom. andra noteringar än sådana som är baserade på kontantbetalningar då får göras senast innan bokslutet upprättas, kan separata krav på rättelseanteckningar utelämnas ur lagen. 
Hänvisningen till verifikationernas och bokföringens innehåll innebär att det tekniska formatet för presentation och förvaring får ändras också efter att bokslutet upprättats. Detta är i praktiken ofta nödvändigt då filer konverteras till ett format som kan arkiveras, för att säkerställa att de så enkelt som möjligt kan tas fram i läsbar form. Detta är med ett undantag det förfarande som avses i 1 kap. 6 § i det gällande ministeriebeslutet 47/1998 samt bokföringsnämndens allmänna anvisning om bokföringsmetoder och bokföringsmaterial (1.2.2011). Undantag har utgjort sådana pappersverifikationer från utomstående som man fått spara som bildfiler, förutsatt att bilderna med undantag för färger har återgett också verifikationen på ett korrekt sätt. 
I och med att datatekniken och förfarandena utvecklats så att ett elektronisk dokumentformat synnerligen ofta kan väljas utan någon egentlig presentationsform, är det skäl att också i fråga om alla verifikat göra skillnad mellan sakinnehållet och utformningen. För tydlighetens skull föreskrivs i paragrafens nya 3 mom. att formatet för verifikationer, bokföring och annat bokföringsmaterial får ändras om detta är nödvändigt för behandlingen, överföringen eller förvaringen. Innehållet och verifieringskedjan måste då säkerställas. 
7 a §.Förteckning över bokföringar och material. I denna nya paragraf konstateras det att den bokföringsskyldiga ska ha en förteckning över bokföringarna och materialet, som till innehållet i stor utsträckning motsvarar balansboken enligt den gällande lagstiftningen. Denna förteckning ska tillsammans med kontoplanen som definieras i 2 § göra det möjligt för utomstående att effektivt utföra granskning och revision av bokföringen och bokföringsmaterialet. Av förteckningen ska framgå av vilka olika delar och material den bokföring som ligger till grund för bokslutet är sammanställd, sambandet mellan dem samt var och hur de förvaras och kan läsas. Denna förteckning fyller sålunda vid behov också myndigheternas informationsbehov och främjar sålunda bekämpningen av grå ekonomi. 
Förteckningen över bokföringar och material ska i enlighet med 10 § 1 mom. i detta kapitel förvaras i tio års tid, liksom bl.a. också bokslutet och kontoplanen. Att bifoga förteckningen till bokslutet på samma sätt som man gjort med de förteckningar och specifikationer som ingått i den tidigare balansboken, kommer också i fortsättningen att vara ett bra sätt att uppfylla detta krav. 
Ansvaret för förvaringen av förteckningen stämmer överens med ansvaret för bokslutet. En bestämmelse om saken behandlas nedan i samband med 3 kap. 7 a §. 
9 §.Förvaring av bokföringsmaterial. Paragrafens rubrik har getts en mera allmän utformning eftersom paragrafen gäller dels geografiska aspekter och dels också andra omständigheter som har att göra med förvaring. 
Paragrafens 1 mom. har ändrats så att enligt den inte längre krävs något särskilt tillstånd för att tillfälligt förvara bokföringsmaterial utomlands. I den nya utformningen konstateras det på ett mera allmänt plan att allt bokföringsmaterial ska förvaras omsorgsfullt och så att både revisorer och myndigheter utan onödigt dröjsmål ska ha tillgång till det i Finland. Momentet gäller förvaring både under räkenskapsperioden och därefter, inklusive sådana verifikationer och delbokföringar under den pågående räkenskapsperioden som inte ännu lagts till grund för noteringar i huvudbokföringen. 
Med stöd av ministeriebeslutet 49/1998 som utfärdats med stöd av bemyndigandet i det gällande momentet har förfarandet med tillfällig förvaring delvis begränsats till OECD-medlemsstaterna. Denna begränsning är i och med utvecklingen av molntjänsterna och datateknologin i övrigt inte längre praktisk och den faller bort i och med att ministeriebeslutet upphävs. I momentet understryks däremot att den bokföringsskyldiga ska se till att materialet förvaras omsorgsfullt, men i detta avseende uppställs inga geografiska begränsningar. 
Kravet i ministeriebeslutet 47/1998, som föreslås bli upphävt, att bokföringsmaterialet ska förvaras i två maskinläsbara datamedier eller servrar, har inte överförts till lagen. Numera finns det datatekniska lösningar, t.ex. versionerade och certifierade metoder baserade på säker molnteknologi, som gör det möjligt att uppnå motsvarande eller en avsevärt bättre säkerhetsnivå. 
Kravet att verifikationer, noteringar och övrigt material ska kunna granskas utan onödigt dröjsmål gäller material som behandlas och förvaras både under räkenskapsperioden och därefter. Dröjsmålsfrågan ska bedömas från fall till fall. Den pågående räkenskapsperiodens material finns ofta tillgängligt mer eller mindre i realtid, medan det kan ta några dagar innan man får tillgång till dokument som redan en längre tid har arkiverats i pappersform. Om en granskning i realtid inte är möjlig ska den bokföringsskyldiga ge myndigheten eller revisorn en motiverad förklaring till dröjsmålet och meddela när materialet blir tillgängligt. 
Det är också uppenbart att den bokföringsskyldiga inte kan slippa sina skyldigheter enbart genom att påstå att bokföringsmaterialet inte är tillgängligt t.ex. på grund av en flyttning eller på grund av att materialet har lämnats för förvaring till en utomstående som av ”oaktsamhet” förstört det. Den bokföringsskyldiga blir straffrättsligt ansvarig om han eller hon inte på ett trovärdigt sätt kan skingra misstanken att uppsåtligen ha undanskaffat bokföringsmaterialet. 
Momentet har betydelse för bekämpningen av grå ekonomi då det utan onödigt dröjsmål ger myndigheterna tillgång till bokföringsmaterial. Detta understryker det hot om påföljder enligt 8 kap. 4 § 1 mom. 3 punkten, som har utsträckts till att omfatta förvaringsskyldigheten i dess helhet. Det gällande hotet om påföljder gäller endast förvaring utomlands. 
I och med ändringarna i denna paragraf och i hela 2 kap. understryks den bokföringsskyldigas ansvar för att ordna bokföringen och förvaringen av materialet omsorgsfullt på en hållbar grund. I stället för att i detta kapitel eller i förordningen som är baserad på det föreskriva om tekniska detaljer, kan bokföringen i och med de nya bestämmelserna genomföras enligt kraven i en konkret situation och med beaktande av de datatekniska möjligheterna - förutsatt att lagens krav är uppfyllda. Kraven i detta kapitel ger i sin helhet både revisorerna och myndigheterna bättre möjligheter att på ett smidigt sätt utföra revision och granskning av bokföringar och material med beaktande av bekämpningen av grå ekonomi. 
En i rättspraxis allmän form av bokföringsbrott är att hela bokföringen saknas. Beroende på sammanhanget har detta ofta t.o.m. betraktats som en grov form av bokföringsbrott. Eftersom underlåtelse att iaktta bestämmelserna i denna paragraf i praktiken kan jämställas med att hela bokföringen eller en del av den saknas, understryker detta den bokföringsskyldigas eget ansvar för omsorgsfull förvaring av bokföringen. Det finns inte heller något behov av en detaljerad reglering av det tekniska genomförandet. En sådan reglering skulle vara ägnad att hindra eller åtminstone styra den framtida utvecklingen i en mindre flexibel riktning. Den bokföringsskyldigas ansvar för att ordna förvaringen på ett sakligt sätt understryks i den nya 7 a § som föreslås i 3 a kap. Enligt den föreslagna bestämmelsen innebär undertecknandet av bokslutet dels ansvar för dess innehåll och dels också ansvar för att bokslutet förvaras på vederbörligt sätt. 
Kravet att dra försorg om förvaringen uppfylls i fråga om bokslutet så att den bokföringsskyldiga sänder bokslutet till myndigheten för registrering. Såsom framhålls i den allmänna motiveringen är det önskvärt att myndigheternas datasystem utvecklas så att de bokföringsskyldiga om de så önskar kan ge in också annat material till registret för förvaring och på detta sätt uppfylla lagens krav. Detta förutsätter att registermyndighetens datasystem kan särskilja offentligt material från icke-offentligt samt ge behöriga användare tillgång till icke-offentliga filer. 
Paragrafens 2 mom. föreslås bli upphävt som obehövligt. Av föregående 8 § följer att också den tekniska förvaringsformen för en verifikation får ändras, vilket innebär att kopior får användas och förvaras utan något sådant särskilt bemyndigande som avses i det upphävda momentet. I enlighet med det gällande ministeriebeslutet 47/1998 och bokföringsnämndens allmänna anvisning 1.2.2011 tillämpas sedan länge metoden att skanna bokföringsskyldigas pappersverifikationer och överföra dem till bokföringssystemet som en bildfiler och därefter göra sig av med de ursprungliga pappersdokumenten. 
Paragrafens 3 mom. upphävs som onödigt eftersom det redan i det första momentet föreskrivs om kravet att bokföringar och material utan onödigt dröjsmål ska kunna läsas i Finland. 
Ministeriebeslutet 49/1998 som utfärdats med stöd av bemyndigandet i den gällande paragrafen upphävs då denna lagändring träder i kraft. 
10 §.Arkivering av bokföringsmaterial. Enligt paragrafens 1 mom. ska bokföringar förvaras i minst 10 år efter utgången av räkenskapsperioden. Motsvarande förvaringstid gäller för kontoplaner som avses i detta kapitels 2 § 2 mom., för förteckningar över bokföringar och material samt med stöd av hänvisningsbestämmelser också specifikationer till balansräkningen och till noterna (3 kap. 13 § 2 mom.) samt koncernbokslutets sammanställningsdokument (6 kap. 19 §). Skyldigheten att förvara själva bokslutet och verksamhetsberättelsen i anslutning till det är i den gällande lagen baserad på skyldigheten att förvara balansboken enligt 3 kap. 8 §, som föreslås bli upphävd. Av denna anledning har bokslutet och verksamhetsberättelsen fogats till de dokument som ska förvaras enligt denna paragraf. I syfte att förenhetliga terminologin talas inte heller i detta moment längre om bokföringsböcker utan om bokföringar. 
Avsikten är inte att ändra bestämmelsen om förvaringstiden. Bestämmelsen om förvaringssättet i det gällande momentet har ersatts med en hänvisning till detta kapitels 6, 7 och 9 § som i tillämpliga delar gäller också förvaring efter att bokslutet upprättats. 
I paragrafens 2 mom. föreskrivs om en minimiförvaringstid på sex år för räkenskapsperiodens verifikationer, affärskorrespondens och annat bokföringsmaterial än sådant som nämns i 1 mom. Också enligt mervärdesskattelagens 209 j § ska den skattskyldiga i minst sex år förvara kopior av fakturor över försäljning samt mottagna fakturor över inköp. Uttrycket ”korrespondensen om affärshändelserna” som används i momentet avser andra dokument i bokföringsmaterialet än verifikationer, bl.a. de beräkningar och själva deklarationerna som ligger till grund för arbetsgivar- och momsdeklarationer, såvida de inte redan är verifikationer som lagts till grund för noteringar. Skyldigheten att förvara sådana beräkningar och deklarationer kan i och för sig också härledas från hänvisningen i 6 §, eftersom verifieringskedjan till beskattningsgrunderna och övriga myndighetsrapporter bryts om deklarationerna inte förvaras. I bokföringsnämndens allmänna anvisning 1.2.2011 om bokföringsmetoder och bokföringsmaterial beskrivs affärskorrespondens på följande sätt: (punkt 4.2): 
” - - till korrespondensen om affärstransaktionerna hör övriga dokument som ska ingå i bokföringsmaterialet än verifikationerna. Till sådant material räknas exempelvis myndighetsanmälningar gjorda utgående från bokföringen (till exempel skattedeklarationer) samt anmälningar till sammanslutningar som sköter pensionsförsäkringar eller till övriga sammanslutningar och övriga anmälningar som görs med stöd i lagstiftningen. Protokollen från bolagsstämman och styrelsemöten är också korrespondens gällande affärstransaktionerna, om inga bokföringar görs utgående från dem. Om bokföringar görs utgående från dem hör de till verifikationerna. Till korrespondens gällande affärstransaktionerna räknas även till exempel den transferprisdokumentering som avses i lagen om beskattningsförfarandet [1558/1995] 14a och 14b.” 
Tidsfristen på sex år täcker emellertid inte alla situationer. För tydlighetens skull har momentet sålunda kompletterats med en allmän hänvisning till längre tidsfrister som eventuellt föreskrivs i annan lagstiftning. En sådan förlängning föreskrivs i mervärdesskattelagens 209 m § enligt vilken fakturor och verifikationer som anknyter till en fastighetsinvestering samt utredningar ska förvaras i 13 år från utgången av det kalenderår under vilket justeringsperioden har börjat. Efter den allmänna förvaringstiden på sex år för verifikationer kan fakturorna och verifikationerna dock ersättas med en utredning varav framgår de uppgifter som föreskrivs av skatteförvaltningen. Förvaringsskyldigheten omfattar dessutom entreprenadavtal, köpebrev och andra motsvarande dokument i anslutning till mervärdesbeskattningen. Bokföringsnämnden rekommenderar att utredningen och de övriga dokumenten förvaras i anknytning till de balansspecifikationer som avses i bokföringsförordningens 1 kap. 5 § (den allmänna anvisningen 6.5.2008 om bokföring av mervärdesskatt, punkt 3.6). Också i fråga om detta moment har bestämmelsen om förvaringssättet ersatts med en hänvisning till detta kapitels 6, 7 och 9 §, som i tillämpliga delar gäller också förvaring efter det att bokslutet upprättats. 
Den bokföringsskyldiga eller den som fortsätter verksamheten ska förvissa sig om att bokföringsmaterialet i sin helhet kan läsas också efter att den bokföringsskyldigas verksamhet upphört t.ex. på grund av konkurs. 
3 kap. Bokslut och verksamhetsberättelse
I 3 kap. finns grundläggande bestämmelser om publicering av bokslutshandlingar, dvs. om vilka delar bokslut och verksamhetsberättelser består av (1 och 1 a §). Vidare föreskrivs i kapitlet bl.a. om registeringsskyldighet och likaså om offentliggörande och kopior av bokslut (9 - 11 §). För att ett bokslut ska vara formellt giltigt måste det också dateras och undertecknas så som föreskrivs i 7 §. 
Dessa formella bestämmelser gäller också verksamhetsberättelsen som dock inte ingår i bokslutet. En kopia av en eventuell revisionsberättelse ska också fogas till bokslutet som registreras (12 §). 
I slutet av kapitlet föreskrivs också om specifikationer till balansräkningen och till noterna. Specifikationerna ska bekräfta bokslutet och verksamhetsberättelsen. De är inte offentliga och ska inte ges in för registrering (13 §). 
Kapitlets formbestämmelser är emellertid inte uttömmande. Bokföringsförordningen och den nya förordningen om uppgifter som ska tas upp i små- och mikroföretags bokslut innehåller scheman för resultaträkningen och balansräkningen av det slag som ingår i bokslutshandlingarna, varav framgår vilka benämningar som ska användas i dokumenten. I de nämnda förordningarna föreskrivs likaså om bokslutsnoter. 
Kapitlets bestämmelser gäller inte enbart formella omständigheter. Enligt kapitlets 2 § ska såväl bokslutet som verksamhetsberättelsen i första hand ge en rättvisande bild av verksamheten. Enligt nya 2 a § ska frågan om denna målsättning uppfylls bedömas med beaktande av väsentlighetsprincipen samt arten och omfattningen av verksamheten i fråga. 
I kapitlets 3 § sammanställs övriga allmänna bokslutsprinciper, exempelvis presumtionen om verksamhetens kontinuitet samt försiktighetsprincipen. I kapitlet definieras å andra sidan inte innebörden av bokslutsbegreppen och inte heller beräkningen av poster som ska tas upp i bokslutet. De bestämmelserna ingår i lagens 4 och 5 kap. 
1 §.Bokslutets innehåll. Paragrafens rubrik har förkortats för att motsvara avskiljandet av bestämmelserna om verksamhetsberättelsen till en separat bestämmelse. Enligt paragrafens 1 mom. ska den bokföringsskyldiga för varje avslutad räkenskapsperiod upprätta ett bokslut vari i enlighet med artikel 4.1 första stycket – liksom även i det förra fjärde direktivet (artikel 2.1 första stycket första meningen) – ska ingå ”- - balansräkning, resultaträkning och noter till de finansiella rapporterna.” Motsvarande bestämmelser finns i momentets 1, 2 och 4 punkt. 
Det andra stycket i den nämnda artikeln berättigar för sin del medlemsstaterna att kräva ”att andra företag än små företag tar med andra uppgifter i årsboksluten utöver de handlingar som anges i första stycket.” Någon sådan avgränsning gjordes inte i det fjärde direktivet (artikel 2.1 andra stycket) i fråga om små företag. 
Momentets 3 punkt är baserad på den nämnda medlemsstatsoptionen som förutsätter att i bokslutet ska tas in också en finansieringsanalys som beskriver anskaffningen och användningen av medel. Kravet på en finansieringsanalys gäller dock enbart storföretag som avses i 1 kap. 4 c §. Detta är en lättnad jämfört med det nuvarande rättsläget där skyldigheten att upprätta en finansieringsanalys enligt 3 mom. i denna paragraf gäller åtminstone publika aktiebolag samt sådana privata aktiebolag och andelslag som inte är bokföringsskyldiga enligt gällande 9 § 2 mom. Motsvarande undantag i fråga om upprättande av finansieringsanalyser för koncerner föreskrivs i 6 kap. 2 § 2 mom. för andra än stora koncerner. 
Enligt momentet är skyldigheten att upprätta bokslut ovillkorlig. Bokföringsnämnden understryker i sitt utlåtande 1770/2005 att bokslut inte får lämnas oupprättat på grund av eventuella brister i bokföringsmaterialet. De faktorer som avses i utlåtandet, dvs. att det inte finns verifikat över den väsentliga användningen av bolagets medel, att över utgiften inte kan uppgöras specificerat memorialverifikat som verifierar affärshändelsen, samt att uttaget av medel inte har bokförts som lön och att man av omständigheterna kan dra slutsatsen att kontantuttagen inte heller är avsedda som delägarlån – är av den naturen att de vid behov ska meddelas i noterna till bokslutet, för att bokslutet och verksamhetsberättelsen ska ge en enligt bokföringslagens 3 kap. 2 § 1 mom. riktig och tillräcklig bild av resultatet av den bokföringsskyldiges verksamhet samt av dennes ekonomiska ställning. 
Paragrafens 2 mom. stämmer överens med den gällande bestämmelsen. Momentets första mening motsvarar artikel 9.5 första meningen som lyder: ”För varje balans- och resultaträkningspost ska beloppet för det räkenskapsår som balans- eller resultaträkningen hänför sig till och beloppet för motsvarande post från föregående räkenskapsår anges.” Den andra meningen i artikeln anger för sin del medlemsstatsoptionen som lyder: ”Om dessa belopp inte är jämförbara får medlemsstaterna kräva att beloppet för föregående räkenskapsår justeras.” I momentets andra och tredje mening hänvisas till denna option. Sådana bestämmelser om jämförbara uppgifter ingår också i det fjärde direktivets artikel 4.4. 
Den nya utformningen av paragrafens 3 mom. är baserad på medlemsstatsoptionen i artikel 19.3 enligt vilken medlemsstaterna får undanta små företag från skyldigheten att utarbeta förvaltningsberättelser. 
Direktivet känner å andra sidan inte till begreppet finansieringsanalys, vilket innebär att bestämmelsen om skyldigheten att upprätta en sådan är helt nationell men enligt artikel 4.1 har Finland rätt att kräva en sådan, dock endast i fråga om andra företag än småföretag. Skyldigheten att upprätta båda dessa dokument gäller också sådana företag av allmän betydelse som avses i 1 kap. 11 §. 
Paragrafens 4 mom. upphävs som obehövligt i och med den ändring som föreslås i föregående moment. 
Paragrafens 5 och 6 mom. upphävs eftersom bestämmelserna om verksamhetsberättelse i syfte att förtydliga strukturen sammanställs i nya 1 a §. Bestämmelsernas materiella innehåll motsvarar de nuvarande normerna, eftersom det nya direktivet i detta avseende inte skiljer sig från det förra fjärde direktivet. 
Bestämmelser om verksamhetsberättelser finns i följande artiklar i direktivet: 
- Artikel 19.1 första stycket: ”Förvaltningsberättelsen [eng. management report]ska innehålla en rättvisande översikt (eng. fair review) över utvecklingen och resultatet av företagets verksamhet (development and performance of the undertaking´s business) och dess ställning (position), tillsammans med en beskrivning av de väsentliga risker och osäkerhetsfaktorer som det står inför. 
- Artikel 19.1 andra stycket: ” Översikten ska vara en balanserad och fullständig analys av utvecklingen och resultatet av företagets verksamhet och av dess ställning, i vilken hänsyn tas till verksamhetens storlek och komplexitet.” (eng. The review shall be a balanced and comprehensive analysis of the development and performance of the undertaking's business and of its position, consistent with the size and complexity of the business). 
- Artikel 19.1 tredje stycket första meningen: “ I den utsträckning som behövs för att förstå företagets utveckling, resultat eller ställning ska analysen innefatta både de finansiella och, där så är lämpligt, icke-finansiella centrala resultatindikatorer (eng. non-financial key performance indicators) som är relevanta för den aktuella verksamheten, inklusive information rörande miljö- och personalfrågor. ” 
- Artikel 19.2: ” Förvaltningsberättelsen ska även upplysa om a) företagets förväntade framtida utveckling, b) verksamhet inom forskning och utveckling, c) den information om förvärv av egna aktier eller andelar som föreskrivs i artikel 24.2 i direktiv 2012/30/EU.” 
- Artikel 24.2 i direktiv 2012/30/EU till vilken det hänvisas till ovan lyder: ”a) Skälen för de förvärv som har skett under räkenskapsåret. b) Antal och nominellt värde eller, i avsaknad av sådant värde, bokfört parivärde beträffande de aktier som har förvärvats och avyttrats under räkenskapsåret samt den andel av det tecknade kapitalet som dessa aktier utgör. c) Vid förvärv eller avyttring mot vederlag, uppgift om vederlaget för aktierna. d) Antal och nominellt värde eller, i avsaknad av sådant värde, bokfört parivärde beträffande samtliga aktier som har förvärvats och som innehas av bolaget samt den andel av det tecknade kapitalet som dessa aktier utgör. ” 
- Artikel 19.2 d: ”förekomsten av filialer till företaget, och” 
- Artikel 19.2 e: ”företagets användning av finansiella instrument och när det är väsentligt för bedömningen av dess tillgångar, skulder, ekonomiska ställning och resultat i) företagets mål och policy för hantering av finansiella risker, inklusive dess säkringspolicy för varje viktig typ av planerad transaktion där säkringsredovisning används, och ii) företagets exponering för prisrisk, kreditrisk, likviditetsrisk och kassaflödesrisk.” 
Paragrafens nya 4 mom. motsvarar artikel 4.2 första meningen som lyder: ”Årsbokslut ska upprättas på ett överskådligt sätt - -” och artikel 4.1 första stycket som lyder: ”Årsbokslutet ska utgöra en helhet - -”. Sådana bestämmelser finns också i fjärde direktivets artikel 2.1 första stycket andra meningen och artikel 2.2 första meningen. Momentets ordalydelse stämmer överens med den gällande bestämmelsen. 
1 a §.Verksamhetsberättelse. Denna nya paragraf innehåller på artiklarna 19.1 och 19.2 a - 19.2 e baserade bestämmelser om verksamhetsberättelse. De nämnda artiklarna behandlas ovan i samband med 1 § 5 och 6 mom. 
Medlemsstatsoptionen i artikel 19.3 om undantag för små företag i fråga om att upprätta verksamhetsberättelse återkommer i förordningen om uppgifter som ska tas upp i små- och mikroföretags beslut. Av denna anledning behöver motsvarande bestämmelse inte tas in här. 
Den nämnda artikeln lyder: ” Medlemsstaterna får undanta små företag från skyldigheten att utarbeta förvaltningsberättelser, under förutsättning att de kräver att den information som avses i artikel 24.2 i direktiv 2012/30/EU om företags förvärv av sina egna aktier eller andelar lämnas i noterna till den finansiella rapporten.” 
I artikel 19.4 ingår en medlemsstatsoption enligt vilken ”Medlemsstaterna får undanta små och medelstora företag från den skyldighet som avses i punkt 1 tredje stycket i den mån den avser icke-finansiell information” [dvs. information rörande miljö- och personalfrågor samt icke-finansiella centrala resultatindikatorer]. Eftersom småföretag i enlighet med artikel 19.3 helt och hållet undantas från skyldigheten att upprätta verksamhetsberättelse är denna artikel 19.4 inte relevant för dem. 
2 §.En rättvisande bild. Paragrafens 1 mom. motsvarar första meningen i den gällande bestämmelsen med ett sådant förtydligande att i momentet har strukits det överlappande begreppet ”riktiga och tillräckliga uppgifter”. Detta är i sak identiskt med en rättvisande bild, vilket innebär att ändringen endast är lagteknisk och att strykningen inte har någon betydelse för bokföringspraxis. Samma ändring föreslås i paragrafens rubrik. 
Momentet är baserat på artikel 4.3 första meningen enligt vilken ”Årsbokslutet ska ge rättvisade bild (eng. true and fair view) av företagets tillgångar, skulder, ekonomiska ställning och resultat” samt på artikel 19.1 första stycket där det föreskrivs att ”Förvaltningsberättelsen ska innehålla en rättvisande översikt (eng. fair review) över utvecklingen och resultatet av företagets verksamhet och dess ställning, tillsammans med en beskrivning av de väsentliga risker och osäkerhetsfaktorer som det står inför”. 
Liksom enligt den gällande bestämmelsen avser skyldigheten att ge en rättvisande bild både bokslutet och verksamhetsberättelsen eftersom det i artikel 34.1 första stycket punkt a i förutsätts samstämmighet mellan dessa dokument, dvs. ”- - revisorerna - - ska även uttala sig om huruvida förvaltningsberättelsen är konsistent med de finansiella rapporterna för samma räkenskapsår.” Revisorerna hade motsvarande skyldighet enligt det fjärde direktivets artikel 51.1 och det sjunde direktivets artikel 37.1 andra stycket. 
Enligt momentets nya ordalydelse ska avseende fästas uttryckligen vid omständigheter som är väsentliga för en rättvisande bild. Innebörden av begreppet väsentlig preciseras nedan i nya 2 a § 1 mom. på det sätt som förutsätts i artikel 2.16. 
Momentets informationsvärde har ökats också så att den som är bokföringsskyldig åläggs att beakta verksamhetens art och omfattning när det gäller att ge en rättvisande bild. Sålunda är t.ex. branschvisa skillnader av betydelse för uppfyllandet av informationsskyldigheten. Information om en omständighet som behövs för att ge en rättvisande bild t.ex. av ett byggföretag, har inte nödvändigtvis samma betydelse i fråga om ett kreditinstitut. 
Det har föreslagits att den gällande lagen ska ändras så att i fråga om den helhet som utgörs av bokslutet och verksamhetsberättelsen ska upphävas kravet att verksamhetsberättelsen ska ge en rättvisande bild av verksamheten. Ändringen är emellertid ägnat att fördunkla en praxis som utvecklats under flera decennier, då det med anledning av den nya utformningen blir nödvändigt att separat bedöma den rättvisande bild som bokslutet ger i egenskap av ett självständigt och fristående dokument, eftersom bedömningen enligt nuvarande praxis innebär en övergripande prövning av den information som ingår i såväl verksamhetsberättelsen som bokslutet. En sådan ändring skulle också bidra till ökad dubbelrapportering, eftersom samma information skulle tas in dels i bokslutet och dels i verksamhetsberättelsen. Dessutom skulle ändringen orsaka företagen onödiga kostnader då den nya bestämmelsen sätts i kraft. Förslaget har motiverats med att revisionen av verksamhetsberättelserna skulle ha blivit mera problematisk i och med att i dem i större utsträckning tas in också information som inte är av ekonomisk karaktär. Problematiken när det gäller granskningen av verksamhetsberättelsen har emellertid till sin karaktär i första hand samband med revisionslagen, där det föreskrivs om revisionsobjekten. Beslutsfattandet om hur ett dokument, exempelvis en verksamhetsberättelse, ska granskas och hurudant utlåtande som ska ges om granskningen är sålunda från lagberedningens synpunkt en revisionsrättslig fråga – inte en redovisningsrättslig fråga inom ramen för bokföringslagen. 
Från redovisningsrättslig synpunkt kan verksamhetsberättelsens innehåll utvecklas så att ekonomisk information och övrig (dvs. icke-ekonomisk) information i verksamhetsberättelsen behandlas som klart skilda element, vilket innebär att revisorerna lättare kan begränsa sitt utlåtande till att gälla t.ex. endast ekonomisk information som bygger på uppgifter som rapporteras i bokslutet och bokföringen. Den gällande revisionslagen ställer inga hinder för ett sådant förfarande. Bokföringsnämnden ska i samband med verkställigheten av bokföringslagens ändrade bestämmelser ge anvisningar om saken och förtydliga verksamhetsberättelsens uppbyggnad så att av den i fortsättningen tydligare framgår – exempelvis med hjälp av rubricering eller andra konstruktiva lösningar – en indelning i dels (i) i ekonomiskt material som är baserat på bokslutet och dels (ii) i annat, till sin karaktär närmast skriftligt material som lagstiftningen förutsätter och är baserat på de bokföringsskyldigas egen prövning och som inte har något direkt samband med bokslutet. På basis av det som anförs ovan föreslås inte någon ändring i lagens nuvarande uppbyggnad. 
Det i momentet använda begreppet ”ekonomisk ställning” inkluderar också begreppet ”tillgångar” (eng. assets) och ”skulder” (eng. liabilities) som används i artikel 4.3 första meningen. I det tidigare direktivets finskspråkiga version användes i stället för ”taloudellinen asema” termen ”rahoitusasema” och likaså det jämfört med ”velkoja” mer omfattande begreppet ”vastuut” (fjärde direktivets artikel 2.3). 
Paragrafens gammal 2 mom. upphävs. Enligt bestämmelsen får ministeriet genom förordning, med tanke på en rättvisande bild, avvika från bestämmelserna om bokslut och verksamhetsberättelse. Det finns inget behov av en sådan undantagsbestämmelse trots att artikel 4.4 andra stycket skulle tillåta den. För närvarande gäller inte heller någon undantagsförordning som är baserad på det nuvarande momentet. 
EU-kommissionen har i sitt tolkningsmeddelande (98/C 16/04 punkt 6, andra och tredje meningen) framhållit betydelsen av avhållsamhet vid den nationella tolkningen av artikel 4.4 andra stycket (fjärde direktivet artikel 2.5 tredje meningen och sjunde direktivet artikel 16.4 tredje meningen): ”För att främja en harmonisering av reglerna får medlemsstaterna emellertid inte - - införa allmänna redovisningsregler som strider mot direktivets bestämmelser och inte heller för att införa ytterligare valmöjligheter som tillåter redovisningsbehandlingar som inte är förenliga med direktivets bestämmelser.” 
Så som ovan framgår gäller för artikel 4.4 andra stycket ett snävt tillämpningsområde, vilket innebär att man kan stödja sig på det endast i sådana fall då direktivet inte innehåller någon uttrycklig bestämmelse om saken. Artikeln har nedan implementerats bl.a. i följande bestämmelser: 
- 5 kap. 2 § 1 mom. 3 punkten, skulder upptas till nominellt belopp eller, om skulden är bunden vid index eller någon annan jämförelsegrund, till det högre beloppet, och 
- 5 kap. 4 §, med avvikelse från den prestationsprincip som direktivet förutsätter får en prestation tas upp som intäkt på grund av tillverkningsgraden. Av motiveringen till detta lagrum framgår att EU-kommissionen i sitt ovan nämnda meddelande anser att en sådan avvikelse är tillåten. 
Till paragrafens 2 mom. har överförts andra meningen i nuvarande 1 mom. efter en språklig precisering för att i enlighet med artikel 4.3 andra meningen understryka skyldigheten att lämna ytterligare uppgifter. Den nämnda artikeln lyder: ”Om tillämpningen av detta direktiv inte räcker till för att ge en rättvisande bild av företagets tillgångar, skulder, ekonomiska ställning och resultat ska alla ytterligare upplysningar som är nödvändiga för att uppfylla detta krav lämnas i noterna till de finansiella rapporterna.”. Motsvarande skyldighet gällde enligt fjärde direktivets artikel 2.4 och sjunde direktivet artikel 16.4. Skyldigheten att lämna ytterligare upplysningar hade visserligen inte begränsats enbart till noterna. 
Den skyldighet som avses i momentet ska uppfyllas med beaktande av väsentlighetsprincipen som det föreskrivs om i följande 2 a §. Till bestämmelsen har för tydlighetens skull fogats en komplettering som avser detta. 
Paragrafens nya 3 mom. innehåller i överensstämmelse med artikel 4.4 första stycket ett undantag som innebär att en sådan bestämmelse inte ska tillämpas som i ett enskilt fall skulle äventyra möjligheten att ge en rättvisande bild. Det nämnda stycket i artikeln lyder: ” Om tillämpningen av en bestämmelse i detta direktiv undantagsvis är oförenlig [eng. is incompatible with] med den skyldighet som föreligger enligt punkt 3, ska avsteg göras från denna bestämmelse för att ge en rättvisande bild av företagets tillgångar, skulder, ekonomiska ställning och resultat. Varje sådant avsteg ska anges i noterna till de finansiella rapporterna med upplysning om skälen för avsteget och om den inverkan som detta har på uppgifterna om företagets tillgångar, skulder, ekonomiska ställning och resultat.” 
Motsvarande undantagsgrund ingår i det fjärde direktivets artikel 2.5 första meningen och i det sjunde direktivets artikel 16.4 första meningen. Motsvarande undantagsmöjlighet som enligt dessa artiklar förutsätter emellertid enligt gällande 2 mom. att det föreskrivs om saken i en ministerieförordning, så som konstateras ovan i motiveringen till det nämnda momentet. 
Av artikelns ordalydelse framgår att det endast i exceptionella fall (eng. in exceptional cases) över huvud taget kan bli fråga om att inte tillämpa bestämmelsen. Detta understryks i det nya momentet genom att som en förutsättning nämna att utan avvikelse skulle möjligheten att ge en rättvisande bild äventyras avsevärt. 
Eftersom det i bestämmelsen föreskrivs om en rättvisande bild gäller undantagsmöjligheten i första hand enskilda bestämmelser om uppgifter som ska framgå av bokslutet och verksamhetsberättelsen, t.ex. om ordningsföljden mellan posterna i resultaträknings- och balansräkningsscheman och om annan rapportering. I momentet utesluts å andra sidan de allmänna bokslutsprinciper gällande bl.a. värdering och periodisering som avses i 3 §, vilka ligger till grund för att ge en rättvisande bild. Avvikelse från dessa principer kan med stöd av 4 mom. i den nämnda paragrafen ske endast i det fall att detta förutsätts i någon annan lag eller bestämmelse. 
Den skillnad som avses ovan framgår av bokföringsnämndens utlåtande 1869/2011 som handlar om ett fall där den bokföringsskyldigas bransch omfattade bl.a. inköp av fordringar från andra företag och indrivning hos gäldenärer. Enligt nämndens avgörande kan sådana fordringar i balansräkningen redovisas som omsättningstillgångar medan de medel som drivits in i bokslutet ska redovisas som omsättningstillgångar, trots att fordringarna i princip enligt den redovisningsrättsliga systematiken hör till finansieringstillångarna och vinsterna och förlusterna i anknytning till dem ska redovisas som finansieringsintäkter. Som motivering för detta exceptionella förfarande anförde nämnden: ”Då utgångspunkten för upprättande av bokslutet är kravet på en rättvisande bild - - anser bokföringsnämnden att detta krav uppfylls i den situation som har beskrivits i ansökan där de indrivna fordringarna upptas i omsättningen och kostnaderna från denna verksamhet på motsvarande sätt upptas som kostnader i affärsverksamheten. Eftersom [kravet på en rättvisande bild är centralt] vid upprättande av bokslut ska det finnas ytterst vägande skäl till att förbigå [detta]. Nämnden anser det inte finnas sådana skäl i sökandes fall.” 
Undantaget gällde det sätt på vilket saken framställdes, men å andra sidan tillät nämnden inte att man avvek från principen om värdering skilt för sig eller i fråga om fordringsportföljen. Principen om värdering skilt för sig – som hör till de allmänna bokslutsprinciperna i 3 § – förutsätter att för varje fordran anges en anskaffningsutgift. I detta avseende är principen densamma oberoende av om de fordringar som förvärvats i samband med köp av fordringsportföljer behandlas som finansieringstillgångar eller omsättningstillgångar. Nämnden förutsatte också att i noterna tas upp uppgifter om behandlingen av fordringsportföljerna samt om ändringar i bokslutsprinciperna och ändringarnas inverkan och likaså om värderings- och periodiseringsprinciperna samt -metoderna. 
Paragrafens nya 4 mom. är baserat på safe harbour -bestämmelsen som gäller endast mikroföretag, dvs. artikel 36.4: ”För mikroföretag ska årsboklut som upprättas i enlighet med punkterna 1, 2 och 3 i den här artikeln anses ge en sådan rättvisande bild - -. ”Momentet hänvisar till förordningen om uppgifter som ska tas upp i små- och mikroföretags bokslut, där det föreskrivs närmare om saken, dels i fråga om bokföringsskyldiga som avses i direktivet och dels i fråga om övriga bokföringsskyldiga. 
På grund av den definition av mikroföretag som ingår i 1 kap. 4 b § 2 mom. sträcker sig denna undantagsmöjlighet inte till företag av allmän betydelse och inte heller till förvaltnings- eller investeringsföretag, trots att ett företag annars i fråga om storleken skulle motsvara definitionen av ett mikroföretag. 
2 a §.Väsentlighet som en allmän bokslutsprincip. Definitionen av begreppet väsentlighet i denna nya paragrafs 1 mom. baserar sig på artikel 2.16 som lyder: ” väsentlig: beskaffenheten på information som innebär att utelämnanden av eller felaktigheter i den rimligen kan förväntas [eng. could reasonably be expected to] påverka de beslut som användarna fattar på grundval av företagets finansiella rapporter. Bedömningen av hur väsentliga enskilda poster är ska göras mot bakgrund av andra liknande poster.” 
Artikelns andra mening har i direktivingressens punkt 17 tredje meningen preciserats på följande sätt ” Även om en enskild post kan betraktas som oväsentlig kan dock likartade oväsentliga poster betraktas som väsentliga när de ses som en helhet.” (eng. while a single item might be considered to be immaterial, immaterial items of similar nature might be considered to be material). 
I den gällande lagen föreskrivs inte om väsentlighetsprincipen, men den hör dock till de centrala principerna i vår bokföringspraxis och till den hänvisas upprepade gånger också i bokföringsnämndens ställningstaganden. Exempelvis utlåtande 1903/2013 ger med stöd av denna princip anvisningar om hur direkta skatter ska behandlas i bokföringen. 
Paragrafens 2 mom. motsvarar artikel 6.1 j: ” De krav som anges i detta direktiv när det gäller redovisning, värdering, utformning, upplysning och koncernredovisning [recognition, measurement, presentation, disclosure and consolidation] behöver inte uppfyllas om följderna av att uppfylla dem är oväsentliga.” I direktivingressens punkt 17 beskrivs principens betydelse på följande sätt: ” I enlighet med väsentlighetsprincipen får uppgifter som betraktas som oväsentliga till exempel sammanföras i redovisningen.”. I det fjärde och det sjunde direktivet saknades motsvarande bestämmelse om väsentlighetsprincipen. 
I artikel 6.1 j nämns som första möjlighet till undantag enligt väsentlighetsprincipen ”redovisning” (eng. recognition, fi. merkitsemistä, ty. Ansatz) som enligt finländsk redovisningsterminologi motsvarar periodisering av inkomster och utgifter mellan räkenskapsperioderna. En bestämmelse om saken ingår i 1 punkten. 
I momentets 2 punkt föreskrivs om värdering dels av tillgångsposter på aktivsida och dels av skuldposter på passivsidan, som i artikel 6.1 j kallas ”värdering” (eng. recognition, fi. arvonmäärittäminen, ty. Bewertung). 
Liksom enligt ovan nämnda artikel 6.1 j gäller 3 punkten ”utformning” (eng. presentation, fi. esittämistapa, ty. Darstellung). Till detta begrepp hör bl.a. bestämmelserna om hur posterna ska redovisas i resultaträkningen eller balansräkningen. 
Momentets punkt 4 ”upplysning” (eng. disclosure, fi. tilinpäätöksestä esitettävia tietoja, ty. Offenlegung) är också den baserad på artikel 6.1 j. Denna punkt omfattar bl.a. benämningarna på omständigheter som ska tas upp i resultaträkningen, balansräkningen eller noterna samt deras inbördes ordning. 
Den på artikel 6.1 j baserade 5 punkten om koncernredovisning (eng. konsolidation, finska koncernitilinpäätös, tyska Konsoliderung) gäller i första hand bestämmelser om beräkningstekniska konsolideringsåtgärder för upprättande av koncernbokslut. 
Väsentlighetsprincipen ingår inte i direktivets medlemsstatsoptioner, vilket innebär att den nämnda artikeln måste sättas i kraft nationellt. Artikel 6.4 tillåter begränsning av tillämpningsområdet ”- - till uppställning och upplysning.” Detta anges emellertid inte i momentet, eftersom gränsdragningen mot de övriga punkterna i artikel 6.1 i praktiken är svår. 
I momentet utsträcks väsentlighetsprincipen till att utöver bokslutet omfatta också upprättandet av verksamhetsberättelse. Bestämmelsen är baserad på artikel 6.1 j som i och för sig gäller endast bokslutet, men av den engelska ordalydelsen i artikel 19.1 första punkten framgår att verksamhetsberättelsen ska vara allmän till sin karaktär eftersom det där förutsätts att den ska vara en ”fair review” trots att detta i det finskspråkiga direktivet har översatts med ”oikean kuvan antava selostus” och på svenska ”en rättvisande översikt”. 
Direktivet tar inte ställning till det inbördes förhållandet mellan bokslutet och verksamhetsberättelsen på annat sätt än att de förutsätts vara konsistenta till innehållet (artikel 34.1 andra stycket punkt a i). Enligt artikel 4.1 andra punkten får medlemsstaterna emellertid kräva att andra företag än små företag tar med andra uppgifter i årsbokslutet utöver balansräkning, resultaträkning och noter till de finansiella rapporterna. Det är sålunda möjligt att nationellt förutsätta att verksamhetsberättelsen tas in i bokslutet, vilket också innebär att det kommer att omfattas av väsentlighetsprincipen enligt artikel 6.1 j. Det kan anses att detta förverkligas i 3 kap. 1 § 3 mom. enligt vilket verksamhetsberättelsen ska fogas till bokslutet. Förhållandet mellan bokslutet och verksamhetsberättelsen behandlas också ovan i samband med 2 §. 
Paragrafens 3 mom. hänvisar till 1 kap. 1 § enligt vilken bokföringen ska vara så fullständig att alla affärshändelser i respektive företag blir beaktade. I punkt 17 i direktivets ingress finns ett motsvarande uttalande: ”Väsentlighetsprincipen bör inte påverka eventuella nationella skyldigheter att upprätta fullständiga förteckningar över affärstransaktioner och ekonomisk ställning”. 
3 §.Övriga allmänna bokslutsprinciper. Ingressen i paragrafens 1 mom. har kompletterats med en hänvisning dels till 2 § om en rättvisande bild och dels till 2 a § om väsentlighetsprincipen, för att den bokföringsskyldiga ska kunna upprätta sitt bokslut och sin verksamhetsberättelse med iakttagande av de allmänna bokslutsprinciperna i denna paragraf. 
Momentets 1 punkt som motsvarar den gällande bestämmelsen är baserad på artikel 6.1 a: ”Företaget förutsätts fortsätta sin verksamhet”. Motsvarande bestämmelse fanns i det fjärde direktivets artikel 31.1 a. 
Kontinuitetsprincipen enligt denna punkt är betydelsefull då man när bokslutet och verksamhetsberättelsen upprättas inte vet när verksamheten kommer att upphörs. Detta framgår av bokföringsnämndens utlåtande 1883/2012 om ett fall där den bokföringsskyldiga hade för avsikt att sälja sin byggnad. I en sådan situation ger det verkliga försäljningspriset den bästa bilden av inkomstförväntningen. På motsvarande sätt ska man förfara när bokslut upprättas i en konkurssituation, då värderingen av tillgångsposterna ska baseras på det förväntade realiseringspriset. 
I konkursombudsmannens rekommendation 10/2004 som gäller ett konkursbos bokföring och revision anförs det att intäkterna i konkursbon som inte idkar någon rörelse ” skall specificeras åtminstone i bestående aktiva (anläggningstillgångar) och rörliga aktiva (omsättningstillgångar), intäkter från realisering av egendom samt intäkter från indrivning av fordringar och rörelseintäkter, när boet fortsätter rörelsen samt i ränte- och hyresintäkter samt övriga intäkter” (punkt 1.2.1). 
Momentets 2 punkt motsvarar den gällande bestämmelsen och artikel 6.1 b: ”Redovisningsprinciper och värderingsgrunder ska tillämpas konsekvent från ett räkenskapsår till ett annat” [eng. accounting policies and measurement bases]. Motsvarande bestämmelse om värderingsmetoder ingick i det fjärde direktivet (artikel 31.1. b) och om konsolideringsprinciper i det sjunde direktivet (artikel 25.1). 
Konsekvens (eng. consistency) innebär kontinuerliga procedurval, dvs. i samband med upprättandet av bokslut ska fattas konsekventa beslut om volymer, mätning, värdering och upptagande från en räkenskapsperiod till en annan. Detta utgör en grund för jämförbarheten mellan ett enskilt företags olika bokslut. Principer och metoder kan bytas ut endast av grundad anledning, för att främja en rättvisande bild av verksamheten. 
Till åtskillnad från artikeln inskränker sig denna punkt i fråga om metoderna inte enbart till värderingsgrunderna. Det är emellertid ändamålsenligt att bestämmelserna i fråga om värderingen täcker också andra procedurmässiga lösningar. 
Momentets 2 a punkt som inte har ändrats är baserad på artikel 6.1 h ”Poster i resultat- och balansräkningarna ska redovisas och presenteras med beaktande av den ekonomiska innebörden av transaktionen eller överenskommelsen i fråga”. Artikel 6.3 innebär att man nationellt får göra undantag från detta krav: ”Medlemsstaterna får undanta företag från kraven i punkt 1 h.” Det har inte ansetts finnas något behov att implementera denna medlemsstatsoption i Finland och bestämmelsen har därför hållits kvar i lagen. Motsvarande bestämmelser fanns också i det fjärde direktivets artikel 4.6. 
Den juridiska formen är emellertid det primära kriteriet, vilket framgår t.ex. av bokföringsnämndens utlåtande 1882/2012. Utlåtandet avser ett i bilhandeln sedvanligt finansieringsarrangemang som innebär att handelsmannen säljer sina fordon till ett finansieringsbolag eller en annan finansiär och av denna får rätt att sälja dem. Trots att det vid sådan försäljning är fråga om att överlämna en säkerhet till finansiären, ansåg nämnden att inte ens en del av anskaffningsutgiften för ett fordon som har sålts vidare till finansiären kan upptas i handelsmannens omsättningstillgångar, eftersom de sålda fordonen inte längre är handelsmannens egendom t.ex. i det fall att handelsmannen blir insolvent. 
Momentets gällande 3 punkt är baserad på artikel 6.1 c första meningen ”Redovisning och värdering ska ske med iakttagande av rimlig försiktighet”. Motsvarande bestämmelse om värdering ingick också i det fjärde direktivets artikel 31.1 c. I den gällande bestämmelsen ställs försiktigheten i proportion till räkenskapsperiodens resultat. Denna precisering förtydligar syftet med artikeln och kan således hållas kvar i bestämmelsen. 
Momentets gällande 4 punkt behöver inte ändras eftersom den stämmer överens med artikeln 6.1 e och med artikel 31.1 f i det tidigare fjärde direktivet: ”Den ingående balansen för varje räkenskapsår ska stämma överens med närmast föregående räkenskapsårs utgående balans”. 
Denna s.k. balanskontinuitetsprincip är emellertid inte ovillkorlig. Liksom enligt IFRS-standarderna hör det till god bokföringssed att balanskontinuiteten inte hindrar t.ex. rättelse av väsentliga fel som hänför sig till en tidigare räkenskapsperiod – då felet upptäcks först senare – så att det egna kapitalet krediteras eller debiteras. Såsom framgår av bokföringsnämndens ställningstagande 1750/2005 ska tidigare fel sålunda inte under den pågående räkenskapsperioden tas upp i resultaträkningen som vinst eller förlust. Detsamma gäller beaktande av ändringar i beräkningsmetoden enligt 2 punkten. 
Momentets 5 punkt motsvarar vad som i artikel 6.1 d föreskrivs om prestationsprincipen: ”Belopp som redovisas i balansräkningen och resultaträkningen ska beräknas enligt periodiseringsprincipen” (eng. computed on the accrual basis). Ordalydelsen i denna punkt – som motsvarar artikel 31.1 d i det tidigare fjärde direktivet – har annars behållits oförändrad, men till slutet av punkten har fogats den förtydligande termen ”prestationsprincipen” för att av punkten ska framgå definitionen av detta centrala bokslutsbegrepp. 
Prestationsprincipen innebär att en affärshändelse ska tas upp i bokföringen det datum då den bokföringsskyldiga har levererat tillgången. Vid en anskaffning är det på motsvarande sätt fråga om den dag då den bokföringsskyldiga själv tar emot en produktionsfaktor, en produkt eller en tjänst. 
När det gäller den löpande bokföringen under räkenskapsperioden är prestationsprincipen inte det enda alternativet: enligt 2 kap. 3 § 2 mom. är också kontantprincipen och faktureringsprincipen tillåtna alternativ. Om bokföringen under en räkenskapsperiod sköts i enlighet med kontantprincipen ska en inkomst tas upp i bokföringen den dag då betalningen för en tillgång som den bokföringsskyldiga sålt till kunden kommer in på den bokföringsskyldigas bankkonto eller till kassan. Om bokföringen är baserad på kontantprincipen ska en utgift noteras den dag då betalningen för en köpt produktionsfaktor går ut från den bokföringsskyldigas bankkonto eller kontantkassa. 
I enlighet med prestationsprincipen förutsätts det i detta kapitels 4 § att noteringar som gjorts enligt kontantprincipen rättas och kompletteras i samband med att bokslutet upprättas enligt prestationsprincipen. Såsom framgår av bokföringsnämndens ställningstagande 1894/2012 skiljer sig dessa principer från varandra endast i fråga om tidpunkten då en affärshändelse ska tas upp i bokföringen. Detta val inverkar däremot inte på periodiseringen av inkomsterna och utgifterna och inte heller på värderingen av tillgångsposterna. 
I praktiken förs bokföringen under räkenskapsperioden ofta utgående från faktureringen, dvs. enligt faktureringsprincipen, som är en mellanform mellan kontant- och prestationsprincipen. Prestationsprincipen innebär att en inkomst ska tas upp det datum då den bokföringsskyldiga har upprättat och sänt fakturan till sin kund för en tillgång som denna köpt. Tidpunkt kan infalla före eller efter överlåtelsen av tillgången, liksom även mottagandet av betalningen. På motsvarande sätt ska en utgift i det fall att bokföringen är baserad på faktureringsprincipen noteras det datum då leverantören av den köpta varan eller tjänsten har upprättat fakturan. 
Faktureringsprincipen är tillåten enligt mervärdesskattelagen (1501/1993). Enligt lagens 136 § 6 mom. första meningen får under räkenskapsperioden ”skatt hänföras till den kalendermånad under vilken köparen har debiterats för den levererade varan eller den utförda tjänsten” och på motsvarande sätt enligt 142 § 1 mom. första meningen får under en räkenskapsperiod ”ett avdrag som - - hör till räkenskapsperioden hänföras till den kalendermånad under vilken den som är berättigad till avdraget har debiterats för den levererade varan eller den utförda tjänsten.” 
Efter räkenskapsperioden ska i fråga om mervärdesbeskattningen tillämpas prestationsprincipen om det inte är fråga om en bokföringsskyldig som får upprätta bokslut enligt kontantprincipen. Mervärdesskattelagens 137 § 1 mom. lyder: ”En skattskyldig som bokföringslagen inte tillämpas på eller som enligt den lagen har rätt att upprätta ett bokslut enligt betalningsprincipen får -- hänföra skatt på försäljning till den kalendermånad under vilken försäljningspriset eller en del av det har influtit” och på motsvarande sätt 143 § 1 mom.: ”En skattskyldig - - får - - hänföra avdraget till den kalendermånad under vilken inköpspriset eller en del av det har betalts”. 
Eftersom tillämpningen av faktureringsprincipen är baserad på mervärdesskattelagen kan tillämpningen av denna princip inte anses strida mot god bokföringssed. Den har sålunda också tidigare fått tillämpas i löpande bokföring utan någon egentlig bestämmelse. I 2 kap. 3 § 2 mom. har nu tagits in en uttrycklig bestämmelse om saken. 
Faktureringsprincipen har å andra sidan inte nämnts som en redovisningsprincip i lagen och inte heller direktivet känner till denna princip. Den nya väsentlighetsprincipen i 2 a § i detta kapitel blir sålunda relevant när man överväger vilka rättelser och vilken kompletterande information som behövs för att i ett bokslut som är baserat på prestationsprincipen ge en rättvisande bild enligt 2 §. Några rättelser behövs inte då faktureringsprincipen inte har någon väsentlig inverkan på räkenskapsperiodens resultat, jämfört med att prestationsprincipen hade tillämpats som sådan. Då skulle eventuella rättelser inte inverka på möjligheten att med ledning av bokslutet ge en rättvisande bild. Vid tillämpning av faktureringsprincipen måsta man emellertid alltid vara konsekvent på det sätt som avses i 1 punkten i detta moment. Exempelvis i fråga om varuhandel måste inköp, försäljningar och aktiveringar av omsättningstillgångar med tanke på konsekvensen framgår av bokslutet på motsvarande sätt. En bokföringsnotering som görs i enlighet med faktureringsprincipen ska på samma sätt som en notering enligt prestationsprincipen baseras på en reell affärshändelse, inte på ett artificiellt arrangemang. 
Gällande 4 § i detta kapitel tillåter å andra sidan att alla bokföringsskyldiga i fråga om smärre affärshändelser tillämpar kontantprincipen i sin bokföring, men för bokföringsskyldiga som idkar lantbruk är det tillåtet att tillämpa kontantprincipen i fråga om alla affärshändelser, oberoende av deras storlek. Bokföringsnämnden har i sitt ovan nämnda utlåtande 1894/2012 gett lantbruksidkare följande anvisningar om upprättande av bokslut enligt kontantprincipen: 
- ” Eftersom det avgörande vid tillämpning av kontantprincipen inte är mottagande av produktionsfaktor utan betalningstidpunkten, betyder det att produktionsfaktorer som har köpts på skuld överhuvudtaget inte upptas i bokföringen förrän de har betalats. Därmed upptas skulder som härrör från dessa inte heller i huvudbokföringen. Motsvarande gäller för försäljning på kredit och fordringar i anknytning till detta. Vid användning av kontantprincipen ska därför leverantörsskulderna och kundfordringarna fortlöpande kunna utredas utanför huvudboken såsom anges i BokfL 2:3.2 §. Detta kan skötas till exempel med en reskontra som används som en separat parallell bokföring. Användning av kontantprincipen som bokföringsgrund gäller såväl löpande utgifter som också anskaffningar av bestående aktiva. Därmed ska omsättningstillgångar eller bestående aktiva inte bokföras före betalningen vid användning av kontantprincipen.” 
- ” BokfL innehåller inga undantagsregler för lantbruksidkare gällande bokföring av anskaffningsutgiften på bestående aktiva samt rörliga aktiva i balansräkningen (kravet på aktivering), värdering samt periodisering. Därmed ska ett lantbruksaktiebolag värdera och periodisera dessa tillgångsposter enligt - - . Enligt det som har beskrivits här ovanför skiljer sig ett bokslut som har upprättats enligt kontantprincipen från ett bokslut som har upprättats enlig prestationsprincipen endast gällande tidpunkten då grunden för bokföringen och upptagande i bokslutet har uppstått; i stället för mottagnings- eller överlåtelsetidpunkten används betalningstidpunkten.” 
- ” Bokföringsnämnden anser att kontantprincipen i aktiebolag, även om verksamheten skulle vara idkande av lantbruk, som bokslutsprincip är en från det normala avvikande bokföringsgrund. Detta betyder att kontantprincipen och effekterna av principen separat ska beskrivas i bokslutsprinciperna för att bokslutet ska ge den rättvisande bild - -. För detta ändamål ska man som not till bokslutet uppta uppgifter om hur metoden har påverkat räkenskapsperiodens resultat och den ekonomiska ställningen. De leverantörsskulder och kundfordringar som beror på kontantprincipen och inte har upptagits i balansräkningen ska dessutom upptas som not. Likaså ska förändringar i omsättningstillgångarna samt bestående aktiva till följd av att kontantprincipen har använts upptas som not i det fall då denna information är väsentlig för den som läser bokslutet.” 
När man förfar enligt bokföringsnämndens anvisningar innehåller ett bokslut enligt kontantprincipen motsvarande information som om det upprättats enligt prestationsprincipen. 
Med beaktande av de ovan nämnda bestämmelserna i mervärdesskattelagens 137 § 1 mom. och 143 § 1 mom., som gör det möjligt att tillämpa kontantprincipen vid mervärdesbeskattningen under förutsättning att den skattskyldiga enligt bokföringslagen har rätt att upprätta bokslut enligt kontantprincipen, är det ändamålsenligt att tillåta detta alternativ för föreningar och stiftelser som inte hör till tillämpningsområdet för direktivet. Nedan i 4 § föreskrivs om utvidgning av tillämpningsområdet. 
En sådan utvidgning är också förenlig med EU-rådets s.k. faktureringsdirektiv 13.7.2010 (2010/45/EU - om ändring av direktiv 2006/112/EG om ett gemensamt system för mervärdesskatt vad gäller regler om fakturering) i 4 punkten i direktivets ingress konstateras följande: ” För att hjälpa små och medelstora företag som har svårt att betala mervärdesskatt till den behöriga myndigheten innan de har fått in betalningen från sina kunder, bör medlemsstaterna ha möjlighet att tillåta att mervärdesskatt redovisas enligt kontantmetoden [eng. cash accounting scheme], vilken möjliggör för leverantören och tillhandahållaren att betala mervärdesskatt till den behöriga myndigheten när denne får betalt för en leverans eller ett tillhandahållande, vilket också medför att avdragsrätten uppstår när denne betalar för en leverans eller ett tillhandahållande.” 
Momentets 6 punkt om separat värdering motsvarar den gällande bestämmelsen och är baserad på artikel 6.1 f: ”Tillgångs- och skuldposternas beståndsdelar ska värderas var för sig”. Artikel 31.1 e i det tidigare fjärde direktivet varav nästan samma lydelse (”Aktiv- och passivposternas beståndsdelar skall värderas var för sig.”). Ordalydelsen behöver justeras endast i lagtekniskt hänseende så att till punkten fogas ordet ”samt” eftersom en ny 7 punkt har fogats till momentet. 
Både omsättningstillgångar som avses i 4 kap. 4 § 1 mom. och finansieringstillgångar som avses i 2 mom. i samma paragraf ska med stöd av punkten värderas per tillgång så som närmare föreskrivs i 5 kap. Separat värdering är en central bokslutsprincip. Detta framgår av bokföringsnämndens utlåtande 1869/2011 till en bokföringsskyldig vars verksamhet går ut på att köpa fordringar från andra företag och driva in dem hos gäldenärerna. Nämnden tillät inte avvikelse från principen om separat värdering ens i fråga om fordringsportföljen. En förutsättning för värdering skilt för sig är att för varje fordran fastställs en anskaffningsutgift. Till denna del är principen densamma oberoende av om de fordringar som anskaffats i samband med inköp av fordringsportföljer behandlas som finansieringstillgångar eller omsättningstillgångar. Om de fordringar som ingår i portföljden inte har prissatts separat då de köptes, måste varje fordran anses vara värd skillnaden mellan det nominella värdet och anskaffningsutgiften för hela fordringsportföljen. 
Enligt utlåtandet 1725/2004 kan inte heller värdepapper som hör till placeringstillgångarna värderas som en helhet. Om aktier som hör till samma serie har anskaffats i flera poster behöver en nedskrivning i enlighet med 5 kap. 2 § 1 mom. 2 punkten inte göras då den underskrider priset vid bokslutstidpunkten, förutsatt att det sammanlagda anskaffningspriset för alla aktier i samma serier som den bokföringsskyldiga äger överskrider deras marknadsvärde vid bokslutstidpunkten.  
Också tillgångar som hör till bestående aktiva ska enligt 4 kap. 3 § värderas skilt för sig. Den bokföringsskyldiga ska sålunda upprätta en plan för avskrivningar enligt 5 kap. 5 § skilt för varje tillgång som kan förväntas generera inkomst under flera räkenskapsperioder på det sätt som avses i det nämnda lagrummet. Enligt bokföringsnämndens allmänna anvisning 16.10.2007 om avskrivningar enligt plan tillåts emellertid avvikelse med stöd av väsentlighetsprincipen. 
Momentets nya 7 punkt är baserad på artikel 6.1 g som lyder ”Kvittning får inte ske mellan tillgångs- och skuldposter eller mellan intäkts- och kostnadsposter”. Motsvarande kvittningsförbud ingick i artikel 7 i det tidigare fjärde direktivet som utsträckte förbudet också till intäkter och kostnader: ” Kvittning får inte ske mellan tillgångs- och skuldposter eller mellan intäkts- och kostnadsposter.” I kommissionens tolkningsmeddelande (98/C 16/04) förtydligas kvittningsförbudet på följande sätt (punkterna 8 och 9): 
- ”De kvittningssituationer som avses i artikel 7 bör inte sammanblandas med situationer där det redan finns en juridisk rätt att kvitta fordringar och skulder med stöd av lagen eller en kontraktsenlig överenskommelse. En omedelbar följd av den lagliga rätten till kvittning är att endast det återstående beloppet kan och skall tas upp i redovisningen.” 
- ”Det förekommer emellertid komplexa transaktioner där de ingående inkomsterna och utgifterna, ekonomiskt sett, inte har någon betydelse för det slutliga utfallet av transaktionen. Principen om en rättvisande bild skulle i vissa fall kräva att endast en slutliga resultatet av en komplex transaktion redovisas, dock måste varje situation bedömas på sina egna meriter.” 
I denna punkt implementeras också medlemsstatsoptionen i artikel 6.2 som lyder: ”Trots vad som sägs i punkt 1 g får medlemsstaterna i särskilda fall tillåta eller kräva att företag utför kvittning mellan tillgångs- och skuldposter eller mellan intäkts- och kostnadsposter, förutsatt att de belopp som kvittas anges som bruttobelopp i noterna till den finansiella rapporten. ”En sådan option saknades i det tidigare fjärde direktivet. 
Den ovan nämnda medlemsstatsoptionen i artikel 6.2 implementeras så att sammanställning tillåts då det är nödvändigt för att ge en sådan rättvisande bild som avses i 2 §. 
I bokföringsförordningens 1 kap. 10 § samt 2 kap. 2 § 1 mom. 5 a punkten föreskrivs att i enlighet med artikel 6.2 ska noterna ska innehålla de poster till bruttobelopp som sammanställs i resultaträkningen eller i balansräkningen. 
I 2 mom. som motsvarar den gällande bestämmelsen preciseras försiktighetsprincipen som föreskrivs i 1 mom. 3 punkten. Preciseringarna motsvarar direktivet. 
- Artikel 6.1 c i: ”endast per balansdag konstaterade intäkter får redovisas” (eng. profits made) – så också enligt de tidigare fjärde direktivets artikel 31.1 c aa. 
- Artikel 6.1 c ii: ”alla skulder som har uppkommit under det berörda räkenskapsåret eller under ett tidigare räkenskapsår ska redovisas, även om dessa skulder blir kända först efter balansdagen men före den dag då balansräkningen upprättas” (eng. all liabilities arising in the course of financial year concerned or in the course of previous financial year shall be recognised, even if such liabilities become apparent only between the balance sheet date and the date on which the balance sheet is drawn up). – En motsvarande bestämmelse ingick i det fjärde direktivets artikel 31.1 c bb. 
- artikel 6.1 c iii: ”alla negativa värdejusteringar ska redovisas, oavsett om resultatet för räkenskapsåret är en vinst eller en förlust” (eng. negative value adjustments) – Motsvarande bestämmelse ingick också i det fjärde direktivets artikel 31.1 c.cc. 
Försiktighet enligt momentet berättigar inte s.k. dolda reserver som uppkommer t.ex. genom att man i sin helhet kostnadsför anskaffade produktionsmedel på den räkenskapsperiod då anskaffningen skett, trots att produktionsmedlet väntas generera inkomst under flera räkenskapsperioder. Ett sådant förfarande äventyrar möjligheten att ge en rättvisande bild. 
Enligt den gällande lagen ska ”särskild” försiktighet iakttas i fem situationer: 
- periodisering av anskaffningsutgiften för andra immateriella tillgångar än rättigheter som förvärvats mot vederlag (5 kap. 5 a §), 
- periodisering av utvecklingsutgifter (5 kap. 8 §), 
- aktivering av kapitalrabatt och emissionsutgifter för lån (5 kap. 10), 
- uppskrivning (5 kap. 17 §), samt 
- latenta skatteskulder och skattefordringar (5 kap. 18 §). 
Eftersom det enligt direktivet inte finns någon grund för ”särskild” försiktighet och detta begrepp inte heller kan särskiljas från ”normal” försiktighet, som detta moment handlar om, har ordalydelserna i de ovan nämnda lagrummen ändrats så att i dem inte längre hänvisas till ”särskild” försiktighet. Denna ändring innebär inte någon lindring. Liksom för närvarande har den bokföringsskyldiga samma bevisbörda när det gäller iakttagande av försiktighet. Vid behov bekräftas detta genom att den bokföringsskyldiga till sitt bokföringsmaterial fogar beräkningar i form av memorialverifikationer. 
Paragrafens 3 mom. har preciserats i syfte att förtydliga förhållandet mellan momentet och nya 2 a § där det föreskrivs om väsentlighetsprincipen. Av ordalydelsen framgår att oväsentliga avvikelser med tanke på en rättvisande bild inte förutsätter någon annan grund än vad som föreskrivs i nämnda 2 a §. 
Den gällande bestämmelsens ordalydelse är baserad på artikel 31.2 i det tidigare fjärde direktivet: ”Avvikelser från dessa allmänna grunder kan undantagsvis accepteras. Redogörelse för en sådan avvikelse skall lämnas i en not med uppgift om skälen för avvikelsen samt en bedömning av dennas inverkan på tillgångarna, skulderna, den ekonomiska ställningen och resultatet.” 
Någon sådan uttrycklig undantagsbestämmelse finns inte längre i det gällande direktivet. Momentet kan emellertid hållas kvar i lagen eftersom det i tabellen i det sjunde direktivets bilaga i fråga om det tidigare direktivets artikel 31.2 hänvisas till det nuvarande direktivets artikel 4.4. Motsvarande bestämmelse ingår i 2 § 4 mom. där det föreskrivs om en rättvisande bild. I momentet upprepas möjligheten att avvika från principerna, förutsatt att det finns en laglig grund för en sådan avvikelse. Detta moment är sålunda strängare än nämnda 2 § 4 mom. Skillnaden är ändamålsenlig eftersom en avvikelse från bokslutsprinciperna har betydligt större återverkningar än i fråga om en sådan annan enskild bestämmelse som avses i 2 § 4 mom. 
Ett exempel på en sådan avvikelse som förutsätts i en annan bestämmelse är partiell inkomstföring enligt 5 kap. 14 §, som innebär att en inkomst redovisas som en intäkt redan på grund av tillverkningsgraden och inte först då slutprodukten överlåts, så som huvudregeln enligt prestationsprincipen i denna paragrafs 1 mom. 5 punkten förutsätter.  
4 §.Rättelse och komplettering av bokföring enligt fakturerings- och kontantprincipen. Den gällande bestämmelsen om kontantprincipen när det gäller bokslutet har förnyats. Paragrafens 1 mom. motsvarar den gällande bestämmelsen enligt vilken smärre noteringar som gäller affärshändelser inte behöver rättas och kompletteras enligt prestationsprincipen då bokslutet upprättas. Momentet har å andra sidan kompletterats med ett uttryckligt omnämnande om noteringar enligt faktureringsprincipen. En bestämmelse om sådana noteringar finns i 2 kap. 3 § 2 mom. 
I lagen och i bestämmelser på en lägre hierarkisk nivå anges inte vad som avses med ”smärre” i detta sammanhang. Bokföringsnämnden har inte heller yttrat sig om denna fråga. Med beaktande av att en rättvisande bild enligt nya 1 mom. i 3 § ska baseras på omfattningen av den bokföringsskyldigas verksamhet, har detta betydelse också i anslutning till bestämmelsen. Frågan om vad som avses med ”smärre” ska bedömas också utifrån den nya väsentlighetsprincipen i 2 a §: Information ska anses vara väsentlig då utelämnanden av eller felaktigheter i den rimligen kan förväntas påverka de beslut som användarna fattar på grundval av bokslutet och verksamhetsberättelsen. Då en omständighet i sig är oväsentlig ska väsentlighetsbedömningen inriktas på helheten, om flera liknande omständigheter föreligger. 
En skattemässig tolkning av begreppet smärre är inte bunden till bokföringsrätten. Mervärdesbeskattningen gäller inte smärre affärsverksamhet: Ett företag är inte skattskyldigt om dess omsättning uppgår till högst 8 500 euro. I momspraxis gäller dock en sträng tolkning, i synnerhet i fråga om hur inkomster kronologiskt hänförs enlighet med prestationsprincipen. 
Paragrafens nya 2 mom. innebär att stiftelser och föreningar som storleksmässigt hör till kategorin mikroföretag får upprätta bokslut enligt kontantprincipen. I och med denna utvidgning upphävs 1 mom. som generellt tillåter att lantbruksidkare upprättar bokslut enligt kontantprincipen, oberoende av i vilken företagsform verksamheten bedrivs. Eftersom också ett aktiebolag som idkar lantbruk hör till direktivets tillämpningsområde, står den gällande lagens undantag i fråga om sådana aktiebolag i strid med direktivet. 
Momentet innehåller en bestämmelse som går i samma riktning som bokföringsnämndens tidigare utlåtande 1894/2012 om sådana krav på noteringar vilkas syfte är att trygga överensstämmelsen mellan information enligt kontantprincipen och bokslut som upprättats enligt prestationsprincipen. Enligt 2 a § ska informationen inriktas på väsentliga omständigheter, vilket innebär att en sådan omständighet som avses i momentet inte behöver tas upp i noterna då omständigheten är oväsentlig för att ge en rättvisande bild av ett mikroföretags inkomster och ekonomiska ställning. 
Momentet är inte avsett att vara en uttömmande kravlista, vilket framgår av ordet ”åtminstone” före listan över noterna. Om någon annan omständighet än en sådan som avses i momentet är väsentlig ska den sålunda tas upp i en not. 
Enligt kontantprincipen är det med tanke på bokföringen inte avgörande när en produktionsfaktor tagits emot utan när den har betalats. Detta betyder att produktionsfaktorer som köpts på skuld inte ska noteras i bokföringen innan de har betalts, vilket framgår av bokföringsnämndens utlåtande 1894/2012. Sålunda ska inte heller skulder som är relaterade till dem noteras i huvudbokföringen. 
Motsvarande regel gäller för försäljning på kredit och därmed relaterade fordringar. Sålunda ska leverantörsskulder och kundfordringar enligt 2 kap. 3 § 2 mom. kontinuerligt kunna utredas utanför huvudbokföringen, t.ex. med hjälp av separat reskontra som sidobokföring. På denna grund förutsätts det i momentet att i noterna anges leverantörsskulder och kundfordringar som inte tagits upp i balansräkningen. 
Momentets undantagsbestämmelse är en option, inte en förpliktelse, för mikrostiftelser och -föreningar. Exempelvis i en stiftelse eller förening där leverantörsskulderna eller kundfordringarna utgör avsevärda belopp kan det vara ändamålsenligt att inte utnyttja denna undantagsmöjlighet och att upprätta bokslutet enligt prestationsprincipen på det sätt som föreskrivs i 3 § 1 mom. 5 punkten. Ju högre belopp det är fråga om desto besvärligare är det att sammanställa specifikationer till noterna. 
Tillämpningen av kontantprincipen som bokföringsgrund gäller på samma sätt löpande utgifter som anskaffning av omsättningstillgångar och bestående aktiva. Kontantprincipen innebär sålunda att omsättningstillgångar och bestående aktiva som förvärvats på kredit inte ska noteras innan de betalts. 
Momentet berättigar inte till avvikelse från lagens övriga bestämmelser. Sålunda ska t.ex. på upptagande (aktiveringsförpliktelser), värdering och periodisering av anskaffningsutgifter för produktionstillångar tillämpas bestämmelserna i 5 kap., oberoende av kontantprincipen. 
7 §.Datering och underskrift. Artikel 33.1 lyder: ” Medlemsstaterna ska se till att ledamöterna av ett företags förvaltnings-, lednings- och tillsynsorgan inom ramen för den behörighet som tillkommer dem enligt nationell lagstiftning kollektivt ansvarar för att säkerställa att a) årsbokslutet, förvaltningsberättelsen och, om den lämnas separat, företagsstyrningsrapporten, och b) koncernredovisningen, förvaltningsberättelsen för koncernen och, om den lämnas separat, företagsstyrningsrapporten för koncernen upprättas och offentliggörs i enlighet med kraven i detta direktiv och, i tillämpliga fall, med de internationella redovisningsstandarder som antagits i enlighet med [IAS-förordningen].” I det tidigare fjärde och sjunde direktivet föreskrivs om motsvarande solidariska ansvar (artiklarna 50 b och 36 b). 
I paragrafens 1 mom. ställs kravet att av underskriften ska framgå det ansvar som avses i artikeln. I 9 § finns en särskild bestämmelse om meddelandet till registermyndigheten för offentliggörande. Undertecknarna ska datera bokslutet och verksamhetsberättelsen den dag då de faktiskt undertecknas och inte t.ex. räkenskapsperiodens sista dag. 
Trots att skyldigheten enligt momentet gäller båda handlingarna, både bokslutet och verksamhetsberättelsen, behöver verksamhetsberättelsen inte undertecknas separat eftersom den utöver bokslutet ingår i den balansbok som avses i detta kapitels 8 §. 
En fysisk person kan dels utöva ett yrke ― bestämmelserna om bokföringen ingår då i 7 kap. ― och även affärsverksamhet i form av ett företag, dvs. en enskild rörelse. Den fysiska personen företräder rörelsen och vidtar rättshandlingar som berör den. Också en person som äger en enskild rörelse ansvarar för rörelsens åtaganden, trots att den egendom som används för verksamheten kan hållas åtskild från personens övriga tillgångar. En privat rörelse är inte heller en separat skattskyldig i förhållande till rörelseidkaren. Med beaktande av denna rättsliga status är det klart att uttryckligen rörelseidkaren personligen ska underteckna rörelsens bokslut och verksamhetsberättelse i den situation då de har upprättats. 
I ett öppet bolag undertecknas bokslutet av bolagsmännen som är personligen ansvariga för bolagets åtaganden. I ett kommanditbolag har de tysta bolagsmännen inte något sådant ansvar, och de är sålunda enligt lagen inte skyldiga att underteckna bokslutet. Denna skyldighet gäller endast de ansvariga bolagsmännen. Öppna bolag och kommanditbolag kan också välja styrelse. Styrelsen är då inte ett lagstadgat organ och den kan sålunda inte åsidosätta bolagsmännens och en eventuells verkställande direktörs rättigheter och skyldigheter när det gäller att sköta ärenden. Styrelsen kan följaktligen inte åläggas att underteckna bokslutet eller verksamhetsberättelsen. 
Om den bokföringsskyldiga är ett aktiebolag, ett andelslag, en förening eller någon annan motsvarande sammanslutning eller stiftelse krävs inte samtliga styrelseledamöters underskrift utan det räcker att bokslutet undertecknas av den behöriga och beslutföra styrelsen (regeringens proposition 173/1997). Beslutsförheten bestäms i enlighet med respektive bolagsordning eller stadgar. Styrelsen kan inte själv besluta om sin beslutförhet t.ex. genom att bemyndiga styrelseordföranden att underteckna bokslutet på sina vägnar (bokföringsnämndens utlåtande 36/1975). 
Samtliga styrelseledamöter ska emellertid alltid erbjudas möjlighet att underteckna bokslutet och verksamhetsberättelsen. Ingenting hindrar heller att bokslutet och verksamhetsberättelsen undertecknas också av en styrelseledamot som inte deltagit i det styrelsemöte som fattat beslut om bokslutet. 
Styrelsen, en styrelseledamot eller verkställande direktören har eventuellt bytts ut under räkenskapsperioden eller efter att den avslutats, men innan bokslutet och verksamhetsberättelsen upprättats. Bokslutet och verksamhetsberättelsen ska alltid undertecknas av styrelseledamöterna och verkställande direktören vid tidpunkten för undertecknandet. 
Då verkställande direktören sköter aktiebolagets eller andelslagets löpande förvaltning ska denna, utöver styrelsen, underteckna bokslutet och verksamhetsberättelsen. Detta är motiverat eftersom verkställande direktören ansvarar för bokföringens laglighet (6 kap. 17 § 1 mom. andra meningen i aktiebolagslagen och 6 kap. 17 § 1 mom. andra meningen i lagen om andelslag). Verkställande direktören är emellertid inte ett obligatoriskt organ i ett aktiebolag och inte heller i ett andelslag. Om någon verkställande direktör inte har valts är enbart styrelsen skyldig att underteckna bokslutet och verksamhetsberättelsen. 
En förening har ingen verkställande direktör. Enligt 35 § 1 mom. i föreningslagen (503/1989) ska styrelsen sköta föreningens angelägenheter och den ska också företräda styrelsen. Trots att föreningar i praktiken ofta har en person som kallas verkställande direktör, är denna inget lagstadgat organ och inte heller är det fråga om en person ”i motsvarande ställning” på det sätt som avses i momentet. Personen i fråga kan dock frivilligt ― utöver styrelsen ― underteckna bokslutet och verksamhetsberättelsen. 
Enligt huvudregeln i 10 § 1 mom. i lagen om stiftelser (109/1930) ska styrelsen sköta stiftelsens ärenden och företräda stiftelsen. Enligt 10 a § i lagen om stiftelser kan i stiftelsens stadgar bestämmas att den löpande förvaltningen ska ledas av en verkställande direktör eller en verksamhetsledare eller av en person i motsvarande ställning. Den som valts till denna uppgift är skyldig att i enlighet med momentet underteckna bokslutet och verksamhetsberättelsen. 
Om ett öppet bolag eller kommanditbolag har en verkställande direktör som inte är ansvarig bolagsman ska också denna underteckna bokslutet. Till åtskillnad från enskilda rörelser har verkställande direktören enligt lagen en allmän skyldighet att sköta bolagets löpande förvaltning (lagen om öppna bolag och kommanditbolag (389/1988) 2 kap. 4 §). 
Också en privat rörelse kan ha en verkställande direktör men dennas verksamhet är baserad på ställningsfullmakt och inte på lagstiftningen. Den som är verkställande direktör för en privat rörelse kan sålunda inte underteckna bokslutet eller verksamhetsberättelsen på ägarens vägnar. Verkställande direktörens ställningsfullmakt innebär inte heller en förpliktelse att underteckna bokslutet och verksamhetsberättelsen. 
I affärslivet är det vanligt att man anlitar en prokurist. Enligt prokuralagens (130/1979) 2 § 1 mom. får en prokurist i allt som gäller bedrivande av huvudmannens rörelse handla på huvudmanens vägnar och teckna hans firma. Denna generalfullmakt att företräda företag varken berättigar eller ålägger någon att underteckna bokslutet och verksamhetsberättelsen t.ex. i ett aktiebolag eller på huvudmannens vägnar. 
I 2 mom. som stämmer överens med den gällande bestämmelsen föreskrivs om beaktande av avvikande mening. En enskild medlem kan vara av en annan åsikt än den övriga styrelsen om vad som borde ingå i bokslutet eller verksamhetsberättelsen. En medlem som deltar i styrelsemötet som beslutar om bokslutet eller verksamhetsberättelsen är emellertid alltid skyldig att underteckna bokslutet och verksamhetsberättelsen. Medlemmen kan framföra avvikande mening om bokslutets eller verksamhetsberättelsens innehåll och yrka att ett yttrande om detta ska tas in i dokumentet. 
Bestämmelsen i detta moment är tvingande. Att få sin avvikande mening antecknad är styrelsemedlemmarnas subjektiva rätt och de övriga styrelsemedlemmarna kan inte framföra några krav i fråga om innehållet. Majoriteten kan inte ens kräva specificering eller motivering av en avvikande mening. Också verkställande direktören och andra som undertecknat bokslutet eller verksamhetsberättelsen har rätt att få sin avvikande mening antecknad i dokumentet i fråga.  
En avvikande mening ska i sin helhet tas in i bokslutet eller verksamhetsberättelsen och blir i likhet med dessa dokument också offentlig. Det räcker sålunda inte att i bokslutet eller verksamhetsberättelsen endast meddelas att en avvikande mening har framförts, utan att fullständigt återge dess innehåll. 
7 a §.Ansvar för bokslutet och verksamhetsberättelsen samt för förteckningen över bokföringar och material. Denna nya paragraf understryker tillika med målsättningen att bekämpa grå ekonomi också det ansvar som den bokföringsskyldigas styrelse och verkställande direktör har för förvaring av bokslutet och verksamhetsberättelsen tills de registreras i enlighet med 9 §. Om ingen registrering sker upphör styrelsemedlemmarnas och verkställande direktörens ansvar först efter den förvaringstid på 10 år som föreskrivs i 2 kap. 10 § 1 mom. 
I paragrafen hänvisas till lagarna om respektive bokföringsskyldiga juridiska personer. I fråga om aktiebolag avses aktiebolagslagen (624/2006), i vars 6 kap. 2 § 1 mom. andra meningen det föreskrivs att styrelsen svarar för att tillsynen över bolagets bokföring är ordnad på behörigt sätt. Då aktiebolaget har en verkställande direktör är denna med stöd av aktiebolagslagens 6 kap. 17 § 1 mom. andra meningen ansvarig för att bolagets löpande bokföring är lagenlig samt för tillsynen. Det är sålunda i första hand verkställande direktören som ansvarar för att bokföringen är lagenlig. Styrelsen ska då övervaka att verkställande direktören klarar denna uppgift. 
Styrelsens och verkställande direktörens inbördes ansvar för förvaringen av verksamhetsberättelsen och bokslutet enligt denna paragraf bestäms i aktiebolaget på det sätt som framgår av de ovan nämnda bestämmelserna i aktiebolagslagen. Detta ansvar sträcker sig likaså till förvaring av förteckningen över bokföringar och material enligt 2 kap. 7 a §. 
En fysisk person som i enlighet med nya 1 a § i 1 kap. är rörelseidkare eller yrkesutövare ansvarar med stöd av 2 kap. 10 § 3 mom. alltid för förvaringen av sitt bokslut och övrigt bokföringsmaterial, vilket innebär att det inte behövs någon bestämmelse om saken i denna paragraf. 
Associationslagstiftningen är inte uttömmande i fråga om straffansvaret. Detta framgår av högsta domstolens avgörande HD 2001:86 (omröstn.) där det framhålls att också bolagets faktiska verksamhet kan vara avgörande för vem som anses vara företrädare för den bokföringsskyldiga, dvs. att det har betydelse hur skötseln av bokföringen är ordnad i bolaget. Man kan sålunda inte slippa ansvar genom att åberopa avsaknad av formell ställning. 
8 §.Balansbok. Denna paragraf upphävs som en del av strävandet att förtydliga bokföringens uppbyggnad och upphäva bestämmelser som inte har någon faktisk självständig rättsverkan. De förteckningar över bokföringsböcker och olika slag av verifikationer som tidigare ingick i balansboken har ersatts med en sådan mera heltäckande förteckning över bokföringar och material som definieras i nya 7 a § i 2 kap. Den gällande lagens krav på en inbunden balansbok i pappersform, vars sidor eller uppslag ska vara numrerade, uppfyller i och med den datatekniska utvecklingen inte längre sitt ursprungliga syfte, dvs. att säkerställa bokslutets integritet som en helhet. Bestämmelsen har ersatts med de nya bestämmelserna i 2 kap. om säkerställande av verifieringskedjan via bokföringsprocesserna och förvaringen av material, oberoende av vilken databehandlingsteknik som används. 
9 §.Registrering av bokslut och verksamhetsberättelse. Enligt aktiebolagslagens 8 kap. 10 § ska aktiebolagen alltid, oberoende av hur omfattande deras affärsverksamhet är, göra registeranmälan om bokslutet och verksamhetsberättelsen. I 1 mom. 1 punkten som motsvarar den gällande bestämmelsen upprepas detta krav i enlighet med artikel 1.1. Enligt samma artikel omfattar den ovillkorliga registreringsskyldigheten dessutom sådana personbolag (öppna bolag och kommanditbolag) vars ansvariga bolagsman är ett aktiebolag eller ett personbolag av nämnda slag (2 och 3 punkten). Också denna bestämmelse är baserad på redovisningsdirektivets tillämpningsbestämmelser (artikel 1 andra stycket, punkt n). Motsvarande bestämmelser ingick i det tidigare fjärde respektive sjunde direktivet (artikel 1.1 första stycket och 1.1 andra stycket, punkt n samt artikel 4.1 n). 
Undantagna från registreringsskyldigheten är, i enlighet med bokföringsnämndens utlåtande 1538/1998, bostadsrättsföreningar, bostadsandelslag, bostadsaktiebolag och aktiebolag som avses i 2 § i lagen om bostadsaktiebolag, dvs. ömsesidiga fastighetsaktiebolag. 
Trots att direktivet inte gäller andelslag har det i Finland i synnerhet av konkurrensskäl ansetts ändamålsenligt att bokslutet och verksamhetsberättelsen i ett andelslag ska vara offentliga handlingar, på samma sätt som i aktiebolag. Detta är grunden för 4 punkten. Av motsvarande orsak, eftersom försäkringsbolag är aktiebolag och därför registreringsskyldiga, uppställs i 5 och 6 punkten samma skyldighet för ömsesidiga försäkringsbolag samt för försäkringsföreningar. 
Handelsregisterlagens 17 a § 1 mom. som är baserat på artikel 3 i Europeiska unionens filialdirektiv (89/666/EEG) ålägger utländska företags filialer att registrera sina bokslutshandlingar i Finland. I och med registreringen blir de offentliga i vårt land. Skyldigheten gäller ett utländskt företag som har grundat filial, om dess eget bokslut har upprättats, reviderats och offentliggjorts med iakttagande av Europeiska unionens lagstiftning eller på något motsvarande sätt. Till följd av dessa begränsningar gäller skyldigheten att upprätta och registrera ett separat bokslut i första hand företag som har grundats utanför EES-området. 
I paragrafens 2 mom. hänvisas till 1 kap. 4 a § där begreppet småföretag definieras. Balansräkningskriteriet stiger sålunda från den gällande bestämmelsens 3,65 miljoner euro till 6 miljoner euro, medan omsättningskriteriet stiger från 7,3 till 12 miljoner euro. Kriteriet på antal anställda förblir å andra sidan oförändrat, dvs. 50 personer räknat på räkenskapsperiodens genomsnitt. 
Till åtskillnad från den gällande bestämmelsen bedöms gränsöverskridningen enbart på basis av den senaste räkenskapsperioden. Detta beror på att småföretagsdefinitionen i artikel 3.2 som det hänvisas till som en grund för 1 kap. 4 a §, inte gör det möjligt att beakta räkenskapsperioden före den senast avslutade. I fråga om bestämmelserna om småföretag anger direktivet en maximigräns som medlemsstaterna inte får avvika från i sin nationella lagstiftning. 
Om en bokföringsskyldig som driver affärsverksamhet ska upprätta ett koncernbokslut, bedöms över- eller underskridandet av de gränser som avses i 2 mom. utifrån koncernbokslutet (3 mom.). I koncernbokslutet elimineras omsättningen mellan koncernföretagen och likaså deras inbördes fordringar och skulder. Sålunda behöver ett moderföretag vars egen omsättning och balansräkning överskrider de ovan nämnda gränserna i euro inte göra registeranmälan om sitt bokslut i det fall att gränserna efter elimineringen av de inbördes posterna underskrids i koncernbokslutet. 
Enligt huvudregeln ska registeranmälan göras om bokslutet och verksamhetsberättelsen inom sex månader efter räkenskapsperiodens utgång. Eftersom bokslutet och verksamhetsberättelsen enligt detta kapitels 6 § ska upprättas senast inom fyra månader från räkenskapsperiodens utgång, återstår minst två månader för registeranmälan. 
I vissa associationslagar finns det bestämmelser om en sådan kortare tidsfrist för registeranmälan som avses i detta moment. I aktiebolag och andelslag gäller en särskild tidsfrist på två månader efter att bokslutet fastställts (8 kap. 10 § 1 mom. i aktiebolagslagen och 8 kap. 10 § 1 mom. i lagen om andelslag). Bokslutet fastställs i aktiebolag av ordinarie bolagsstämman och i andelslag av den ordinarie stämman som ska hållas senast sex månader efter räkenskapsperiodens utgång (5 kap. 3 § 1 mom. i aktiebolagslagen och 5 kap. 4 § 1 mom. i lagen om andelslag). Sålunda ska i dessa företag göras registeranmälan om bokslutet och verksamhetsberättelsen senast åtta månader efter räkenskapsperiodens utgång. Denna tidsfrist kan dock ytterligare förlängas med högst tre månader (5 kap. 24 § i aktiebolagslagen och 5 kap. 26 § 2 mom. i lagen om andelslag). 
Den särskilda tidsfristen gäller, visserligen villkorligt, också finländska filialer till företag som är registrerade inom EES-området. I handelsregisterlagens 17 a § 1 mom. föreskrivs att ett utländskt företags bokslut, om det äger en filial, får anmälas för registrering i respektive EES-stat inom den stadgade tiden, om den är längre än sex månader. 
I 5 mom. hänvisas till registermyndighetens rätt att utfärda närmare föreskrifter om de förfaringssätt som ska iakttas när bokslutshandlingar lämnas i elektronisk form. En sådan föreskrift kan baseras på handelsregisterlagens 31 § 2 mom. som lyder: ”Föreskrifter om tekniska detaljer i anslutning till registerföringen, så som anmälningssätt och formen för offentliggörande av registeranteckningar, kan utfärdas genom registermyndighetens beslut” (regeringens proposition 193/2006). 
10 §.Offentliggörande av bokslut och verksamhetsberättelse. I handelsregisterlagen och handelsregisterförordningen (208/1979) föreskrivs om offentliggörande av bokslut och verksamhetsberättelsen som enligt 1 mom. givits in för registrering. Offentliggörandet hör till patent- och registerstyrelsens uppgifter. 
I artikel 30.1 första stycket föreskrivs följande om offentliggörande: ” Medlemsstaterna ska se till att företag inom en rimlig tidsperiod, som inte får överstiga 12 månader efter balansdagen, offentliggör det vederbörligen godkända årsbokslutet och förvaltningsberättelsen, tillsammans med det revisionsuttalande som lämnats av den lagstadgade revisor eller revisionsföretag som avses i artikel 34 i det här direktivet, enligt lagstiftningen i varje medlemsstat i enlighet med kapitel 2 i direktiv 2009/101/EG.” 
I artikel 30.3 första stycket föreskrivs dessutom ”[artikel 30.1] ska tillämpas på koncernredovisningar och förvaltningsberättelser för koncern.” 
Enligt artikel 30.5 första stycket i direktiv 2009/101/EG som det hänvisas till ovan ”- - handlingarna och uppgifterna ska offentliggöras i den av medlemsstaten utsedda nationella tidningen, antingen genom att de helt eller delvis återges eller genom hänvisning till den handling som tagits in i akten eller förts in i registret. Den utsedda nationella tidningen kan vara en tidning i elektronisk form.” 
I Finland är bokslut och verksamhetsberättelser offentliga för allmänheten på så sätt att enligt 1 § i handelsregisterlagen har envar rätt att få del av anteckningar som gjorts i handelsregistret samt av därtill hörande handlingar. Vem som helst har också rätt att få kopior av bokslut och verksamhetsberättelser som givits in till registret. Detta motsvarar artikel 30.2 andra stycket första meningen: ”Kopior av de finansiella rapporterna ska kunna erhållas på begäran.” Trots att ordalydelsen i meningen är begränsad till ”de finansiella rapporterna” ska den inte tolkas snävt eftersom artikel 2 f i direktiv 2009/101/EG omfattar alla ”redovisningshandlingar”, dvs. enligt artikel 30.1 första stycket också förvaltningsberättelsen och revisionsuttalandet. 
Patent- och registerstyrelsen ger kopior mot avgiftArtikel 3.4 tredje stycket i direktiv 2009/101/EG lyder: ”Priset för att få en kopia av sådana handlingar och uppgifter som avses i artikel 2 eller delar av den i pappersform eller i elektronisk form får inte överstiga den administrativa kostnaden.” Detta upprepas i det nya redovisningsdirektivets artikel 30.2 andra stycket andra meningen: ”Kostnaden för en sådan kopia får inte överstiga självkostnaden.” 
Bokslut och verksamhetsberättelser som givits in till handelsregistret ska registreras. En kungörelse om saken publiceras i Handelsregistertidningen. Genom skyldigheten att ge kopior och med denna kungörelse uppfylls offentlighetskravet enligt 2 kap. i direktiv 2009/101/EG. I enlighet med det nämnda direktivet kan bokslut och verksamhetsberättelser också i sin helhet publiceras i Officiella tidningen. Med beaktande av det stora antalet registreringsskyldiga kan detta emellertid inte anses vara ett ändamålsenligt alternativ i Finland. 
I lagen tas inte in den medlemsstatsoption som avses i artikel 30.1 andra stycket, som innebär att medlemsstaterna får undanta företag från registreringsskyldigheten. Medlemsstaterna får sålunda ”dock undanta företag från skyldigheten att offentliggöra förvaltningsberättelsen om en kopia av hela eller någon del av varje sådan förvaltningsberättelse enkelt kan erhållas på begäran till en kostnad som inte överstiger självkostnaden”. I artikel 30.3 första stycket föreskrivs dessutom ”artikel 30.1 ska tillämpas på - - förvaltningsberättelser för koncern.” Motsvarande möjligheter till undantag föreskrevs i det fjärde direktivet (artikel 47.1 andra stycket) och det sjunde direktivet (artikel 38.2). 
Medlemsstatsoptionen är inte ändamålsenlig i Finland eftersom utöver bokslutet också verksamhetsberättelsen ska läggas till grund för en rättvisande bild enligt 2 § 1 mom. i detta kapitel. Det skulle sålunda strida mot den nämnda målsättningen att i samband med offentlighetsförfarandet skilja åt dessa dokument från varandra. 
Förutom att ge in bokslutet för registrering enligt 9 § och sålunda för att offentliggöras, kan den bokföringsskyldiga själv publicera sitt bokslut. Detta konstateras i 2 mom. Offentliggörandet på det sätt som avses i bestämmelsen innebär att bokslutet görs tillgängligt för företagets referensgrupper, exempelvis ägare och anställda samt allmänheten (regeringens proposition 173/1997). Också till detta bokslut ska med stöd av 12 § 1 mom. i detta kapitel fogas en verksamhetsberättelse. Bestämmelsen är baserad på artikel 32.1 som lyder: ” Om årsbokslut och förvaltningsberättelse offentliggörs i sin helhet ska de återges i den form och text på grundval av vilka den lagstadgade revisorn eller revisionsföretaget har utarbetat sitt revisionsuttalande. De ska åtföljas av den fullständiga revisionsberättelsen.” Samma förpliktelse gäller också enligt det tidigare fjärde direktivet (artikel 48). 
Paragrafens 3 mom. enligt vilket bokslutet eller verksamhetsberättelsen får publiceras i sammandrag har preciserats i överensstämmelse med artikel 32.2. Artikeln lyder: ” Om årsbokslut inte offentliggörs i sin helhet ska det i den förkortade versionen av årsbokslutet, som inte ska åtföljas av revisionsberättelsen, 
a) anges att den offentliggjorda versionen är förkortad, 
b) göras en hänvisning till det register till vilket bokslutet har lämnats in i enlighet med artikel 3 i direktiv 2009/101/EG eller, om den finansiella rapporten ännu inte har lämnats in ska detta anges, 
c) anges om ett revisionsuttalande utan reservation, med reservation eller med avvikande mening avgetts av den lagstadgade revisorn eller revisionsföretaget, eller om den lagstadgade revisorn eller revisionsföretaget inte har kunnat avge något revisionsuttalande, 
d) anges om den lagstadgade revisorn eller revisionsföretaget i revisionsberättelsen särskilt fäst uppmärksamhet på något visst förhållande utan att det föranlett att revisionsuttalandet lämnats med reservation.” 
Liknande bestämmelser fanns i det fjärde direktivet (artikel 49) enligt vilket det också var förbjudet att foga revisionsberättelsen till en förkortad version av bokslutet: ”revisionsberättelsen behöver inte omfattas av det offentliggörande som här avses”. 
I och med revideringen av momentet överförs till det också bestämmelserna om revision från 12 § 2 mom. Det sist nämnda momentet upphävs sålunda som obehövligt. Det motsvarade inte heller artikel 32.2 eller det fjärde direktivets motsvarande artikel 49, då det enligt momentet lämnades beroende av den bokföringsskyldigas prövning om revisionsberättelsen skulle bifogas bokslutssammandraget eller inte, medan å andra sidan de nämnda artiklarna uttryckligen förbjuder detta. 
Den ovan nämnda artikeln 32.2 gäller endast en förkortad version av bokslutet (årsbokslutet). Liksom enligt den gällande bestämmelsen har de förpliktelser som avses i momentet nationellt utsträckts till att omfatta också offentliggörande av en förkortad verksamhetsberättelse. Detta strider inte mot direktivet och utvidgningen är ändamålsenlig med beaktande av att revisionsberättelsen och uttalandet enligt revisionslagen gäller också verksamhetsberättelsen. 
11 §.Skyldighet att ge kopior. De bokföringsskyldiga som räknas upp i paragrafens 1 mom., dvs. bostadsrättsföreningar, bostadsandelslag, bostadsaktiebolag och aktiebolag som avses i 28 kap. 2 § i lagen om bostadsaktiebolag (1599/2009) behöver inte iaktta det förfarande för registrering och offentliggörande av bokslut och verksamhetsberättelser som föreskrivs i detta kapitels 9 § 1 mom. och 10 §. Orsaken till att de undantas är i första hand praktisk eftersom dessa företag ― trots att de är många till antalet ― har en relativt liten ekonomisk betydelse jämfört med företag som bedriver affärsverksamhet (bokföringsnämndens utlåtande 1538/1998). Detta stämmer överens med EU-rätten eftersom den legislativa grunden för det nya direktivet enligt dess ingress är artikel 50.1 i fördraget om Europeiska unionens funktionssätt. I fördragets artikel 54 konstateras det att med ”bolag förstås bolag enligt civil- eller handelslagstiftning, inbegripet kooperativa sammanslutningar samt andra offentligrättsliga eller privaträttsliga juridiska personer, med undantag av sådana som inte drivs i vinstsyfte.” 
Sådana undantag som föreskrivs i momentet avser dock inte att dessa företags ekonomiska ställning inte ska vara offentlig, eftersom de är skyldiga att på begäran ge kopior av sina bokslut och verksamhetsberättelser. 
I företag som driver affärsverksamhet kan tiden mellan fastställandet av bokslutet och verksamhetsberättelsen respektive registeranmälan vara relativt lång, t.ex. i aktiebolag och andelslag t.o.m. över tre månader. För utomstående aktörer är det viktigt att få uppdaterad information om företagets ekonomiska ställning och resultat. För att en utomstående part ska få tillgång till information som baserar sig på bokslutet eller verksamhetsberättelsen redan innan dokumentet i fråga registrerats, åläggs i 2 mom. de bokföringsskyldiga som hör till den kategori av registreringsskyldiga som avses i detta kapitels 9 §, att på begäran ge kopior av sitt bokslut. 
I fråga om sådana bokföringsskyldiga anges i gällande 2 mom. en tidsmässig bakre gräns: när bokslutet och verksamhetsberättelsen har givits in för registrering behöver den bokföringsskyldiga inte längre ge någon kopia. Då offentliggörandet också enligt direktivet i första hand är en myndighetsåtgärd, behövs inte längre den överlappande skyldigheten att ge en kopia. 
Om begäran har gjorts före registreringsanmälan ska en kopia enligt den gällande bestämmelsen ges, men endast under förutsättning att det redan förflutit två veckor från det att bokslutet och verksamhetsberättelsen fastställts vid den bokföringsskyldigas bolagsstämma eller i något annat motsvarande organ. För en utomstående som behöver bokslutet kan ändamålsenligheten av denna tidsfrist dock ifrågasättas: en sådan utomstående behöver möjligast uppdaterad information om företagets resultat och ekonomiska ställning. Lagen anger inte heller motsvarande karenstid i fråga om bostadsbolag som avses i 1 mom., eftersom de ska ge kopia av sitt bokslut inom två veckor från det att begäran framförts. Av nämnda orsak har i momentet strukits bestämmelsen om två veckors karenstid. 
I direktiven föreskrivs inte heller inom vilken tid skyldigheten att ge kopia ska uppfyllas. I 3 mom. föreskrivs nationellt om en tidsfrist på två veckor. 
De bokföringsskyldiga åsamkas kostnader för att ge kopior, i praktiken för ljuskopiering. Lagen kräver inte att kopiorna ska ges gratis eftersom de bokföringsskyldiga i likhet med patent- och registerstyrelsen kan uppbära avgifter för andra kopior än de som ges till myndigheten. Bestämmelsens begränsning av avgiften ― ”högst lika stor som den som registermyndigheten uppbär för en motsvarande kopia” ― är baserad på den med föregående 11 § 1 mom. analoga artikeln 3.4 tredje stycket i direktiv 2009/101/EG, som lyder: ”Priset för att få en kopia - - får inte överstiga den administrativa kostnaden”. Denna bestämmelse upprepas i det nya bokslutsdirektivets artikel 30.2 andra stycket andra meningen, som lyder: ”Kostnaden för en sådan kopia får inte överstiga självkostnaden.” 
13 §.Specifikationer till balansräkningen och till noterna. Denna paragraf gäller sådana specifikationer till balansräkningen och noterna som inte hör till bokslutet och inte heller till verksamhetsberättelsen. Så som framgår av denna paragrafs 3 mom. omfattas de inte av lagens bestämmelser om registrering och offentliggörande. De hänförs inte heller till de bokslutshandlingar som avses i direktivet och i fråga om dem gäller sålunda inte begränsningen i artikel 4.1 andra stycket, enligt vilken medlemsstaterna får kräva att andra företag än små företag tar med andra uppgifter i årsboksluten utöver resultaträkningen, balansräkningen och noterna. 
I bokföringsförordningens 5 kap. 1 och 2 § föreskrivs närmare om innehållet i de specifikationer till balansräkningen till noterna som avses i 1 mom. Dessutom har bokföringsnämnden rekommenderat att principerna för värdering av fordringar som avses i 5 kap. 2 § 1 punkten ska inkluderas i specifikationerna till balansräkningen utöver att de dokumenteras i en verifikation som upprättas för bokföringen (utlåtande 1827/2008). 
Av paragrafens 2 mom. framgår att specifikationerna till balansräkningen och till noterna hör till bokföringsmaterialet, vilket innebär att förvaringstiden för dem i enlighet med 2 kap. 10 § 1 och 3 mom. är 10 år också i det fall att bokföringsskyldighet inte längre föreligger. I momentet har gjorts en sådan justering av paragrafhänvisningen att den inte avser 2 kap. 8 §, som föreslås bli upphävd, utan i stället de allmänna bestämmelserna i 2 kap. 7 § som innebär att bestämmelserna om förvaringen utsträcks också till specifikationerna på samma sätt som till övrigt bokföringsmaterial. 
I 3 mom. föreskrivs uttryckligen att undantag från registreringsskyldigheten indirekt framgår också av detta kapitels 1 och 9 § som gäller bokslutets innehåll och registrering. Specifikationerna till balansräkningen och noterna är sålunda inte offentliga. Det är emellertid möjligt att någon annanstans i lag ålägga bokföringsskyldiga att ge in också specifikationerna till registermyndigheten. En sådan bestämmelse finns i 13 § 2 mom. i stiftelselagen. 
4 kap. Definitioner i anslutning till bokslutsposter
En förutsättning för att bokslut ska vara sinsemellan jämförbara är att de uppgifter som lämnas av olika bokföringsskyldiga har beräknats på ett enhetligt sätt. I detta syfte sammanställs i 4 kap. definitionerna av resultaträkningens centrala benämningar, exempelvis omsättning (1 §). I syfte att genomföra det nya direktivet upphävs å andra sidan definitionen av begreppet extraordinära intäkter och kostnader i 2 § och därmed stryks begreppet extraordinära intäkter och kostnader också i de resultaträkningsscheman som avses i bokföringsförordningens 1 kap. 1 - 4 §. 
I fråga om balansräkningen definieras å ena sidan poster som ska tas upp bland bestående respektive rörliga aktiva (3 §). Den sist nämnda bestämmelsen kompletteras av 4 § 2 mom. om omsättningstillgångar och 4 § 3 mom. om finansieringstillgångar samt 6 § 1 mom. om resultatregleringar och 7 § 1 mom. om långfristiga fordringar och skulder. I 5 § 4 och 5 mom. ingår presumtionsbestämmelser om omsättningstillgångar av samma slag samt om värdepapper. 
Tillgångar som hör till såväl bestående som rörliga aktiva regleras i 5 § 1 mom. där det föreskrivs vilka poster som alltid ska hänföras till anskaffningsutgiften, samt i paragrafens 2 och 3 mom. om poster som, om den bokföringsskyldiga så önskar, också kan beakta i anskaffningsutgiften under de förutsättningar som anges i dessa lagrum. 
I fråga om passivsidans poster ingår i 7 § 2 mom. en motsvarande bestämmelse om indelningen i långfristiga respektive kortfristiga fordringar och skulder som i fråga om aktivsidan. Dessutom föreskrivs i kapitlets 5 § 2 mom. om resultatregleringar (passiva). 
1 §.Omsättning. Denna paragraf har ändrats i överensstämmelse med det nya direktivet. I artikel 2.5 som ligger till grund för paragrafen nämns inte så som i det tidigare fjärde direktivets artikel 28 att omsättningen ska omfatta ”bolagets normala verksamhet”. Gällande artikel 2.5 lyder: ” nettoomsättning: belopp som erhållits genom försäljning av varor och tillhandahållande av tjänster efter avdrag av försäljningsrabatter och mervärdesskatt samt andra skatter som direkt relateras till omsättningen.” (eng. net turnover). 
EU-kommissionens tolkningsmeddelande (98/C 16/04, punkt 23) preciserar definitionen i fråga om punktskatter: ” Uttrycket ’annan skatt som är direkt knuten till omsättningen’ inbegriper inte punktskatter. Till skillnad från mervärdesskatt som tas ut och återbetalas i varje förädlingsled, betalas en punktskatt vanligtvis endast en gång av producenten först när varan lämnar fabriken. Det är därför mest logiskt att betrakta punktskatt som en oskiljbar del av varans pris som av den anledningen alltid bör inkluderas i nettoomsättningen.”. 
Bokföringsnämnden har också gett en anvisning om behandling av skatter. Avgörandet i utlåtandet 2005/1761 lyder: ”Avfallsskatten liksom också övriga skatter av accisart, vilka inte direkt baserar sig på försäljningens belopp, räknas in i den bokföringsskyldiges omsättning och dras av som övriga rörelsekostnader när skatten betalas.” 
Trots att direktivet inte längre anger någon gräns för vad som hör till den normala verksamheten, är det ändamålsenligt att omsättningen inte omfattar finansiella intäkter samt intäkter från försäljning av tillgångar som hör till bestående aktiva och likaså affärsfunktioner. Detta motsvarar de internationella IFRS-standarderna. Intäkter från följande transaktioner tillhör omsättning: försäljning av varor, utförande av tjänsteuppdrag, och annans utnyttjande av ett företags tillgångar, som ger upphov till ränta, royalty eller utdelning. Varor är sådana som tillverkats av företaget i syfte att säljas och varor som köpts in för vidareförsäljning, såsom handelsvaror som köpts in av en detaljist eller mark och annan egendom som innehas för försäljning.2 §.Extraordinära intäkter och kostnader. Denna paragraf upphävs eftersom det i det nya direktivet inte finns någon definition som motsvarar artikel 29.1 i det tidigare fjärde direktivet. Den artikeln var av följande lydelse: ”Intäkter och kostnader från annat än bolagets normala verksamhet skall redovisas som ´extraordinära intäkter och kostnader´.” 
I EU-kommissionens tolkningsmeddelande om vissa artiklar i rådets fjärde och sjunde redovisningsdirektiv (98/C 16/04, punkt 26) gavs följande anvisning om extraordinära poster: ” Definitionen av extraordinära poster i direktivet hindrar inte att intäkter och kostnader endast i undantagsfall anges som extraordinära. Olika faktorer såsom företagets storlek och verksamhet måste beaktas vid klassificering av bokföringsposter. Om en post anges som extraordinär eller ej sammanhänger ofta med företagets storlek: ju större verksamhet desto oftare kan vissa händelser inträffa, vilket får till följd att det är mer korrekt att ange dem som ordinära poster.” 
I och med att paragrafen upphävs ska extraordinära intäkter och kostnader i regel i resultaträkningar enligt scheman i bokföringsförordningens 1 kap. 1 - 4 § hänföras till ”Övriga rörelseintäkter” och ”Övriga rörelsekostnader” och på motsvarande sätt strykas i benämningarna ”Extraordinära intäkter” och ”Extraordinära kostnader”. 
Ett undantag från det som anförs ovan utgör koncernbidrag enligt lagen om koncernbidrag vid beskattningen (825/1986). Med anledning av att bokföringslagens 4 kap. 2 § upphävs preciseras resultaträkningens uppställningsformer enligt bokföringsförordningens 1 - 4 § genom att till gruppen bokslutsdispositioner fogas en särskild punkt för koncernbidrag. Motsvarande punkt ingår också i de uppställningsformer för resultaträkningen som ingår i förordningen om uppgifter som ska tas upp i små- och mikroföretags bokslut. 
I överensstämmelse med det som anförs ovan har också bokföringsförordningens 1 kap. 3 § 1 mom. 2 punkten ändrats. Bestämmelsen gäller skyldigheten att i noterna specificera extraordinära intäkter och kostnader. Ändringarna i denna punkt är baserade på artikel 16.1 f som behandlas nedan i samband med 5 kap. 16 §. 
5 §.Anskaffningsutgift. I paragrafens 1 mom. har uttrycket ”de rörliga utgifterna” ersatts med ”de direkta utgifterna”. Den ändrade ordalydelsen motsvarar direktivtexten bättre än den gällande och är mer allmänspråklig. Momentet är baserat på artikel 6.2 enligt vilken med anskaffningspris avses ”inköpspris och övriga med förvärvet sammanhängande kostnader minus sammanhängande minskningar av kostnaderna för förvärvet” (eng. 'purchase price' means the price payable and any incidental expenses minus any incidental reductions in the cost of acquisition) samt artikel 2.7 första meningen enligt vilken med tillverkningskostnad avses ”anskaffningspriset för råmaterial, förbrukningsvaror och andra kostnader som är direkt hänförliga till posten i fråga” (eng. 'production cost' means the purchase price of raw materials, consumables and other costs directly attributable to the item in question). 
Motsvarande artikel 35.2 i det tidigare fjärde direktivet lydde ”I anskaffningskostnaden ingår utöver inköpspriset även övriga med förvärvet sammanhängande kostnader” och artikel 35.3 a ” Tillverkningskostnaden utgörs av anskaffningskostnaderna för råvaror och förnödenheter samt av de övriga kostnader som direkt kan hänföras till produkten”. 
Ändringen i paragrafens 2 mom. är baserad på artikel 2.7 andra meningen som lyder: ” Medlemsstaterna ska tillåta eller kräva att en rimlig andel av fasta eller rörliga omkostnader som är indirekt hänförliga till posten i fråga ingår i den mån de hänför sig till produktionsperioden” (eng. a reasonable proportion of overhead costs indirectly attributable to). 
Enligt det tidigare fjärde direktivets motsvarande artikel 35.3 b lydde: ” Av de kostnader som har uppkommit under tillverkningsperioden, men som endast indirekt kan hänföras till produkten, får en skälig andel tillföras tillverkningskostnaden”. 
Med avvikelse från den gällande bestämmelsen förutsätts i momentet inte att de indirekta utgifterna för förvärvet och tillverkningen ska vara väsentliga för att de ska kunna hänföras till anskaffningsutgiften. Det är inte möjligt att i momentet fortsättningsvis föreskriva om denna förutsättning, eftersom direktivet i fråga om artikeln är förpliktande för medlemsstaterna, dvs. artikeln ska hållas i kraft och en medlemsstat kan ”endast” välja om den sätter artikeln i kraft så att den gäller samtliga företag eller så att den avser ett alternativt förfarande. 
Bestämmelsen har också kompletterats med en andra mening som innebär att dessa indirekta utgifter måste kunna utredas med stöd av kostnadsberäkning eller -kalkyler. Förpliktelsen motsvarar den som förutsätts i 5 kap. 5 § 2 mom. i fråga om poster som ska hänföras till den aktiverade anförskaffningsutgiften för en materiell tillgång som genererar inkomst under flera räkenskapsperioder. I direktivet finns ingen motsvarande bestämmelse men den nya meningen kan inte anses stå i strid med direktivet och den är ändamålsenlig med tanke på en eventuell efterhandsbedömning. 
Paragrafens 3 mom. motsvarar artikel 12.8 första meningen i fråga om medlemsstatsoptionen som – till åtskillnad från den tidigare bestämmelsen – omfattar också kortfristiga tillgångar: ” Medlemsstaterna får tillåta eller kräva att ränta på kapital som har lånats för att finansiera produktionen av anläggnings- eller omsättningstillgångar inräknas i tillverkningskostnaderna i den mån räntan hänför sig till produktionsperioden.” Det tidigare fjärde direktivets artikel 35.4 första meningen lydde: ”Ränta på kapital som har lånats för att finansiera produktionen av anläggningstillgångar får inräknas i tillverkningskostnaderna i den mån räntan hänför sig till produktionsperioden.” 
Eftersom artikeln i det nya direktivet innebär en medlemsstatsoption, tillåter direktivet nationella tillämpningskriterier. Tillämpningen av momentet kan sålunda i likhet med den gällande bestämmelsen begränsas uteslutande till tillgångar bland bestående aktiva, vilket innebär att motsvarande ränteaktivering i fråga om rörliga aktiva inte tillåts. I momentet kan också bibehållas den gällande bestämmelsens väsentlighetskrav. Det är emellertid inte ändamålsenligt att för finländska bokföringsskyldiga utesluta detta förfarande som är tillåtet enligt direktivet. Det ändrade momentet tillåter sålunda, utan att förplikta, aktivering av räntor också då tillgången i fråga rörliga aktiva. 
EU-kommissionens tolkningsmeddelande (98/C 16/04) kan tjäna som vägledning också för tolkningen av det nya direktivet. Enligt punkt 41 i tolkningsmeddelandet bör uttrycket ”produktionen” inte tolkas alltför snävt. I punkt 42 föreskrivs dessutom ”upptagande i balansräkningen av upplåningskostnader förutsätter att en betydande tidsperiod är nödvändig innan tillgången är färdigställd för sin tilltänkta användning eller för att säljas. I fråga om förvärv kan detta vara fallet om komponenter köps in som därefter monteras.” 
I det gällande direktivets artikel 17.1 a vi föreskrivs att i noterna ska lämnas upplysningar ”Om ränta kapitaliseras i enlighet med artikel 12.8, det belopp som har redovisats under tillgångar under räkenskapsåret.” Motsvarande krav ställdes också i det tidigare fjärde direktivets artikel 35.4 andra stycket, som lagts till grund för motsvarande bestämmelse i bokföringsförordningens 2 kap. 4 § 1 mom. 8 punkten: ”Om en sådan räntekostnad tas upp bland tillgångarna skall detta anges i en not.” 
Paragrafens 4 och 5 mom. som är av nästan samma ordalydelse som de gällande bestämmelserna är baserade på medlemsstatsoptionen i artikel 12.9: ” Medlemsstaterna får tillåta att anskaffnings- eller tillverkningskostnaderna för likartade lagertillgångar och andra fungibla tillgångsposter, inräknat värdepapper, värderas antingen på grundval av vägda genomsnittspriser, enligt FIFO-metoden (”först in – först ut”), enligt LIFO-metoden (”sist in – först ut”) eller en metod som återspeglar allmänt accepterad bästa praxis” (eng. a method reflecting generally accepted best practice). Ordalydelsen i det tidigare fjärde direktivets artikel 40.1 var nästan densamma. 
Paragrafens 4 mom. har kompletterats så att det i överensstämmelse med artikel 12.9 omfattar också ett värde som beräknats på något annat sådant allmänt använt sätt som är förenligt med god bokföringssed. Bokföringsnämnden kan vid behov ge utlåtanden om sådana förfaranden. 
Ordalydelsen i paragrafens 5 mom. har utvidgats så att den utöver värdepapper av samma slag omfattar också andra sådana placeringar som avses i direktivet (eng. instruments). 
I det nya direktivet finns inte någon bestämmelse som motsvarar artikel 40.2 i det tidigare fjärde direktivet. Denna upphävda artikel lydde: ” Om det värde som med tillämpning av beräkningsmetoderna i punkt 1 redovisas i balansräkningen, på balansdagen väsentligt avviker från ett värde baserat på det senast kända marknadspriset, skall skillnadsbeloppet för varje slag av tillgångar redovisas i noterna.” Sålunda upphävs motsvarande bestämmelse i bokföringsförordningen, dvs. 2 kap. 4 § 1 mom. 9 punkten. 
8 §.Egna och moderföretagets aktier och andelar. Denna nya bestämmelse är förenlig med god bokföringssed. I uppställningsformen ”Tillgångar” i direktivets bilaga III ska enligt punkt D.III.2 under passiva tas upp ”Egna aktier eller andelar - - om nationell lagstiftning medger att de redovisas i balansräkningen.” Motsvarande bestämmelse ingår i uppställningsformen i bilaga IV punkt D.III.2. 
Enligt första meningen i den nya bestämmelsen ska anskaffningsutgiften för egna aktier enligt lag i ett aktiebolag dras av från passivsidans fria egna kapital, vilket också bokföringsnämnden konstaterar i sin allmänna anvisning 12.4.2005 om bostadsaktiebolag (punkt 4.2): Aktier som bolaget har inlöst för sig själv tas inte upp som medel i balansräkningen utan med inlösningspriset sänks de poster i eget kapital som kan användas för inlösning. Detta förfarande motsvarar de internationella IFRS-standarderna. 
Direktivet ska inte tillämpas på andelslag. I lagen om andelslag finns emellertid inte någon bestämmelse enligt vilken egna andelar får tas upp på balansräkningens passivsida. Med beaktande av principen om innehållsbetoning, som föreskrivs i 3 kap. 3 § 1 mom. 2 a punkten, och en enhetlig lagtillämpning finns det inte någon grund för att ett andelslag eller dess moderföretags aktier eller andelar skulle tas upp i balansräkningen bland aktiva. För tydlighetens skull omnämns detta uttryckligen i paragrafens andra mening. 
Av bestämmelsen framgår också att det både för aktiebolag och för andelslag är förbjudet att finansiera förvärv av egna aktier och andelar (13 kap. 10 § i aktiebolagslagen och 16 kap. 11 § i lagen om andelslag). 
Ett finländskt moderföretag kan å andra sidan också ha dotterföretag med hemort utomlands. Med tanke på en sådan situation är det enligt bestämmelsen också förbjudet att i koncernbalansräkningen ta upp ett dotterbolags egna eller ett finländskt moderföretags aktier. 
En sådan uttrycklig bestämmelse om utländska dotterföretag behövs med tanke på principerna om internationell privaträtt. Om en utländsk rättsordning tillåter att egna aktier eller andelar tas upp bland balansräkningens aktiva i ett utländskt dotterföretags bokslut, ska detta arrangemang utan något uttryckligt förbud godkännas också när det finländska koncernbokslutet upprättas, under förutsättning att dotterföretaget i sitt bokslut de facto tillämpat denna möjlighet. I Finland beaktas lagstiftningen i registreringsstaten, vilket innebär att en förutsättning för att ett företag ska betraktas som finländskt är att det införts i handelsregistret eller på något annat sätt registrerats här. En bestämmelse om saken finns t.ex. i aktiebolagslagens 1 kap. 1 §. Härav följer att på ett företag som registrerats i ett annat land på motsvarande sätt ska tillämpas det landets lag också i finsk domstol, t.ex. i fråga om upprättande av bokslut. Ett utländskt dotterföretags egna aktier som redovisats i balansräkningen är sålunda ”tillåtna” också med beaktande av finländsk internationell privaträtt. Eventuella egna aktier eller andelar i ett utländskt dotterföretags balansräkning ska sålunda tas upp som en egen post i det finländska moderföretagets koncernbalans, om detta inte uttryckligen förbjuds i bestämmelsen. 
Paragrafen har ett samband också med medlemsstatsoptionen i artikel 25. Motsvarande bestämmelse ingick inte i det tidigare sjunde direktivet. Artikelns rubrik lyder ”Företagsförvärv inom en koncern” (eng. Business combination within a group) och den lyder: 
- Artikel 25.1: ”En medlemsstat får tillåta eller kräva att det bokförda värdet av aktier eller andelar som innehas i ett företag som omfattas av konsolideringen endast elimineras genom avräkning mot motsvarande ägarandel av företagets kapital, förutsatt att det ytterst är samma part som har ett bestämmande inflytande över företagen i företagsförvärvet både före och efter företagsförvärvet, och att detta bestämmande inflytande inte är av tillfällig natur.” 
- Artikel 25.2: ”Den differens som uppkommer vid tillämpningen av punkt 1 ska läggas till eller dras ifrån reserverna i koncernredovisningen.” 
- Artikel 25.3: ”Tillämpningen av den i punkt 1 angivna metoden, de därav följande ändringarna i reserverna samt namn och säte för de berörda företagen ska anges i noterna till koncernredovisningen.” 
Enligt den nya paragrafen är det inte tillåtet att ta upp egna aktier som tillgångar bland balansräkningens aktiva. Detta hindrar emellertid inte att medlemsstatsoptionen i artikel 25 implementeras som en elimineringsteknik vid upprättandet av koncernbokslut. 
5 kap. Värderings- och periodiseringsbestämmelser
Detta kapitel innehåller de mest centrala materiella bestämmelserna om upprättande av bokslut. Redovisningen av den bokföringsskyldigas resultat för räkenskapsperioden ― dvs. periodiseringen av utgifter och inkomster ― ska baseras på dessa bestämmelser, liksom även värderingen av tillgångs- och skuldposter med tanke på upptagande i balansräkningen. Den principiella utgångspunkten är att bland balansräkningens aktiva får aktiveras endast den del av den bokföringsskyldigas utgifter som väntas generera inkomst under de fem följande räkenskapsperioderna. Resten av utgiften ska tas upp i resultaträkningen som en avdragspost, dvs. kostnad. På motsvarande sätt ska inkomsten tas upp som en intäkt den räkenskapsperiod då den uppkommit (1 §). 
Till kapitlets viktigaste bestämmelser hör 5 § 1 mom. där det föreskrivs att anskaffningsutgiften för tillgångar som hör till de materiella tillgångarna och väntas generera inkomst under flera räkenskapsperioder avskrivs så att den enligt plan kostnadsförs på respektive räkenskapsperiod under sin verkningstid. Återstoden av anskaffningsutgiften ska å andra sidan efter räkenskapsperiodens avskrivning tas upp i balansräkningen bland bestående aktiva, dvs. aktiveras. 
Kapitlets övriga bestämmelser styr tillämpningen av de grundläggande principer som beskrivs ovan och föreskriver om undantag i särskilda fall, exempelvis när det gäller periodisering av inkomsten av en prestation som kräver lång framställningstid (4 §). Om inte något annat uttryckligen föreskrivs i kapitlet ska den bokföringsskyldiga iaktta de grundläggande principerna om redovisning av utgifter och kostnader i bokslutet. 
I kapitlet preciseras tidsgränserna för avskrivning av uppgifter med lång verkningstid i överensstämmelse med det nya direktivet så att en utgift avskrivs under högst 10 år, om den bokföringsskyldiga inte på ett tillförlitligt sätt kan uppskatta verkningstiden. Denna ändring gäller utvecklingsutgifter (8 §), goodwill (10 §) och övriga utgifter med lång verkningstid (11 §). 
Till åtskillnad från vad som tidigare varit fallet är det enligt kapitlet tillåtet att basera värderingsalternativ enligt verkligt värde direkt på respektive IFRS-standarder. Dessa ska iakttas i sin helhet då den bokföringsskyldiga väljer detta alternativ för värdering av sina finansiella instrument eller förvaltningsfastigheter till verkligt värde och upptagande av dessa till verkligt värde (2 a och 2 b §). 
IFRS-standarderna ska läggas till grund också för upptagande av finansiella leasingavtal i balansräkningen (5 b §). Denna nya bestämmelse är inte tvingande men den är ändamålsenlig i en situation där den bokföringsskyldiga hör till en koncern för vilken upprättas ett koncernbokslut med iakttagande av IFRS-standarderna, som förutsätter att det finansiella leasingavtalet tas upp i koncernens balansräkning. 
2 §.Fordringar, finansieringstillgångar och skulder. Paragrafens 1 mom. 1 punkten om värdering av fordringar som ska tas upp i balansräkningen på aktivsidan är av samma lydelse som 1 punkten i den gällande bestämmelsen. Bestämmelsen är för det första baserad på huvudregeln i artikel 6.1 i enligt vilken poster som redovisas i de finansiella rapporterna ”ska värderas i enlighet med principen om anskaffnings- eller tillverkningskostnad” och den preciserande artikeln 2.6 enligt vilken med anskaffningspris avses ”inköpspris och övriga med förvärvet sammanhängande kostnader minus sammanhängande kostnader för förvärvet” samt artikel 2.7 enligt vilken med tillverkningskostnad avses ”anskaffningspriset för råmaterial, förbrukningsvaror och andra kostnader som är direkt hänförliga till posten i fråga”. I det tidigare fjärde direktivet ingick de motsvarande artiklarna 31.2, 35.2 och 35.3. 
Det första stycket i artikel 12.7 förutsätter å andra sidan att omsättningstillgångar (eng. current assets) ”ska göras till föremål för värdejusteringar i syfte att ta upp dem till ett lägre marknadsvärde eller, under särskilda förhållanden, till något annat lägre värde som kan åsättas dem på balansdagen” (eng. in particular circumstances). Motsvarande bestämmelse fanns i det tidigare fjärde direktivets artikel 39.1 b. 
Med värdejustering (eng. value adjustments) avses enligt artikel 2.8 ”ändringar i syfte att beakta värdeförändringar för enskilda tillgångsposter på balansdagen, oavsett om värdeförändringen är slutlig eller inte.” En liknande bestämmelse fanns i det fjärde direktivets artikel 19. 
Trots att det i direktivet inte finns någon likalydande bestämmelse, stämmer uttrycket ”högst till det sannolika värdet” överens med den försiktighetsprincip som avses i de ovan nämnda artiklarna och i artikel 6.1 c, som innehåller en av de centrala principerna vid upprättande av bokslut och verksamhetsberättelse såsom framgår av 3 kap. 3 § 1 mom. 3 punkten. 
Också 2 punkten är baserad på artikel 12.7 som behandlas ovan i samband med 1 punkten. Tillämpningsområdet för punkten stämmer överens med ordalydelsen i den gällande lagen. 
Termen ”sannolikt överlåtelsepris” har också ersatts med begreppet ”verkligt marknadsvärde” som bättre motsvarar den i artikel 12.7 använda termen ”marknadsvärde”. Attributet ”verkligt” är avsett att motsvarar uttrycket ”under särskilda förhållanden” (eng. particular circumstances) i artikel 12.7, vilket innebär att marknadsvärdet inte ska tillämpas under exceptionella marknadsförhållanden. Då marknadsvärdet av orsaker som inte sammanhänger med värdepappersemittenten är onormalt högt eller lågt eller om marknadspriset fluktuerar exceptionellt mycket, ska värderingen göras utifrån det sannolika överlåtelsepriset som då motsvarar det verkliga marknadspriset. Detta gäller också den situationen att värdepapperet inte är föremål för handel på en reglerad marknad. 
Bokföringsnämnden har ansett att det är förenligt med god bokföringssed att stödja sig på de internationella IAS/IFRS-standarderna då dessa inte står i konflikt med uttryckliga bestämmelser i denna lag (utlåtande 1767/2005). Detta gäller också fastställande av marknadsvärdet med ledning av de gällande standarderna IFRS 13 och IAS 39. 
Momentets 3 punkt motsvarar 3 punkten i den gällande paragrafen. Till åtskillnad från de föregående punkterna 1 och 2 gäller 3 punkten värdering av den bokföringsskyldigas egna skulder och upptagande av dem i balansräkningen på passivsidan. Punkten motsvarar för det första den ovan nämnda huvudregeln, dvs. artikel 6.1 i, som förutsätter att poster som tas upp i bokslutet ska värderas i enlighet med principen om anskaffnings- eller tillverkningskostnad, och artikel 6.1 c om försiktighetsprincipen. 
Värderingen av indexbundna skulder som avses i punkten är assymmetrisk i enlighet med försiktighetsprincipen i 3 kap. 3 § 1 mom. 3 punkten. Avvikelse från det nominella beloppet får ske endast om skulderna skrivs upp på grund av en indexjustering, vilket innebär att den bokföringsskyldigas skuldansvar ökar i förhållande till det nominella beloppet. Trots värdeminskningen måste å andra sidan också indexbundna skulder alltid tas upp till minst sitt nominella belopp. 
Också i det fall att skulden är ett lån med noll procents ränta, vilket innebär att långivaren på förhand drar av ränteandelen från det utlåtande beloppet, ska den bokföringsskyldiga ta upp skulden i sin balansräkning till det nominella belopp som ska återbetalas, trots att lånebeloppet efter ränteavdraget är mindre än så. 
I artikel 12.10 första meningen föreskrivs dessutom om en medlemsstatsoption som gäller s.k. nollräntelån, som tillåter aktivering av skillnaden mellan det erhållna beloppet och det belopp som ska återbetalas. Artikeln lyder: ”Om det belopp som ska återbetalas för en skuld överstiger det mottagna beloppet, får medlemsstaterna tillåta eller kräva att mellanskillnaden tas upp som en tillgång.” I det tidigare fjärde direktivet ingick motsvarande bestämmelse i artikel 41, med den skillnaden att den berättigade företagen att handla i enlighet med artikeln utan att medlemsstaterna hade någon valmöjlighet i detta avseende. Bestämmelsen behandlas nedan i 5 kap. 10 §. 
Nya 2 mom. stämmer överens med medlemsstatsoptionen i artikel 12.6 a: ” Medlemsstaterna får tillåta eller kräva att finansiella anläggningstillgångar [eng. financial fixed assets] värdejusteras i syfte att åsätta dem det lägre värde de har på balansdagen.” Den nämnda artikeln förutsätter inte ― till åtskillnad från artikel 12.6 b som generellt gäller bestående aktiva och ligger till grund för 13 § i detta kapitel ― att nedskrivningen är bestående. 
Motsvarande bestämmelse ingick också i det tidigare fjärde direktivets artikel 33.1 cc, men den var inte en medlemsstatsoption utan ålade medlemsstaterna att ge företagen rätt att tillämpa nerskrivningsmöjligheten. 
Paragrafens nya 3 mom. är baserat på artikel 12.6 c. Värdejustering enligt artikel 12.6 a inverkar direkt på resultatet för respektive räkenskapsperiod. Enligt artikel 12.6 c ska värdejusteringarna ”debiteras resultaträkningen och anges separat i noterna till den finansiella rapporten om de inte har tagits upp särskilt i resultaträkningen.” Samma bestämmelse ingick också i det tidigare fjärde direktivets artikel 33.1 c cc. 
En bestämmelse om bokföring som påverkar resultatet i bokslutet saknas i fråga om värdejusteringar av omsättningstillgångar enligt direktivets artikel 12.7 första punkten, trots att motsvarande förfarande också i fråga om sådana tillgångar är konsekvent från bokföringsmässig synpunkt. Detta har beaktats i momentet enligt vilket det inte gör någon skillnad om finansieringstillgångarna har upptagits bland bestående eller rörliga aktiva. 
Enligt artikel 12.6 c ska på ett resultatpåverkande sätt bokföras också nedskrivning av anläggningstillgångar som avses i artikel 12.6 b och som ― till åtskillnad från artikel 12.6 a ― är bestående. Bokföring på ett resultatpåverkande sätt förutsattes också i det tidigare fjärde direktivets artikel 33.1 c cc. En motsvarande bestämmelse ingår i 13 § som gäller nedskrivning av poster i bestående aktiva och behandlas nedan. 
Om en nedskrivning inte i resultaträkningen tas upp som en separat post ska den enligt den nämnda artikeln redovisas i en not. En bestämmelse om saken ingår i den nya 7 punkten om resultaträkningens noter. 
2 a §.Upptagande av finansiella instrument till verkligt värde samt fonden för verkligt värde. I denna paragraf föreskrivs om upptagande av finansiella instrument till verkligt värde i bokslutet. Till denna del motsvarar paragrafen den gällande bestämmelsen. Rubriken har preciserats för att ange detta innehåll. 
Paragrafen är baserad på artikel 8.1 a, som motsvarar det tidigare fjärde direktivets artikel 42a.1 första stycket. Bestämmelsen ålägger medlemsstaterna att tillåta eller kräva att alla företag ska avvika från vad som i 6.1 i föreskrivs om värdering ― som regleras i föregående 2 § ― av finansiella instrument, inklusive derivatinstrument, så att de i bokslutet upptas till verkligt värde. 
Den förordning om värdering samt upptagning av finansiella instrument i bokslut och koncernbokslut som avses i den gällande bestämmelsen har utfärdats år 2004 (1315/2004, nedan ”ministerieförordningen”). När den gällande paragrafen stiftades ansågs det vara ändamålsenligt att utfärda mera detaljerade bestämmelser om finansiella instrument på en lägre hierarkisk nivå, för att eventuella tekniska ändringar i samband med att internationell redovisningspraxis utvecklas skulle kunna sättas i kraft så snabbt som möjligt i Finland. I det ovan nämnda ministeriebeslutet beaktas sålunda det tidigare fjärde direktivets artiklar 42a.2 - 42.f, som motsvarar artiklarna 8.2 - 8.4 och 8.7 - 8.9 i det nya direktivet. 
Medlemsstatsoptionen i det nya direktivets 8.6 ger å andra sidan medlemsländerna möjlighet att tillåta eller kräva redovisning och värdering i överensstämmelse med de redovisningsstandarder som godkänns genom IAS-förordningen. Sålunda ska standarderna IAS 39, IFRS 7 och IFRS 13 tillämpas i den utsträckning som de antagits genom nämnda förordning. Artikeln innebär sålunda till denna del att också andra bokföringsskyldiga än sådana börsnoterade bolag som avses i lagens 8 a kap. ska tillämpa de internationella redovisningsstandarderna. Paragrafens 1 mom. är baserat på denna artikel. Varje bokföringsskyldig får själv besluta tillämpa bestämmelsen eller inte. 
Paragrafen avviker från gällande reglering som innebär att finansiella instrument ska behandlas i enlighet med ministerieförordningen. I och med lagändringen upphävs ministerieförordningen och i 9 kap. 2 a § föreslås en särskild ikraftträdandebestämmelse enligt vilken på upptagande av tillgångar till verkligt värde som gjorts före lagändringen ska tillämpas de bestämmelser som gällde vid den tidpunkten. I paragrafen kvarstår å andra sidan möjligheten att genom förordning avvika från EU-regelverket, eftersom artikel 8.6 är en medlemsstatsoption. En avvikelse kan vara befogad t.ex. för att begränsa de krav på bokslutsnoter som avses i standarden IFRS 7. 
I Finlands lagstiftning definieras begreppet finansiella instrument i 10 § 1 mom. i lagen om investeringstjänster (747/2012) som lyder: 
” Med finansiella instrument avses i denna lag 
1) värdepapper enligt värdepappersmarknadslagen (746/2012), 
2) sådana andelar i fondföretag och sådana penningmarknadsinstrument som inte är värdepapper enligt 1 punkten, 
3) optioner, terminer och andra derivatinstrument som har värdepapper, valutor, räntor, avkastningar, något annat derivatinstrument, finansiella index eller andra finansiella mått som underliggande tillgång och som kan avvecklas fysiskt eller kontant, 
4) optioner, terminer och andra derivatinstrument som har en nyttighet som underliggande tillgång och som måste eller kan avvecklas kontant, 
5) optioner, terminer och andra derivatinstrument som har en nyttighet som underliggande tillgång och kan avvecklas fysiskt, om de omsätts på en reglerad marknad enligt lagen om handel med finansiella instrument eller på en multilateral handelsplattform, 
6) andra än i 5 punkten avsedda optioner, terminer och andra derivatinstrument som har en nyttighet som underliggande tillgång och kan avvecklas fysiskt, om derivatinstrumentet upprättas i investerings- eller skyddssyfte och är av samma typ som andra derivatinstrument, 
7) derivatinstrument för överföring av kreditrisk, 
8) finansiella kontrakt avseende prisdifferenser, 
9) optioner, terminer och andra derivatinstrument som har samband med klimatvariationer, fraktavgifter, utsläppsrätter eller inflationstakten eller någon annan officiell ekonomisk statistik och som kan avvecklas kontant samt andra derivatinstrument som avser tillgångar, rättigheter, skyldigheter, index och andra finansiella mått än de som nämns ovan och är av samma typ som andra derivatinstrument.” 
Med finansiella instrument avses enligt 10 § 1 mom. 5 och 6 punkten i den ovan nämnda lagen om investeringstjänster derivatinstrument som har en nyttighet som underliggande tillgång. Utanför tillämpningsområdet för momentet faller å andra sidan ”äkta” varubaserade avtal som fullgörs genom fysisk leverans av varorna i fråga. Detta motsvarar artikel 8.2 som lyder: ” I detta direktiv ska varubaserade avtal som ger endera avtalsparten rätt att betala med kontanter eller något annat finansiellt instrument anses som derivatinstrument, utom när sådana avtal a) ingicks för och fortsätter att uppfylla företagets förväntade inköps-, försäljnings- eller användningsbehov vid den tidpunkt när de ingicks och senare, b) betecknades från början som varubaserade avtal, och c) förväntas bli reglerade genom leverans av varan.” Det tidigare fjärde direktivets artikel 41.a 2 var av samma innehåll, men varken i ministerieförordningen eller någon annanstans i den gällande bokföringslagstiftningen finns det någon bestämmelse om saken. 
I bokföringslagen behöver inte heller tas in förtydligande bestämmelser enligt artiklarna 8.3 och 8.4 om poster som hänförs till finansiella instrument, eftersom tillämpningen av dessa artiklar utesluts i artikel 8.6 som ger medlemsstaterna möjlighet att tillåta eller kräva redovisning och värdering av samt upplysningar om finansiella instrument i överensstämmelse med internationella redovisningsstandarder som antagits i enlighet med IAS-förordningen. Denna artikel har implementerats i ovan nämnda 1 mom. som en bestämmelse som tillåter redovisning och värdering. De nämnda artiklarna lyder: 
- Artikel 8.3: ” Punkt 1 a ska endast tillämpas för följande skulder (eng. liabilities): a) Skulder som innehas för handelsändamål. b) Derivatinstrument.” Motvarande bestämmelse ingick också i det tidigare fjärde direktivets artikel 42.a.4. 
- Artikel 8.4: ” Värdering enligt punkt 1 a ska inte gälla följande: a) Andra finansiella instrument än derivatinstrument som hålls till förfall. b) Lånefordringar och kundfordringar som härrör från företaget och som inte innehas för handelsändamål. c) Andelar i dotterföretag, intresseföretag och samriskföretag, ägarandelsbevis som har utfärdats av företaget, avtal om villkorad ersättning i samband med företagskombinationer liksom andra finansiella instrument av sådan särskild karaktär att instrumenten, enligt vad som är allmänt accepterat, redovisas på annat sätt än andra finansiella instrument.” Motsvarande bestämmelser ingick i det tidigare fjärde direktivets artikel 42a.4. 
Med anledning av tillägget till 2 § 2 och 3 mom. har ordalydelsen i 1 mom. om tillämpningsområdet preciserats så att den gäller instrument som hör till sådana finansiella tillgångar som definieras i 2 § 1 mom. 2 punkten. 
Av 1 mom. som är baserat på artikel 8.6 följer också att det inte finns något behov att implementera artikel 8.7 där det föreskrivs om olika sätt att fastställa det verkliga värdet och inte heller artikel 8.5 i fråga om alla tillgångar och skulder som uppfyller kraven för en säkrad post enligt ett system för säkringsredovisning till verkligt värde, trots försiktighetsprincipen enligt artikel 6.1 i. Dessa artiklar lyder: 
- Artikel 8.7 första stycket: ” Det verkliga värdet enligt denna artikel ska fastställas med hänvisning till ett av följande värden: a) Ett marknadsvärde, för de finansiella instrument för vilka en tillförlitlig marknad med lätthet kan bestämmas. Om marknadsvärdet inte med lätthet kan bestämmas för ett instrument men däremot för dess beståndsdelar eller för ett liknande instrument, får instrumentets marknadsvärde härledas från värdet på beståndsdelarna eller på det liknande instrumentet. b) Ett värde som beräknas utifrån allmänt accepterade värderingsmodeller och värderingsmetoder för finansiella instrument för vilka en tillförlitlig marknad inte med lätthet kan bestämmas, förutsatt att sådana värderingsmodeller och värderingsmetoder ger en rimlig uppskattning av marknadsvärdet.” En likalydande bestämmelse ingick i det fjärde direktivets artikel 42 b.1. 
- Artikel 8.7 andra stycket: ”Finansiella instrument som inte kan beräknas på ett tillförlitligt sätt genom någon av de metoder som beskrivs i leden a och b i första stycket, ska värderas i enlighet med principen om anskaffnings- eller tillverkningskostnad i den utsträckning en beräkning är möjlig på denna grund.” Motsvarande bestämmelse ingick också i det fjärde direktivets artikel 42b.2. 
- Artikel 8.5: ”Genom undantag från artikel 6.1 i får medlemsstaterna, i fråga om alla tillgångar och skulder som uppfyller kraven för en säkrad post enligt ett system för säkringsredovisning till verkligt värde, eller en bestämd del av sådana tillgångar eller skulder, tillåta värdering till det specifika belopp som fordras enligt det systemet.” Motsvarande bestämmelse ingick i det fjärde direktivets artikel 42 a.5. 
Bokföringsnämnden har i sitt utlåtande 1870/2011 tolkat gällande 2 a § så att effekterna av värdeförändringen vid användning av metoden med verkligt värde i första hand ska upptas i resultaträkningen. Undantag från denna regel ska göras bl.a. då de finansiella instrumenten i fråga inte har förvärvats i syfte att bedriva handel med dem. Nämnden ansåg att man för den sökande stiftelsens del ur denna tillgångsmassa på goda grunder kunde avgränsa utanför handelsportföljden åtminstone sådana speciella egendomsposter där orsaken till innehavet till exempel med stöd av regelboken eller av annan särskild anledning är någon annan än aktivt eftersträvande av avkastning. I utlåtandet ansågs det vara förenligt med god bokföringssed att den bokföringsskyldige omsorgsfullt överväger och i sitt bokföringsmaterial dokumenterar grunderna till avvikelsen från huvudregeln, dvs. varför värdeförändringarna har upptagits som eget kapital. 
Paragrafens 2 mom. är en preciserande bestämmelse om beaktande av förändringar i finansiella instruments verkliga värde i fonden för verkligt värde. Momentet motsvarar artikel 8.8 första punkten som lyder: ” När ett finansiellt instrument värderas till verkligt värde ska en värdeförändring trots artikel 6.1 c tas upp i resultaträkningen, utom i följande fall då en förändring av detta slag ska tas upp direkt i fonden för verkligt värde: a) Instrumentet är ett säkringsinstrument enligt ett system för säkringsredovisning som tillåter att en del av eller hela värdeförändringen inte tas med i resultaträkningen. b) Värdeförändringen är orsakad av en kursförändring på en monetär post som utgör en del av ett företags nettoinvestering i en utländsk enhet.” Motsvarande bestämmelse ingick i det tidigare fjärde direktivets artikel 42 c.1. Enligt den gällande ministerieförordningens 7 § 1 mom. ska differensen upptas i fonden om ”1) det är fråga om upptagning av ett finansiellt instrument i ett säkringsredovisningsförfarande, enligt vilket det är möjligt att lämna hela värdeförändringen eller en del av den obeaktad i resultaträkningen under ifrågavarande räkenskapsperiod (säkring av kassaflöde),” eller om ”2) en dylik värdeförändring orsakas av en kursförändring i en valutapost som ingår i nettoinvesteringar som den bokföringsskyldige har gjort i ett utländskt företag (omvandlingsdifferens).” 
Eftersom i fråga om verkligt värde enligt 1 mom. ska iakttas internationella redovisningsstandarder som förutsätter ett förfarande som motsvarar den första stycket i nämnda artikel 8.8, finns det inte något behov att uttryckligen implementera artikeln i bokföringslagen. Hänvisningen till standarderna i paragrafens 1 mom. räcker sålunda för att sätta artikeln i kraft. 
Momentets hänvisning till internationella redovisningsstandarder tillåter att den bokföringsskyldiga också tillämpar medlemsstatsoptionen i artikel 8.8 andra stycket, under förutsättning att detta förfarande är förenligt med redovisningsstandarderna. Den nämnda artikeln (första meningen) lyder: ” Medlemsstaterna får tillåta eller kräva att en värdeförändring på en finansiell tillgång som är tillgänglig för försäljning, och som inte är ett derivatinstrument, tas upp direkt i fonden för verkligt värde.” Samma bestämmelse ingick tidigare i det fjärde direktivets artikel 42 c.3. 
Uttrycket ”en finansiell tillgång som är tillgänglig för försäljning” (eng. an available for sale financial asset) definieras varken i direktivet eller i det tidigare fjärde direktivet. Det är emellertid väsentligt att posten hör till den bokföringsskyldigas tillgångar och sålunda kommer att tas upp i balansräkningen på aktivsidan. Däremot gäller bestämmelsen inte den bokföringsskyldigas förpliktelser, trots att de till sin karaktär är finansiella instrument.  
Att en värdeförändring direkt tas upp i fonden för verkligt värde innebär att varken positiva eller negativa förändringar inverkar på resultatet för den bokföringsskyldigas räkenskapsperiod. En bestämmelse som är avsedd att motsvara detta ingår också i den gällande ministerieförordningens 7 § 1 mom. 3 punkten. 
Fonden för verkligt värde är både i aktiebolag och i andelslag en bunden fond som inte kan delas ut till ägarna ens med borgenärernas samtycke. Fonden får inte heller användas för att öka aktiekapitalet (8 kap. 1 § 1 mom., 11 kap. 1 § 2 punkten och 13 kap. 5 § i aktiebolagslagen, 8 kap. 1 § 1 mom., 11 kap. 1 § 2 punkten och 16 kap. 6 § i lagen om andelslag). I paragrafens nya 3 mom. hänvisas till dessa bestämmelser. 
Paragrafens nya 4 mom. är baserat på artikel 8.8 andra stycket andra meningen som lyder: ” Denna fond för verkligt värde ska justeras när belopp som anges i den inte längre är nödvändiga för tillämpningen av leden a och b i första stycket.” Det tidigare fjärde direktivets artikel 42 c.3 var av samma lydelse. 
Fonden för verkligt värde ska således justeras vid ändringar i det verkliga värdet för finansiella instrument, när beloppen i fonden inte är nödvändiga (regeringens proposition 126/2004 punkt 2.2). I enlighet härmed föreskrivs i ministerieförordningens 7 § 2 mom.: ”Fonden för verkligt värde skall rättas när det finansiella instrumentet överlåts eller förfaller.” Ordalydelsen i det nya momentet har ― i jämförelse med ministerieförordningen ― preciserats så att den täcker alla de situationer som avses i artikeln där tillämpningen av respektive IFRS-standard förutsätter en anteckning som inverkar på resultatet. Enligt standarden ska man förfara på detta sätt bl.a. då nedskrivningen av en aktie är långvarig eller annars betydande. 
Paragrafens nya 5 mom. motsvarar den gällande ministerieförordningens 9 § som lyder: ”Utöver vad som föreskrivs i eller med stöd av bokföringslagen, skall i verksamhetsberättelsen i fråga om finansiella instrument som tagits upp till verkligt värde anges uppgifter om 1) målen och förfaringssätten för hantering av företagets finansiella risker, inklusive säkringsförfarandet för varje sådant huvudslag av anteciperade transaktioner på vilket säkringsredovisning tillämpas, 2) företagets pris-, kredit-, likviditets- och kassaflödesrisker, om dessa uppgifter är viktiga för att bedöma företagets tillgångar, skulder, finansiella ställning eller resultat för räkenskapsperioden.” 
Bestämmelsen är baserad på artikel 19.2 e som motsvarar artikel 46.2 f i det tidigare fjärde direktivet. Eftersom det är fråga om uppgifter i verksamhetsberättelsen tillämpas på den inte den internationella standarden IAS 39 som är begränsad till uppgifter som presenteras i bokslutet. Oberoende av standarden kan verksamhetsberättelsen sålunda regleras i direktivet och genom nationell lagstiftning som implementerar direktivet. 
Det är emellertid inte ändamålsenligt att kräva att i verksamhetsberättelsen ska tas in information som i enlighet med IFRS-standarden ska uppges i noterna. För undvikande av sådan överlappning räcker det enligt momentet att samma sak nämns i noterna. 
I momentet nämns i överensstämmelse med artikel 19.2 e uttryckligen väsentlighetskriteriet, trots att väsentlighet nämns som en allmän princip i artikel 6.1 j och på basis av den i nya 2 a § i denna lags 3 kap. 
Paragrafens nya 6 mom. är baserat på artikel 19.2 e som det hänvisas till i artikel 29.1. Motsvarande bestämmelse ingick i det tidigare sjunde direktivets artikel 36.2 e. Bestämmelsens ordalydelse stämmer överens med den nuvarande ministerieförordningens 10 § 2 mom. 
Artikel 36.3 förbjuder bokföringsskyldiga som utnyttjar mikroföretagslättnader att värdera finansiella instrument och andra tillgångsposter enligt modellen för verkligt värde, så som avses i artikel 8: ”Medlemsstaterna ska inte tillåta eller kräva att artikel 8 tillämpas på mikroföretag som utnyttjar något av undantagen i punkterna 1 och 2 i den här artikeln.” Detta förbud har tagits in i paragrafens 7 mom. 
2 b §.Upptagande av förvaltningsfastigheter till verkligt värde. Denna nya paragraf är baserad på medlemsstatsoptionen i artikel 8.1 b som ger lagstiftaren möjlighet att tillåta eller kräva att företag värderar vissa slag av tillgångar som inte är finansiella instrument (eng. specified categories of assets) till verkligt värde. Till åtskillnad från artikel 8.1 a som behandlas ovan får medlemsstaterna besluta att denna möjlighet inte utnyttjas. 
Motsvarande medlemsstatsoption ingick också i det tidigare fjärde direktivets artikel 42 e första stycket, men i Finland har optionen inte utnyttjats. Optionen ger medlemsstaterna allmän rätt att tillåta att vissa kategorier av tillgångsposter tas upp till verkligt värde. Syftet med optionen är dock att verkligt värde ska få tillämpas endast i situationer där detta är förenligt med de internationella IFRS-standarderna (regeringens proposition 126/2004). 
För närvarande finns standarder om verkligt värde i IAS 39, IFRS 7 och IFRS 13 som gäller finansiella instrument och dessutom i IAS 40 som gäller förvaltningsfastigheter samt i IAS 41 om lantbrukstillgångar. För bokföringsskyldiga som driver handel eller industriell produktion har optionen i artikel 8.1 b betydelse i fråga om förvaltningsfastigheter. 
Förvaltningsfastigheter som avses i standarden IAS 40 utgörs av jordområden och byggnader som den bokföringsskyldiga äger eller innehar enligt ett finansiellt leasingavtal i syfte att få hyresintäkter eller värdestegringar. Enligt standarden ska en förvaltningsfastighet först värderas till anskaffningsutgiften varefter den bokföringsskyldiga ska välja att värdera den antingen till verkligt värde eller till anskaffningsutgiften. Vinst eller förlust som orsakats av en värdeförändring enligt verkligt värde -modellen ska alltid redovisas i resultaträkningen. De krav som ställs på noterna för förvaltningsfastigheter är relativt detaljerade. 
Paragrafens ordalydelse motsvarar kapitlets 5 a § om finansiella instrument. Enligt bestämmelsen kan genom förordning t.ex. lindras de krav som ställs på noterna i standarden IAS 40. Paragrafen stämmer överens också med medlemsstatsoptionen i artikel 8.9. Artikeln lyder: ”När tillgångar som inte är finansiella instrument värderas till verkligt värde får medlemsstaterna trots artikel 6.1 c tillåta eller kräva att alla företag eller vissa kategorier av företag tar upp en värdeförändring i resultaträkningen.” Motsvarande bestämmelse ingick i det tidigare fjärde direktivets artikel 42 f. 
Paragrafen tillämpas enligt 12 kap 8§ 1 mom. i kreditinstitutslagen (610/2014). Momentet lyder: ”Förvaltningsenheter som tagits upp bland materiella tillgångar i balansräkningen får tas upp i bokslutet enligt sitt verkligt värde per bokslutsdagen.” 
Särskilda krav ställs också på börsbolag och på andra än sådana emittenter som avses i värdepappersmarknadslagen (746/2012). Enligt 6 § i finansministeriets förordning (1020/2012) ”- - ska en emittent som uteslutande eller huvudsakligen bedriver fastighetsplaceringsverksamhet eller vid sidan av sin huvudsakliga affärsverksamhet äger förvaltningsfastigheter som inte är i eget bruk och i sin balansräkning värderat fastigheterna till verkligt värde och inhämtat yttrande om fastigheternas värde av en sådan av Centralhandelskammaren godkänd fastighetsvärderare som avses i lagen om fastighetsfonder (1173/1997), ska emittenten i verksamhetsberättelsen eller bokslutsnoterna offentliggöra fastigheternas verkliga värde, fastighetsvärderarens yttrande och vilka fastighetsvärderare som anlitats. Om en emittent värderar fastigheter som inte är i eget bruk till ett annat värde än det verkliga värdet eller beslutar att inte anlita en fastighetsvärderare ska emittenten motivera sitt förfarande i verksamhetsberättelsen eller bokslutsnoterna.” 
I paragrafens 2 mom. ingår ett mot kapitlets 2 a § 7 mom. svarande förbud som gäller mikroföretag. 
5 §.Periodisering av anskaffningsutgiften för materiella tillgångar som genererar inkomst under flera räkenskapsperioder. Paragrafens rubrik och 1 mom. har ändrats så att de motsvarar den underliggande artikeln 12.5: ” Anskaffnings- eller tillverkningskostnaden, eller det omvärderade beloppet i de fall där artikel 7.1 är tillämplig, för anläggningstillgångar med begränsad ekonomisk livslängd ska minskas genom värdejusteringar i syfte att systematiskt skriva av sådana tillgångar över deras nyttjandeperiod.” (eng. shall be reduced by values adjustments calculated to write off such assets systematically over their useful economic lives). Begreppet ”värdejustering” som används i artikeln motsvaras i finländsk bokföringsterminologi av begreppet ”avskrivning” som redan är så vedertaget att det inte är ändamålsenligt att ändra ordalydelsen i momentet. Också i det tidigare fjärde direktivet användes på svenska termen ”värdejustering” medan i den finska texten användes termen ”poisto” (artikel 35.1 b): ” Anskaffnings- eller tillverkningskostnaden för anläggningstillgångar med begränsad ekonomisk livslängd skall minskas genom värdejusteringar i syfte att systematiskt skriva av tillgången över dess ekonomiska livslängd.” Bokföringsnämnden har 16.10.2007 i syfte att styra god bokföringssed gett en omfattande allmän anvisning om beräkning av avskrivningar enligt plan. 
Begreppet värdejustering (eng. value adjustment) definieras i artikel 2.8 på följande sätt: ”värdejustering: ändringar i syfte att beakta värdeförändringar för enskilda tillgångsposter på balansdagen, oavsett om värdeförändringen är slutlig eller inte.” Motsvarande artikel 19 i det tidigare fjärde direktivet lydde: ” Värdejusteringar skall omfatta alla på balansdagen konstaterade värdeförsämringar av individuella tillgångsposter oavsett om en sådan värdeförsämring är slutlig eller inte.” Såsom ovan redan konstaterats är avskrivning ett vedertaget begrepp i vår bokföringspraxis och det finns sålunda ingen anledning att byta ut det mot termen värdejustering. 
Av den ovan nämnda artikeln 12.5 framgår tydligt att det inte finns någon anledning att göra avskrivningar på markområden och aktier bland bestående aktiva med obegränsad ekonomisk livslängd. I fråga om dessa slag av tillgångar innebär god bokföringssed enligt 1 kap. 3 § inte sådan avskrivningsbehandling som avses i den internationella redovisningsstandarden IAS 38. 
I direktivet föreskrivs inte om motsvarande skyldighet som i 2 mom att med hjälp av kostnadsberäkning eller kostnadskalkyler klarlägga i en aktiverad anskaffningsutgift inräknade utgifter för anskaffning och tillverkning, men momentet kan inte anses stå i strid med direktivet. Det är också ändamålsenligt med tanke på en eventuell kontroll i efterhand. Därför föreslås det att momentet hålls kvar i paragrafen. 
Paragrafens 3 mom. är baserad på artikel 38 i det tidigare fjärde direktivet. Trots att det nya direktivet inte innehåller någon motsvarande artikel kan samma förfarande dock iakttas i enlighet med väsentlighetsprincipen i artikel 6.1 j, som det föreskrivs om ovan i 3 kap. 2 a §. För att tydliggöra detta får momentet stå kvar i lagen. 
5 a §.Periodisering av anskaffningsutgiften för immateriella rättigheter. Paragrafens 1 mom. är baserad på första stycket i artikel 12.11som lyder: ”Immateriella anläggningstillgångar (eng. intangible assets) ska skrivas av under tillgångens förväntade nyttjandeperiod.” I det tidigare fjärde direktivet fanns inte någon motsvarande bestämmelse. 
Momentet motsvarar första meningen i den gällande bestämmelsen. Ordalydelsen har emellertid preciserats så att den är mera förpliktande, i syfte att understryka att den bokföringsskyldiga inte kan välja direkt kostnadsföring i stället för aktivering. Uppräkningen av posterna är baserad på EU-kommissionens tolkningsmeddelande (98/C 16/04) gällande punkt C.1.2 på aktivsidan i det tidigare fjärde direktivets artikel 9 om balansräkningens uppställningsform, där dessa poster nämns. Benämningarna är desamma i det gällande direktivets bilaga III punkt C.I.2 på tillgångssidan. Enligt kommissionens tolkningsmeddelande omfattas sådana immateriella rättigheter av aktiveringsskyldigheten när det är fråga om en köpt rättighet (punkt 11, första meningen): ”Det framgår av direktivets ordalydelse att dessa tillgångar måste tas upp i balansräkningen om de har förvärvats mot vederlag.” Aktiveringstvånget är sålunda ovillkorligt om rättigheten genererar inkomst under flera räkenskapsperioder. En förutsättning för aktiveringen är sålunda, liksom också enligt 5 § 1 mom. om aktivering av materiella tillgångar med lång verkningstid, att tillgångarna förväntas generera inkomst. Till momentet har fogats en bestämmelse om saken. 
Sådana ”motsvarande rättigheter” som avses i momentet utöver de uttryckligen nämnda, är enligt bokföringsnämndens tolkning bl.a. trafiktillstånd och nyttjanderätt till adb-programvaror samt spelrättigheter (utlåtandena 1604/2000 och 1782/2006 samt den allmänna anvisningen 16.10.2007 om avskrivningar enligt plan, punkt 2.9). 
Momentet har preciserats också genom en strykning av termen ”tillgångar”, för att understryka att bestämmelsen avser uttryckligen rättigheter, oberoende av om de är överföringsbara eller inte. Samma precisering har gjorts också i paragrafens rubrik. 
Vidare har momentet kompletterats med förtydligandet att en aktivering ska göras endast då utgiften ”förväntas generera inkomst under flera räkenskapsperioder”. Denna förutsättning motsvarar ordalydelsen i 5 §, som är den grundläggande bestämmelsen om periodisering av en utgift som genererar inkomst under flera räkenskapsperioder. 
Paragrafens 2 mom. motsvarar andra meningen i den gällande paragrafens 1 mom. i fråga om sådana immateriella rättigheter som den bokföringsskyldiga själv har skapat. Aktiveringsskyldigheten sträcker sig inte till sådana, utan den bokföringsskyldiga kan själv välja direkt kostnadsföring i stället för aktivering. Detta är förenligt med EU-kommissionens ståndpunkt. I det ovan nämnda tolkningsmeddelandets punkt 11 andra meningen konstateras: ”Endast i fråga om rättigheter och tillgångar som utvecklats av företaget självt, ges medlemsstaterna enligt direktivet rätt att bestämma om de bör tas upp i balansräkningen eller ej.” 
I överensstämmelse med detta ställningstagande förutsätts i det nya direktivets uppställningsformer att immateriella rättigheter som skapats av företaget självt ska tas upp separat ”- - om nationell lagstiftning medger att de redovisas som tillgångar” (bilaga III punkt C.2 b och bilaga IV punkt V.2 b). 
Av tolkningsmeddelandets ovan nämnda punkt 11 andra meningen framgår också att aktiveringsskyldigheten inte sträcker sig till immateriella tillgångar som erhållits utan vederlag. Bestämmelsen är sålunda dispositiv, vilket innebär att av den bokföringsskyldiga själv skapade eller utan vederlag erhållna immateriella tillgångar – om den bokföringsskyldiga själv å önskar – kan aktiveras och kostnadsföras som avskrivningar enligt plan under framtida räkenskapsperioder. 
Momentet har för tydlighetens skull kompletterats med ett tillägg enligt vilket en förutsättning för aktivering är att utgiften förväntas generera inkomst under flera räkenskapsperioder. Detta motsvarar föregående moment samt 5 § 1 mom. om aktivering av materiella tillgångar med lång verkningstid. 
Jämfört med de lagrum som det hänvisas till ovan har i momentet som en ytterligare förutsättning för utnyttjande av aktiveringsmöjligheten uppställts iakttagande av” försiktighet”. I den gällande bestämmelsen nämns förutsättningen ”särskild försiktighet”. Det finns emellertid ingen egentlig skillnad mellan dessa begrepp, eftersom det är fråga om en bokslutsprincip av det slag som avses i 3 kap. 3 § 1 mom. och som i detta moment understryks genom ett uttryckligt omnämnande. 
Kravet konkretiseras så att bevisbördan läggs på den bokföringsskyldiga. Inkomstförväntningarna ska nämligen dokumenteras i en realistisk budget eller i någon annan planeringskalkyl, så som bokföringsnämnden nämner i sitt ställningstagande 1534/1999. För att försiktighetskravet ska vara uppfyllt måste kalkylen visa att inkomstförväntningarnas reella värde klart överstiger den aktiverade anskaffningsutgiften. 
Kravet på försiktighet är en förutsättning som direktivet tillåter eftersom det är fråga om en medlemsstatsoption och försiktighet är en bokslutsprincip som är förenlig också med direktivet (artikel 6.1 c). Eftersom ett nationellt beslut har fattats om aktiveringsmöjligheten får medlemsstaterna besluta också om förutsättningarna för aktivering. 
I likhet med 1 mom. har också detta moment kompletterats med förtydligandet att en förutsättning för aktivering är att utgiften förväntas generera inkomst under flera räkenskapsperioder. 
I paragrafen ingår inte mot gällande 2 mom. svarande bestämmelser om längsta avskrivningstider. Detta bygger på att direktivet inte ställer några tidsmässiga gränser. Enligt artikel 12.11 första stycket ska immateriella anläggningstillgångar skrivas av ”under tillgångens förväntade nyttjandeperiod”. Motsvarande allmänna bestämmelse om kostnadsföring av anskaffningsutgiften för immateriella tillgångar fanns inte i det tidigare fjärde direktivet. 
Maximitiden på 20 år i nuvarande 2 mom. kan inte anses vara en sådan nationell bestämmelse som direktivet tillåter, eftersom den begränsar den bokföringsskyldigas möjligheter att redovisa immateriella rättigheter på ett sätt som är ägnat att försvåra direktivets centrala syfte, dvs. att ge en rättvisande bild (artikel 4.3). Artikel 12.11 är inte en medlemsstatsoption, vilket innebär att det inte är möjligt att nationellt ställa strängare krav på kostnadsföring än direktivet ställer när det gäller immateriella tillgångar, t.ex. med åberopande av försiktighetsprincipen. 
Enligt gällande 3 mom. kan ministeriet genom förordning utfärda närmare bestämmelser om aktivering av anskaffningsutgiften för immateriella tillgångar. Någon sådan förordning har emellertid inte utfärdats och det behövs sålunda inte ett bemyndigande om saken. God bokföringssed kan vid behov styras av bokföringsnämnden med stöd av bemyndigandet i 8 kap. 2 § 1 mom. 
5 b §.Redovisning av tillgångar som förvärvats genom finansiella leasingavtal. Före 2004 års lagändring (1304/2004) innehöll 6 kap. 18 § specialbestämmelser om hur finansiella leasingavtal skulle behandlas i koncernbokslut. Som motivering till att bestämmelsen upphävdes anfördes bl.a. att tillämpningen av internationella redovisningsstandarder och därmed behandlingen av finansiella leasingavtal i enlighet med dem skulle bli allmänt tillåten i enlighet med det nya 7 a kap. som skulle fogas till lagen. Av denna anledning kunde det inte anses föreligga någon särskild grund för att hålla kvar paragrafen. Vidare påpekades det att skattelagstiftningen inte känner till finansiella leasingarrangemang (regeringens proposition 126/2004, s. 25). 
Trots att 6 kap. 18 § upphävdes finns det andra bestämmelser om finansiella leasingavtal. Exempelvis Finansinspektionens gällande föreskrifter och anvisningar 1/2013 om bokföring och årsredovisning inom finanssektorn innehåller motsvarande bestämmelser om finansiella leasingavtal i kreditinstituts koncernbokslut (dnr 9/01.00/2012, punkt 9.4). 
I redovisningsdirektivet finns inga särskilda bestämmelser om finansiella leasingavtal, men behandling av finansiell leasing enligt de internationella redovisningsstandarderna står inte i konflikt med direktivet, eftersom behandlingen motsvarar den matchningsprincip som avses i 3 kap. 3 § 1 mom. På denna grund föreslås det att i paragrafen tas in bestämmelser om finansiella leasingavtal som utsträcker metoden i IFRS-standarden också till separata bokslut. Bestämmelsen är dispositiv, vilket innebär att varje bokföringsskyldig själv kan besluta om tillämpningen av den. Av kravet på överensstämmelse mellan separata bokslut och koncernbokslut (6 kap. 2 § i mom.) följer att en bokföringsskyldig som behandlar finansiella leasingavtal i sitt separata bokslut enligt IFRS ska iaktta samma förfarande också i ett eventuellt koncernbokslut. 
Trots att skattelagstiftningen inte känner till detta förfarande enligt IFRS, utgör detta inte något hinder för att utsträcka förfarandet till upprättande av separata bokslut. Förfarandet inverkar inte på beskattningen, eftersom ett finansiellt leasingavtal kan elimineras i skattedeklarationen. I beskattningspraxis har redan behandlats vissa sale and lease back -arrangemang på samma sätt som finansiella leasingavtal, vilket innebär att försäljningen eller köpet inte har gett upphov till någon överlåtelse i beskattningshänseende (t.ex. HFD 1990 L 2531). 
Paragrafen motsvarar den upphävda (1304/2004) koncernbestämmelsen i 6 kap 18 § 1 mom. med den preciseringen att vid behandlingen av finansiella leasingarrangemang och bedömningen av förutsättningarna för sådana ska iakttas de internationella IFRS-standarder som antagits inom EU genom IAS-förordningen. Avsikten är att förfarandet ska vara så enhetligt som möjligt för de bokföringsskyldiga som i enlighet med 7 a kap. iakttar IFRS-standarderna i sin helhet. I momentet reserveras dock en möjlighet att vid behov genom förordning av statsrådet föreskriva om undantag vid tillämpningen av standarderna och likaså om eventuella ytterligare krav. Denna option är av samma slag som enligt kapitlets 5 a och 5 b §. 
Momentet innehåller också en bestämmelse om enhetligt förfarande. Detta innebär att det inte är möjligt att tillämpa redovisning enligt IFRS på endast vissa finansiella leasingavtal. Sålunda ska redovisningen av finansiella leasingarrangemang som gjorts under tidigare räkenskapsperioder i regel justeras i överensstämmelse med det ändrade förfarandet. Med stöd av den övergångsbestämmelse som föreslås nedan kan den bokföringsskyldiga dock övergå till det nya förfarandet också på så sätt att endast händelser som skett efter lagändringen ska redovisas i enlighet med de föreslagna bestämmelserna. 
Om den bokföringsskyldiga tillämpar den ”bruttometod” som paragrafen möjliggör, behöver i bokslutsnoter inte ytterligare anges uppgifter om ansvarsförhållandena i dessa avtal, om inte bokslutet till denna del ger en felaktig bild. 
5 c §.Redovisning av kapitallån i balansräkningen. Till kapitlet har fogats en ny paragraf som möjliggör ett särskilt förfarande för redovisning av sådana kapitallån som avses i aktiebolagslagen och lagen om andelslag. Det är motiverat att i bokföringslagen i enlighet med IFRS-standarderna föreskriva att möjligheten kan utsträckas också till sådana bokföringsskyldiga som inte iakttar standarderna som sådana. Paragrafen gör det möjligt att ta upp lån i eget kapital på en egen rad så att de hänförs till det egna kapital som framgår av balansräkningen. 
Enligt paragrafen får som en separat post i det egna kapitalet tas upp kapitallån som aktiebolaget eller andelslaget med beaktande av villkoren anses ha karaktären av eget kapital, på motsvarande sätt som förutsätts i fråga om värdepapper som ska hänföras till det egna kapitalet enligt de redovisningsstandarder som godkänts genom IAS-förordningen. 
Förfarandet är baserat på den bokföringsskyldigas prövning. De centrala villkoren för låneinstrumentet ska uppges i bokslutsnoterna. Den bokföringsskyldiga ansvarar för bedömningen. 
Den materiella innebörden av villkoren för ett värdepapper har en avgörande betydelse. Värdepapperet ska i enlighet med IFRS-standarderna ha karaktär av eget kapital för att det ska kunna tas upp bland eget kapital i balansräkningen. Ett värdepapper som uppenbart är av skuldebrevskaraktär kan enligt bestämmelsen inte hänföras till det egna kapitalet trots att det kallas ett kapitallån. Sålunda är själva benämningen inte avgörande i detta avseende. 
Det bokföringsskyldiga företaget bedömer om det är fråga om ett värdepapper i eget kapital. Företaget kan vid behov ta hjälp av IFRS-standarderna för tolknigen. Bestämmelsen är dispositiv, dvs. inte tvingande utan endast en option för företaget. Sådana element när det gäller egna kapitallån enligt IFRS-standarderna har i praktiken bl.a. varit att 
- lånet är efterställt, 
- lånet saknar förfallodag, samt att 
- avkastning har kunnat betalas på lånet endast i situationer där den bokföringsskyldiga också haft möjlighet att få utdelning. 
En förutsättning för redovisning av kapitallån i eget kapital är sålunda att de ovan nämnda villkoren uppfylls eller att det bokföringsskyldiga företaget annars kan bekräfta att värdepapperet på det sätt som bestämmelsen förutsätter avser eget kapital. Kapitallån som inte redovisas i eget kapital ska hänföras till främmande kapital. 
Avsikten är att den bokslutsrad på vilken ett finansiellt instrument har redovisats inte ska ha någon betydelse för skattebehandlingen av värdepapperet. 
8 §.Periodisering av forsknings- och utvecklingsutgifter. I paragrafens 1 mom. kvarstår i fråga om immateriella tillgångar förpliktelsen att i enlighet med den internationella redovisningsstandarden IAS 38 kostnadsföra forskningsutgifter, eftersom direktivet inte tillåter att de aktiveras i balansräkningen. Enligt direktivet gäller aktiveringsmöjligheten numera endast utvecklingsutgifter (artikel 12.11 andra stycket), medan det tidigare fjärde direktivet (artikel 37.1 första stycket) utsträckte samma möjlighet också till forskningsuppgifter. I Finland har denna möjlighet emellertid inte realiserats. 
Varken i direktivet eller i den gällande bokföringslagen och förordningen definieras vad som avses med forskningsutgifter. I förarbetena till den gällande lagen (arbetsgruppen för revidering av bokföringslagen 1995, rapport I, s. 86) räknas upp typisk forskningsverksamhet, bl.a. anskaffning av ny information, sökning av tillämpningsobjekt för informationen, sökning av alternativa produkter och processer samt projektering av nya och förbättrade produkt- och processalternativ. Denna beskrivning kan användas för tolkningen av momentet. 
Paragrafens 2 mom. har i fråga om ordalydelsen preciserats i överensstämmelse med artikel 12.11 andra stycket, som sammanhänger med det första stycket i samma artikel. Bestämmelserna i artikeln lyder: 
- första stycket: ”Immateriella anläggningstillgångar [eng. intangible assets] ska skrivas av under tillgångens förväntade nyttjandeperiod.” 
- andra stycket första meningen: ”Om den förväntade nyttjandeperioden för kostnader för utveckling och goodwill undantagsvis [eng. in exceptional cases] inte kan uppskattas tillförlitligt ska sådana tillgångar skrivas av inom en maximal tidsperiod som medlemsstaten fastställer.” 
- andra stycket andra meningen: ” Denna maximala tidsperiod får inte vara kortare än fem år och får inte överskrida tio år.” 
- andra stycket tredje meningen: ” En förklaring av den period under vilken goodwill skrivs av ska lämnas i noterna till den finansiella rapporten.” 
Till åtskillnad från vad som tidigare varit fallet är regleringen av utvecklingsutgifter inte en medlemsstatsoption. I det tidigare fjärde direktivets artikel 37.1 om forsknings- och utvecklingsuppgifter hänvisades till artikel 34.1 a som hänsköt frågan om huruvida aktiveringsmöjligheter skulle tillåtas till den nationella lagstiftaren. Av artikel 12.11 som nämns ovan framgår att någon sådan prövningsrätt inte längre finns och att aktivering är tillåten direkt med stöd av direktivet. Utvecklingsutgifter måste avskrivas under sin verkningstid, vilket innebär att utvecklingsutgifter som genererar inkomst under flera räkenskapsperioder blir föremål för aktivering. 
Den i momentet angivna maximitiden för kostnadsföring av aktivering, som sålunda gäller situationer där det inte varit möjligt att tillförlitligt uppskatta den ekonomiska verkningstiden, har förkortats från 20 till 10 år i enlighet med artikel 12.11 andra stycket andra meningen. Dessutom har strukits kravet att ”särskild” försiktighet ska iakttas vid aktiveringen. Den nationella lagstiftaren har inte någon möjlighet att ställa ett sådant krav, eftersom artikel 12.11 inte är en medlemsstatsoption. Förutsättningen behövs inte längre ens materiellt i syfte att förhindra överstora aktiveringar, eftersom ett mot aktiveringen svarande belopp på grund av kompletteringen av 13 kap. 5 § i aktiebolagslagen och 16 kap. 6 § i lagen om andelslag begränsar vinstutdelningen. Trots att denna begränsning är en helt nationell bestämmelse står den inte i strid med direktivet. 
Innan denna lagändring träder i kraft ska vid kostnadsföring av aktiveringar i bokslutet dock iakttas den tidigare lagen, såsom framgår av ikraftträdandebestämmelsen i 9 kap. 2 a § 1 mom. 
I artikeln förutsätts inte uttryckligen – till åtskillnad från vad som är fallet med goodwill (andra stycket tredje meningen) – att tidpunkten för kostnadsföringen av en aktiverad utvecklingsutgift anges i noterna. I den gällande bokföringsförordningens 2 kap. 4 § 1 mom. 3 och 4 punkten förutsätts att detta framgår av noterna. Bestämmelserna kan dock kvarstå i förordningen trots att artikel 12.11 inte är en medlemsstatsoption, eftersom kravet på vad som ska framgå av noterna inte begränsar företagets möjligheter att genomföra det förfarande som artikeln tillåter. Det är sålunda fråga om ett tillåtet nationellt informationskrav. 
Begreppet utvecklingsverksamhet definieras inte i direktivet. Enligt den gällande ministerieförordningens 2 § avses å andra sidan med utvecklingsverksamhet tillämpning av forskningsresultat eller annan kunskap för att åstadkomma nya eller väsentligt förbättrade material, anordningar, produkter, processer, system eller tjänster innan kommersiell produktion eller användning påbörjas. Till utvecklingsverksamhet räknas bl.a. utformning, konstruktion och provning av prototyper av modeller innan produktion inleds eller de börjar användas, formgivning av verktyg, jiggar, formar och matriser enligt ny teknik, formgivning, uppförande och drift av en pilotanläggning som inte är av tillräcklig storlek ekonomiskt för kommersiell produktion, samt utformning, konstruktion och provning av ett valt alternativ för nya eller förbättrade material, anordning, produkter, processer, system eller tjänster. 
Ministeriebeslutet motsvarar emellertid inte längre till innehållet de underliggande internationella IAS/IFRS-standarderna och det upphävs sålunda i samband med lagändringen. Detta är emellertid inte ägnat att leda till en kraftig ökning av aktiveringen när det gäller utvecklingsutgifter i bokslutspraxis eftersom 3 mom., som behandlas ovan, begränsar möjligheterna till vinstutdelning med ett belopp som motsvarar aktiveringen. Dessutom kan bokföringsnämnden med stöd av sin reella behörighet enligt 8 kap. 1 § ge utlåtanden om aktivering av utvecklingsutgifter i syfte att styra god bokföringssed som avses i 1 kap. 3 §. 
Behandlingen av utvecklingsutgifter i bokslutet ska vara enhetlig. Därmed är det inte möjligt att erhålla en gynnsammare behandling i bokslutet genom att anteckna faktiska utvecklingsutgifter som övriga utgifter med lång verkningstid. Detta framgår ur 2 mom. fjärde meningen, enligt vilken utvecklingsutgifter inte får aktiveras som övriga utgifter med lång verkningstid. 
Det är förenligt med god bokföringssed att tillämpa de internationella IAS/IFRS-standarderna då de inte står i strid med uttryckliga bestämmelser i lag (utlåtande 1767/2005). Om det inte föreligger någon sådan konflikt och nämnden inte har gett närmare anvisningar kan en enskild bokföringsskyldig tillämpa standarden IAS 38 vid redovisningen av sina utvecklingsutgifter. 
9 §.Periodisering av anskaffningsutgiften för goodwill. Ändringarna i denna paragraf är – i likhet med 8 § 2 mom. – baserade på artikel 12.11 som lyder: 
- första stycket: ”Immateriella anläggningstillgångar [eng. intangible assets] ska skrivas av under tillgångens förväntade nyttjandeperiod.” 
- andra stycket första meningen: ”Om den förväntade nyttjandeperioden för kostnader för utveckling och goodwill undantagsvis [in exceptional cases] inte kan uppskattas tillförlitligt ska sådana tillgångar skrivas av inom en maximal tidsperiod som medlemsstaten fastställer.” 
- andra stycket andra meningen: ”Denna maximala tidsperiod får inte vara kortare än fem år och får inte överskrida tio år.” 
- andra stycket tredje meningen: ”En förklaring av den period under vilken goodwill skrivs av ska lämnas i noterna till den finansiella rapporten.” 
På basis av dessa punkter ska tidsfristen enligt den gällande paragrafen – som sålunda gäller situationer där en ekonomiska verkningstiden inte har kunnat uppskatts på ett tillförlitligt sätt – förkortas från 20 till 10 år. Också utformningen av bestämmelsen har förenklats i likhet med 8 § 2 mom. om utvecklingsutgifter. 
Begreppet goodwill definieras varken i direktivet eller i den gällande bokföringslagen och - förordningen. Begreppet är emellertid så pass etablerat i bokföringspraxis att det inte finns något behov av en legaldefintion. Goodwill är alltid baserad på förvärv mot betalning. Den bokföringsskyldiga kan sålunda inte skapa goodwill genom företagsinterna åtgärder. Goodwill uppkommer t.ex. då en bokföringsskyldig köper en del av ett annat företags affärsverksamhet eller hela verksamheten. Goodwillen är ”överpriset”, dvs. den del av köpesumman som överstiger värdet av de köpta nettotillgångarna, varmed i sin tur avses skillnaden mellan de till den köpta affärsverksamheten hörande maskinernas och övriga tillgångars bokföringsvärde och de skulder som hänför sig till affärsverksamheten. Grunderna för betalning av detta ”överpris” är t.ex. ypperliga immateriella produktionsfaktorer i form av affärsplats eller kundförhållanden eller andra liknande faktorer. 
Goodwill kan också uppkomma i samband med fusion (bokföringsnämndens utlåtande 886/1986) eller i samband med avveckling av företag. Den goodwill som skapas internt genom lönsam verksamhet utgör däremot inte goodwill i den bemärkelse som avses i lagrummet. 
Vid kostnadsföring av goodwill som aktiverats i bokslutet före denna lagändrings ikraftträdande ska iakttas den tidigare lagen, så som nedan föreslås i fråga om ikraftträdandet av 9 kap. 2 a § 2 mom. 
I noterna ska enligt artikel 12.11 andra stycket tredje meningen anges avskrivningstiden för goodwill. Motsvarande bestämmelse ingår i den gällande bokföringsförordningens 2 kap. 4 § 1 mom. 4 punkten som har preciserats i överensstämmelse med artikeln på det sätt som framgår nedan. 
10 §.Kapitalrabatt och emissionsutgifter för lån. Denna paragraf är baserad på medlemsstatsoptionen i artikel 12.10 som lyder: ”Om det belopp som ska återbetalas för en skuld är större än det mottagna beloppet, får medlemsstaterna tillåta eller kräva att mellanskillnaden tas upp som en tillgång. Den ska redovisas separat i balansräkningen eller i noterna till den finansiella rapporten. Mellanskillnaden ska skrivas av med ett skäligt belopp varje år och ska vara helt avskriven senast när skulden återbetalas.” 
Det tidigare fjärde direktivets artikel 41 var av samma lydelse, men den var inte en medlemsstatoption utan ålade EU-länderna att tillåta aktivering av kapitalrabatt och emissionsutgifter. Detta medför inte något behov att precisera paragrafen. 
Den gällande paragrafens krav på ”särskild” försiktighet har emellertid ändrats så att den avser en hänvisning till den allmänna försiktighetsprincipen, såsom när det gäller aktivering av immateriella rättigheter som enligt 5 a § 2 mom. förvärvats vederlagsfritt eller skapats av den bokföringsskyldiga själv. Begreppen skiljer sig inte från varandra i materiellt hänseende eftersom det är fråga om den redovisningsprincip enligt 3 kap. 3 § 1 mom. som uttryckligen nämns i detta moment. Försiktighetskravet understryker den bokföringsskyldigas bevisbörda: förväntningarna ska dokumenteras i en realistisk budget eller i någon annan planeringskalkyl (bokföringsnämndens utlåtande 1534/1999) och noteringarna ska göras i ett så tidigt skede som möjligt, så som framgår av nämndens ställningstagande 1887/2012. 
11 §.Periodisering av andra utgifter med lång verkningstid. Ordalydelsen i denna paragraf har förenhetligats med de ändringar som gjorts i 8 § 2 mom. om utvecklingsutgifter och i 9 § om goodwill. 
Trots att bestämmelsen inte är direkt baserad på direktivet framgår det av EU-kommissionens tolkningsmeddelande (98/C 16/04, punkt 43), att bl.a. aktivering av miljöutgifter kunde baseras på det tidigare fjärde direktivets artikel 15.2: ” Om utgifterna för miljöändamål har tillkommit för att förhindra eller reducera framtida skador på miljön eller för att bevara resurser, kan de uppfylla kraven för att tas upp som en tillgång i redovisningen om de, i enlighet med artikel 15.2 i direktivet, är avsedda att användas löpande för ändamålet med företagets verksamhet och om dessutom ett av följande kriterier uppfylls: 
a) Kostnaderna hänför sig till förväntade miljövinster och förlänger livslängden, ökar kapaciteten, eller förbättrar säkerheten eller effektiviteten för företagets tillgångar, eller 
b) kostnaderna reducerar eller förhindrar en trolig förorening av miljön till följd av framtida verksamhet.” 
Det tidigare fjärde direktivets ovan nämnda artikel 15.2 motsvarar det gällande direktivets artikel 2.4 enligt vilket anläggningstillgångar (eng. fixed assets) är tillgångar som ”-- som är avsedda att stadigvarande brukas i företagets verksamhet”. Enligt motiveringen till 1973 års bokföringslag (655/1973) var syftet med 16 § 5 mom. som motsvarade den gällande paragrafen att tillåta aktivering av fasta utgifter under sådana räkenskapsperioder då tillgångens inkomstgenererande effekt inte ännu börjat (regeringens proposition 120/1973). 
Enligt bokföringsnämndens allmänna anvisning 16.10.2007 om avskrivningar enligt plan avses i den gällande paragrafen bl.a. aktivering av utgifter för utbildning, reklam och säljfrämjande åtgärder samt flytt eller omorganisering (punkt 2.9). 
Bestämmelsen gäller också anskaffningsutgifter för adb-programvaror, med undantag för licens eller annan motsvarande rätt som hör till tillämpningsområdet för 5 § 1 mom. Också i det fall att den bokföringsskyldiga själv för eget bruk tillverkar adb-programvaror får de utgifter som föranletts av detta, t.ex. programmeringsarbete som köpts av en underleverantör och personalkostnader, aktiveras om de uppfyller kriterierna för aktivering (bokföringsnämndens utlåtande 1604/2000). Dessutom har den aktiveringsmöjlighet som är baserad på bestämmelsen ansetts utsträcka sig till utgifterna för grundlig reparation av en aktielägenhet och till utgifterna för produktion av en film (utlåtandena 1635/2000, 1662/2001 och 1734/2004) samt till försäljningsprovisioner som betalts under en räkenskapsperiod (utlåtande 1887/2012). 
Enligt det sist nämnda ställningstagandet fick försäljningsprovisionerna aktiveras som övriga långfristiga utgifter i den utsträckning som de genererade inkomst under kommande räkenskapsperioder. Om detta var osäkert skulle försäljningsprovisionen bokföras som årskostnad. Vid upprättandet av bokslutet skulle den bokföringsskyldiga göra en erfarenhetsbaserad uppskattning av i vilken utsträckning försäljningsprovisionerna skulle generera vinst under kommande räkenskapsperioder och göra en uträkning av detta som bokföringsverifikation. Den bokföringsskyldiga skulle följa upp hur försäljningsprovisionerna genererade inkomst på beställningsnivå. Nämnden ansåg att man kunde utgå från en metod som innebär periodisering av provisionsutgifterna på den räkenskapsperiod de fastställdes, medan högst de två följande räkenskapsperioderna kunde tas som utgångspunkt. 
Sådana utgifter med lång verkningstid som är föremål för aktivering ska beroende på sin karaktär tas upp bland materiella eller immateriella bestående aktiva. I balansschemat i bokföringsförordningens 1 kap. 6 § 1 mom. är benämningarna ”Övriga immateriella tillgångar” och ”Övriga materiella tillgångar”. 
Som övriga utgifter med lång verkningstid kan emellertid – exempelvis för undvikande av en utdelningsbegränsning – aktiveras utvecklingsutgifter, eftersom dessa omfattas av det förfarande som beskrivs i 8 §. Vid kostnadsföring av andra sådana utgifter med lång verkningstid som i bokslutet aktiverats innan denna lagändring trätt i kraft ska iakttas den tidigare lagen, så som framgår av ikraftträdandebestämmelsen i 9 kap. 2 a § 2 mom. 
12 §.Andra än planenliga avskrivningar. Paragrafens 1 mom. motsvarar den gällande bestämmelsen. För tydlighetens skull har uttrycket ”särskilda skäl” ändrats till ”skattemässiga skäl”. 
Bestämmelsen är baserad på artikel 17.1 b ålägger medelstora och stora företag samt företag av allmänt intresse lämna upplysningar om ”- - anläggnings- eller omsättningstillgångar är föremål för värdejustering uteslutande av skatteskäl, justeringsbeloppet och anledningen till justeringen.” I det tidigare fjärde direktivets artikel 35.1 d (anläggningstillgångar) och artikel 39.1 e (omsättningstillgångar) ingick motsvarande bestämmelser. 
Undantagsbestämmelsen om avskrivningar enligt plan i paragrafens 2 mom. gäller vissa bokföringsskyldiga som faller utanför tillämpningsområdet för direktivet. Till den kategori av bokföringsskyldiga som avses i direktivet hör enligt artiklarna 1a och 1b samt i bilagorna I och II endast aktiebolag samt sådana personbolag vilkas samtliga ansvariga bolagsmän är aktiebolag. 
Tillämpningsområdet för bestämmelsen har emellertid inskränkts jämfört med det gällande momentet såtillvida att undantaget i fråga om avskrivningarnas planenlighet inte längre utsträcks till föreningar eller stiftelser. Det finns ingen grund för att utesluta dessa från skyldigheten att göra avskrivningar enligt plan. Föreningar och stiftelser kan bedriva affärsverksamhet på samma sätt som aktiebolag och andelslag, men i praktiken bedriver de ofta sådan verksamhet i liten skala. 
Å andra sidan gäller undantaget fysiska personer som avses i 1 kap. 1 a § 1 och 2 mom. då dessa upprättar balansräkning för att de ska kunna basera sina avskrivningar direkt på skattebestämmelserna samt bokföringsskyldiga vilkas verksamhet är baserad på fastighetsförvaltning. 
Bokföringsnämnden har i sina ställningstaganden preciserat momentets uttryck ”bokföringsskyldiga vars verksamhet baserar sig på besittning av fastigheter”. Enligt utlåtandena 1712/2003 och 1830/2008 kan ett ömsesidigt fastighetsbolag som hör till tillämpningsområdet för lagen om aktiebolag tillämpa undantagsbestämmelsen, men ett aktiebolag som verkar som ett ömsesidigt fastighetsbolag har inte motsvarande möjlighet, trots att dess syfte inte är att generera vinst, och det får inte heller verkställa utdelning. Nämnden har sedermera i sitt utlåtande 1847/2010 utsträckt denna undantagsmöjlighet enligt momentet till att gälla också ömsesidiga fastighetsbolag som lyder under aktiebolagslagen och som sålunda får avskriva anskaffningsutgiften för bestående aktiva och andra långfristiga utgifter under deras verkningstid, utan någon på förhand upprättad plan. 
Undantaget i fråga om avskrivningar enligt plan kan emellertid tillämpas endast i sådana bolag eller företag vars aktier eller andelar berättigar ägaren enbart till besittning av en sådan lokal för boende eller något annat ändamål i fastighet som tillhör företaget, som uttryckligen anges i bolagsordningen eller i andra stadgar (nämndens allmänna anvisning 12.4.2005 om bostadsaktiebolag, punkt 3.3). Tolkningen av begreppet har sålunda stabiliserats i och med nämndens ställningstaganden och det finns inte något behov att till denna del ändra momentets ordalydelse. 
Bokföringsnämnden har också preciserat hur avskrivningar som inte gjorts enligt plan i praktiken ska genomföras. Enligt utlåtandet 1805/2007 ska sådana tillgångar ”dock alltid avskrivas under sin verkningstid, som i praktiken avser högst tillgångens tekniskekonomiska brukstid. Kravet inkluderar ett förbud mot övervärdering av bestående aktiva: om man upptäcker att tillgångens verkliga värde har fallit till en lägre nivå än den oavskrivna anskaffningsutgiften ska en tillräckligt stor avskrivning eller i undantagsfall en nedskrivning göras. Likaså ska de tvingande bestämmelserna i BFL 5 kapitlet följas också i de fall då ingen avskrivningsplan upprättas.” 
”Om en tillgång som hör till bestående aktiva enligt lagen ska aktiveras kan den inte i sin helhet genast bokföras som kostnad, om förutsättningarna för aktivering fortfarande gäller. Avvikelser från denna huvudregel kan endast göras i de situationer som bokföringsnämnden särskilt har definierat. Till dessa hör främst bokföring enligt nettoprincipen av anskaffningsutgiften för en tillgång som hör till bestående aktiva, om denna har täckts med ett bidrag, samt bokföring av anskaffningsutgiften för tillgångar med kort ekonomisk livslängd som årskostnader med beaktande av väsentlighetsprincipen och försiktighetsprincipen.” 
I det sist nämnda utlåtandet ansåg bokföringsnämnden dessutom att var önskvärt att också de bokföringsskyldiga som är undantagna från skyldigheten att utträtta en avskrivningsplan beaktar kontinuitet och konsekvens. Momentets nya andra och tredje mening baserar sig på nämndens ställningstaganden i dessa avseenden. 
13 §.Nedskrivning. Denna paragraf är baserad på artikel 12.6 b som lyder: ” Anläggningstillgångar [eng. fixed assets] ska – oberoende av om de har en begränsad ekonomisk livslängd eller inte – värdejusteras i syfte att åsätta dem det lägre värde de har på balansdagen, om det kan förutses att värdeminskningen är bestående.”(eng. if it is expected that the reduction in their value will be permanent). Ordalydelsen i paragrafen har preciserats med förtydligandet av nedskrivningens varaktighet ska bedömas beroende på om den beräknas bli mindre. Det är sålunda inte fråga om en med absolut säkerhet oåterkallelig nedskrivning, men nedskrivningen ska dock vara mer än sannolikt varaktig. 
Av paragrafen framgår också den inverkan på resultatet som nedskrivningen ska ha enligt artikel 12.6 c: ” De värdejusteringar som avses i leden a och b ska debiteras resultaträkningen och anges separat i noterna till den finansiella rapporten om de inte har tagits upp särskilt i resultaträkningen.” Motsvarande bestämmelse ingick också i det fjärde direktivets artikel 33.1 c cc. 
Om en nedskrivning inte tas upp på en egen rad i resultaträkningen ska den enligt den nämnda artikeln tas upp i en not. En bestämmelse om saken ingår i nya 3 a punkten i bokföringsförordningens 2 kap. 3 § 1 mom. om noter till resultaträkningen. 
I paragrafen används för bedömningen av en nedskrivnings behövlighet uttrycket ”den sannolika framtida inkomsten”. Om en tillgång deltar i den bokföringsskyldigas produktion ska dess värde beräknas i förhållande till de förväntade inkomsterna av denna verksamhet. Det är motiverat att i granskningen beakta nuvärdet av de framtida förväntade inkomsterna, om de genererade inkomsterna fördelar sig över en lång tid. Om däremot en post med lång verkningstid är en investering motsvarar de till den anslutna inkomstförväntningarna bäst det sannolika överlåtelsepriset (regeringens proposition 173/1997). 
Enligt bokföringsnämndens ställningstaganden ska också väsentliga förändringar i de förväntade inkomsterna av bestående aktiva i första hand beaktas genom ändring av avskrivningsplanen. Endast då en ändring är plötslig, dvs. oförutsedd, utgör den en grund för nedskrivning (utlåtande 1795/2007). I det fall som avsågs i det nämnda utlåtandet hade ett vattenandelslags vattenledningsrör blivit helt överflödiga i och med att kommunen byggt ett ersättande vattenledningsnätverk. Samma ställningstagande upprepades i utlåtandet 1810/2008. I nämndens allmänna anvisning 16.10.2007 om avskrivningar enligt plan ges också andra exempel på omständigheter som kan verifiera en nedskrivning (punkt 6.2). 
Enligt artikel 12.6 d får ”- - värdering till det lägre värdet [enligt artikel 12.6 b] inte bibehållas, om skälen för värdejusteringen har upphört [eng. if the reasons - - have ceased to apply]. Denna bestämmelse gäller inte värdejusteringar som gjorts med avseende på goodwill.” Motsvarande bestämmelse – med undantag för bestämmelsen om goodwill – ingick också i det fjärde direktivets artikel 33.1 c dd. En bestämmelse om saken ingår nedan i 16 § som gäller rättelse av kostnadsföring. 
Det är förenligt med god bokföringssed att tillämpa de internationella IAS/IFRS-redovisningsstandarderna då lagen tiger om frågan och inte heller bokföringsnämnden har gett någon anvisning om saken (utlåtande 1767/2005). I övervägandet av en eventuell nedskrivning kan den bokföringsskyldiga sålunda stödja sig på den internationella redovisningsstandarden IAS 36 i sådana fall då tillämpningen av denna inte leder till ett resultat som strider mot denna lag. 
14 §.Framtida utgifter och förluster samt avsättningar. Denna paragraf som till innehållet motsvarar den gällande bestämmelsen är baserad på artiklarna 6.5 och 12. Den först nämnda artikeln är en medlemsstatsoption och lyder: ” Utöver de belopp som redovisas - - får medlemsstaterna tillåta eller kräva att alla förutsebara skulder [eng. foreseeable liabilities] och möjliga förluster [eng. potential losses] som uppstår under det berörda räkenskapsåret eller under ett tidigare räkenskapsår redovisas, även om dessa skulder eller förluster blir kända först efter balansdagen men före den dag då balansräkningen upprättas.” Motsvarande bestämmelse ingick också i det fjärde direktivets artikel 31.1 a. 
Den nämnda artikeln 12.12 innehåller för sin del bestämmelser om avsättningar som ska täcka skulder. Artikelns första stycke lyder: ” Avsättningar ska täcka skulder [eng. liabilities the nature of which is clearly defined] som till sin karaktär är klart bestämda och som på balansdagen är antingen sannolika eller säkra [eng. either likely to be incurred or certain to be incurred] beträffande sin förekomst, men som är obestämda i fråga om belopp eller tidpunkten då de uppkommer.” 
Kriterierna i paragrafens 1 mom. är baserade på de ovan nämnda artiklarna. Momentet ordalydelse har förtydligats så att enligt ingressen ska i resultaträkningen dras av framtida utgifter och förluster och inte, så som i det gällande momentet ”från intäkter”. 
Paragrafens 3 mom. är baserat på ovan i samband med 1 mom. behandlade artikel 12.12 första stycket som stämmer överens med det tidigare fjärde direktivets artikel 20.1. Den sist nämnda artikeln behandlas i EU-kommissionens tolkningsmeddelande (98/C 16/04, punkt 18). 
-” Avsättningar enligt artikel 20.1 skall täcka sannolika förluster (som uppstår till följd av ännu ej avslutade transaktioner) och sannolika skulder. ” 
- ”Grundsynen bakom dessa avsättningar är att det finns ett samband med tredje man (t.ex. ett leverans- eller servicekontrakt, ett rättsligt förfarande osv.).” 
- ”Avsättningar som uppfyller dessa villkor måste göras oberoende av räkenskapsårets resultat i enlighet med de allmänna principer som fastställs i artikel 31.1 c bb. I denna artikel föreskrivs att hänsyn måste tas till förutsebara risker och möjliga förluster som har uppkommit under innevarande eller tidigare räkenskapsår, även om dessa risker eller förluster blir kända först under perioden mellan balansdagen och dagen för upprättandet av balansräkningen.” 
Momentets ordalydelse har ändrats i syfte att förtydliga upptagandet i balansräkningen. Liksom i den föregående bestämmelsen ska en framtida utgift eller förlust som dragits av under räkenskapsperioden tas upp i balansräkningen som en avsättning då dess exakta belopp är osäkra. Denna anvisning har kompletterats med en bestämmelse om att i annat fall – då både beloppet och realiseringstidpunkten är kända – ska beloppet, beroende på dess karaktär, tas upp i balansräkningen som främmande kapital eller som en resultatregleringspost. 
Artikel 12.2 andra stycket innehåller en medlemsstatsoption om avsättningar också för framtida utgifter: ”Medlemsstaterna får även tillåta att avsättningar görs i avsikt att täcka sådana kostnader [eng. expences] som till sin karaktär är klart bestämda och som på balansdagen är antingen sannolika eller säkra beträffande sin förekomst, men som är obestämda i fråga om belopp eller tidpunkten då de uppkommer.” 
I EU-kommissionens tolkningsmeddelande styrs tillämpningen av denna artikel på följande sätt (98/C 16/04 punkt 19): 
- ”Avsättningar - - skall emellertid inte täcka avsättningar för förluster och skulder utan endast - - kostnader.” 
- ”Även om det inte finns någon skyldighet gentemot tredje man, innebär möjligheten att göra en avsättning i detta fall att bolagen kan beräkna räkenskapsperiodens resultat med större noggrannhet.” 
- ”Detta är avsett att exempelvis täcka större och återkommande underhållskostnader för flera år och utgifter för större reparationer.” 
Av tolkningsmeddelandet framgår indirekt att gränsdragningen mellan å ena sidan årliga kostnader och å andra sidan avsättningar som är baserade på den bokföringsskyldigas egen prövning enligt artikel 12.2 andra stycket – utan förpliktelser mot utomstående – är svår, om inte omöjlig, att göra på ett objektivt sätt. Av denna anledning sätts detta stycke inte i kraft i Finland. Risken med en sådan bestämmelse är att den i första hand skulle leda till resultatreglering, vilket skulle äventyra målsättningen att bokslutet ska ge en rättvisande bild av verksamheten. 
Artikel 12.12 tredje stycket första meningen gäller avsättningens belopp och lyder: ”På balansdagen ska en avsättning motsvara den bästa uppskattningen av de kostnader som sannolikt kommer att uppstå [eng. the best estimate of the expenses likely to be incurred] eller när det gäller en skuld, det belopp som krävs för att återbetala denna skuld” (eng. the amount required to meet that liability). 
Det tidigare fjärde direktivets artikel 42 första stycket var däremot av följande lydelse: ”Avsättningarna för förluster och skulder får inte överstiga erforderliga belopp.” Avsättningar fick sålunda göras också till ett lägre belopp än det sannolika beloppet. I 3 mom föreskrivs på motsvarande sätt att utgifter och förluster ska tas upp högst till sitt sannolika belopp. Detta strider emellertid enligt den första meningen i det nya direktivets ovan nämnda artikel 12.2 tredje stycket – där det uttryckligen föreskrivs om det sannolika beloppet utan att någon underskridning tillåts – och momentet har sålunda ändrats i överensstämmelse med denna artikel. 
Artikel 12.12 tredje stycket andra meningen förbjuder användning av avsättningar som nedskrivningsmetod: ”Avsättningar får inte användas för att justera tillgångarnas värde” [shall not be used to adjust the values of assets]. Motsvarande bestämmelse ingick i det fjärde direktivets artikel 20.3: ”Avsättningar får inte användas för att justera tillgångarnas värde”. 15 §.Skattemässiga reserver. Denna paragraf motsvarar till innehållet den gällande bestämmelsen, som är baserad på 54 § i lagen om beskattning av inkomst av näringsverksamhet (360/1968), där det för att en reservering ska godkännas i beskattningen förutsätts att den har gjorts också i bokföringen. För tydlighetens skull har ordalydelsen kompletterats med en avgränsning varav det framgår att en sådan reservering som avses i paragrafen ska baseras på beskattningen. Samma ändring har gjorts också i paragrafens rubrik. 
Bokföringsnämnden har i sitt utlåtande 1659/2001 förtydligat paragrafens syfte med konstaterandet att ingen företagsform i bokföringslagen har försatts i någon specialställning när det gäller avsättning av reserver. Också allmännyttiga företag kan i sin bokföring göra reserveringar med stöd av 15 §, under förutsättning att de med stöd av 54 § i lagen om beskattning av inkomst av näringsverksamhet på så sätt får skattemässig nytta. I fråga om flertalet allmännyttiga företag uppfylls detta villkor emellertid inte, eftersom de inte har beskattningsbar inkomst av näringsverksamhet. De nämnda företagen är i regel skattskyldiga för näringsinkomster, men de begränsningar som följer av 23 § i inkomstskattelagen (1535/1992) innebär att en stor del av dessa samfunds sedvanliga medelsanskaffning inte betraktas som näringsinkomst. 
I utlåtandet 1692/2001 styrs dessutom tolkningen med avseende på bostadshusreservering enligt lagen 846/1986. Nämnden konstaterade att bostadshusreservering är en sådan reservering enligt bokföringslagens 5 kap. 15 § som alltid förutsätter en skattemässig orsak och att reserveringen ska ha en faktisk inverkan på den bokföringsskyldigas beskattningsbara inkomst. En förutsättning för ett allmännyttigt samfunds bostadshusreservering är alltid att samfundet också har intäkter som kan betraktas som skattepliktiga inkomster och vilkas sammanlagda belopp utgör en på bokföringslagen baserad begränsning när det gäller bostadshusreserveringens maximibelopp. Behovet av upprepade reparationer i bostadsfastigheter ska i första hand beaktas i avskrivningsplanen för byggnaderna. 
Balansräkningens uppställningsformer i direktivets bilagor III och IV innehåller inte någon särskild kategori för skattemässiga reserver, men paragrafen är en sådan nationell bestämmelse som är tillåten enligt artikel 9.2 andra meningen om tillägg av nya poster till uppställningsformerna. Nämnda andra mening lyder: ”Medlemsstaterna ska tillåta en mera detaljerad underindelning av dessa poster, förutsatt att de föreskrivna uppställningsformerna följs.” 
Artikel 9.2 tredje stycket lyder: ”Medlemsstaterna ska tillåta att delsummor och nya poster läggs till, förutsatt att innehållet i sådana nya poster inte omfattas av de i uppställningsformen angivna posterna.” 
Artikel 9.2 fjärde meningen som berättigar medlemsstaterna att kräva sådan närmare specificering både i balansräkningarna och i resultaträkningarna lyder å andra sidan: ”Medlemsstaterna får föreskriva sådana underindelningar, eller delsummor eller nya poster.” Motsvarande bestämmelser ingick också i det fjärde direktivets artikel 4.1, med den skillnaden att den inte gällde delsummor. 
I bokföringsförordningens 1 kap. 9 § har i enlighet med artikel 9.2 andra och fjärde meningen tagits in en bestämmelse som lyder: ”Resultaträkningen och balansräkningen skall upprättas mer detaljerad än vad schemat utvisar, om detta är nödvändigt för att de faktorer som inverkat på räkenskapsperiodens resultatbildning eller balansräkningsposterna skall kunna klargöras.” 
Denna bestämmelse kompletteras ytterligare med en ny 9 a § i syfte att sätta i kraft artikel 9.2 tredje meningen. Den behöver emellertid inte vara förpliktande på samma sätt som enligt artikel 9.2 fjärde meningen. Det blir sålunda beroende av den bokföringsskyldigas egen prövning om sådana poster eller delsummor som inte ingår i uppställningarna ska tas upp i resultaträkningen eller balansräkningen. 
16 §.Rättelse av kostnadsföring. Paragrafens första mening motsvarar till innehållet den gällande bestämmelsen. Den är baserad på direktivets artikel 12.6 d som lyder: ”Värdering till det lägre värdet enligt artiklarna 12.6 a och 12.6 b får inte bibehållas, om skälen för värdejusteringar har upphört (eng. if the reasons - - have ceased to apply). Denna bestämmelse gäller inte värdejusteringar som gjorts med avseende på goodwill.” Artikel 12.6 a som det hänvisas till avser värdejustering av finansiella anläggningstillgångar medan artikel 12.6 b avser värdejustering av anläggningstillgångar. Motsvarande bestämmelse – frånsett undantaget för goodwill – ingick också i det tidigare fjärde direktivets artikel 33.1 c dd. 
En liknande justeringsskyldighet gäller med stöd av artikel 12.7 andra stycket i fråga om omsättningstillgångar (eng. current assets): ”Värdering till det lägre värdet enligt första stycket får inte bibehållas om skälen för värdejusteringen har upphört.” Motsvarande förbud ingick också i det fjärde direktivets artikel 31.1 d. 
Ordalydelsen i paragrafens första mening har förtydligats med ett tillägg som avser rättelse av kostnadsföringar som har gjorts tidigare än under den räkenskapsperiod som bokslutet avser. I meningen har också strukits den onödiga begränsningen att kostnadsföringen ska ha visat sig vara obefogad senast vid utgången av räkenskapsperioden. Det är motiverat att beakta en sådan omständighet också efter räkenskapsperioden, förutsatt att den framgår innan bokslutet upprättats. 
En sådan förpliktelse som avses i paragrafens första mening innebär i praktiken att en nedskrivning som visat sig vara obefogad ska återföras till resultaträkningen. Rättelser ska i regel tas upp i resultaträkningen i samma kategori där motsvarande kostnad tidigare noterats. En återföring av en nedskrivning som avser omsättningstillgångar ska i resultaträkningen enligt bokföringsförordningens 1 kap. 1 § 1 mom. tas upp som förändring av lager (regeringens proposition 173/1997). 
Till åtskillnad från vad som i artikel 12.6 c föreskrivs i fråga om värdejusteringar av aktiva tillgångar, förutsätts i artikel 12.7 första stycket inte några särskilda resultaträknings- eller balansräkningsnoter om värdejusteringar som gäller omsättningstillgångar. 
Med stöd av artikel 16.1 f kan det dock bli aktuellt att i noterna uppge rättelser av kostnadsföringar som har betydelse för resultatet: ”Storleken på och arten av enskilda intäkts- eller kostnadsposter av exceptionell storlek eller förekomst”. I överensstämmelse med denna artikel preciseras bokföringsförordningens 2 kap. 3 § 1 mom. 2 punkten, 
I paragrafens nya andra mening föreskrivs i överensstämmelse med den nämnda artikeln 12.6 d andra meningen om förbud att rätta värdejustering av goodwill. 
17 §.Uppskrivning. Paragrafens 1 mom. motsvarar den gällande bestämmelsens första mening med den ändringen att betoningen ”särskild” försiktighet har strukits, eftersom den inte har någon egentlig betydelse. Momentet är baserat på artikel 7.1 första meningen om en medlemsstatsoption som gör det möjligt att vid värdering av bestående tillgångar avvika från principen om anskaffningspris och produktionsutgift: ”Med avvikelse från artikel 6.1 i får medlemsstaterna tillåta eller kräva att alla företag eller vissa kategorier av företag värderar anläggningstillgångar till omvärderade belopp.” Motsvarande medlemsstatsoption ingick i det tidigare fjärde direktivets artikel 33.1 a. 
I nämnda artikel 7.1 andra meningen förutsätts det däremot att medlemsstaterna ”- - ska - - definiera innehåll och tillämpningsområde samt reglerna för tillämpningen”. Med stöd av denna mening begränsas i 1 mom. omvärderingsmöjligheten dels till jord- och vattenområden – som inte avskrivs – och dels till andra värdepapper än finansiella instrument som avses i 2 a § och värderats till verkligt värde. 
Bokföringsnämnden har i sitt utlåtande 1774/2006 understrukit att den förteckning över de i momentet uppräknade tillgångsposter, på vilka man i bokslutet kan göra en värdeuppskrivning, är uttömmande. Föremål för uppskrivning kan således vara endast jord- eller vattenområden eller värdepapper som inte är finansiella instrument och som hör till bestående aktiva. Konstföremål som aktiverats bland bestående aktiva ingår sålunda inte i tillämpningsområdet för uppskrivningsbestämmelsen och kännetecknas av att de liksom tillgångsposter som kan skrivas upp, i regel obegränsad ekonomisk verkningstid. 
Som en sådan ”gräns” eller ”tillämpningsregel” som avses i artikeln förutsätts i momentet att det sannolika överlåtelsepriset är varaktigt väsentligt högre än den ursprungliga anskaffningsutgiften. 
Paragrafens 2 mom. motsvarar den gällande bestämmelsen. Nya 3 mom. första meningen – som är av samma lydelse som den andra meningen i den gällande paragrafen – gäller uppskrivningsfonden och är baserad på artikel 7.2 första stycket: ” Om punkt 1 tillämpas ska ett belopp som motsvarar skillnaden mellan en värdering enligt anskaffnings- eller tillverkningskostnad och en värdering enligt omvärderingsprincipen tas upp i balansräkningen i uppskrivningsfonden under ’Eget kapital’”. 
Uppskrivningsfonden är – i likhet med fonden för verkligt värde enligt 5 a § – både i aktiebolag och i andelslag en bunden fond som inte kan delas ut till ägarna ens med borgenärernas samtycke. Fonden får inte heller användas för att öka aktiekapitalet (8 kap. § 1 § mom., 11 kap. 1 § 2 punkten och 13 kap. 5 § i aktiebolagslagen (1624/2004), 8 kap. 1 § 1 mom., 11 kap. 1 § 2 punkten och 16 kap. 6 § i lagen om andelslag (421/2013). Momentets andra mening hänvisar till följande bestämmelser i direktivet: 
- Artikel 7.2 tredje stycket tredje meningen: ” Belopp från uppskrivningsfonden får inte delas ut, vare sig direkt eller indirekt, om inte beloppet utgör en realiserad intäkt.” 
- Artikel 7.2 andra stycket: ” Uppskrivningsfonden får när som helst helt eller delvis kapitaliseras.” 
- Artikel 7.2 tredje stycket andra meningen: ” Medlemsstaterna får besluta om regler för uppskrivningsfondens användning, förutsatt att överföringar till resultaträkningen från uppskrivningsfonden får ske endast i den mån de överförda beloppen har varit kostnadsförda i resultaträkningen eller motsvarar realiserade intäkter. Belopp från uppskrivningsfonden får inte delas ut, vare sig direkt eller indirekt, om inte beloppet utgör en realiserad intäkt.” 
Nya 4 mom. – som börjar på samma sätt som den tredje meningen i gällande 1 mom. om återföring av en uppskrivning – har ingen direkt motsvarighet i direktivet men stämmer överens med artikel 7.2 tredje stycket första meningen: ” Uppskrivningsfonden ska minskas om det överförda beloppet till fonden inte längre behövs för tillämpningen av redovisning enligt omvärderingsprincipen.” Motsvarande förpliktelse följde av det tidigare fjärde direktivets artikel 33.2 c. 
Momentet har på motsvarande sätt som ovan kompletterats med en bestämmelse om minskning av uppskrivningsfonden. 
Med tanke på styrningen av finländsk bokslutspraxis har det inte ansetts föreligga något behov att sätta i kraft artikel 7.3 andra meningen, som lyder: ” Genom undantag från artiklarna 9 och 13 får medlemsstaterna emellertid tillåta eller kräva att endast beloppet av värdejusteringar på grundval av anskaffnings- eller tillverkningskostnad redovisas under respektive poster i de uppställningsformer som anges i bilagorna V och VI och att den skillnad som uppkommer som ett resultat av värdering enligt omvärderingsprincipen enligt denna artikel redovisas separat i uppställningen.” 
18 §.Latenta skatteskulder och skattefordringar. Denna paragraf motsvarar den gällande bestämmelsen med den justeringen att ordet ”särskild” före försiktighet har strukits, eftersom detta attribut inte har någon självständig betydelse. 
Paragrafen är inte direkt baserad på direktivet men i artikel 17.1 f förutsätts det i fråga om stora och medelstora företag samt företag av allmänt intresse följande upplysningar: ” Om uppskjuten skatt redovisas i balansräkningen, uppskjutna skattebelopp i slutet av räkenskapsåret, och förändringarna i denna post under räkenskapsåret.” Direktivet ger sålunda möjlighet att i resultaträkningen och balansräkningen beakta latenta skatteskulder, vilket innebär att den gällande bestämmelsen ska anses vara förenlig med direktivet. 
Artikel 9.2 fjärde meningen berättigar å andra sidan medlemsstaterna att kräva noggrannare specificering både i balansräknings- och i resultaträkningsschemat: ” Medlemsstaterna får föreskriva sådana underindelningar, eller delsummor eller nya poster.” En bestämmelse om saken har tagits in i 9 a § i bokföringsförordningens 1 kap., som behandlas ovan i samband med 15 § i detta kapitel. 
Motsvarande bestämmelser ingick också i det fjärde direktivets artikel 4.1. Dessutom förutsattes det i artikel 43.1.11 att i noterna skulle uppges skillnaden ”mellan å ena sidan de skatter som har påförts detta och tidigare räkenskapsår samt å andra sidan de skatter som har betalats eller skall betalas för dessa år, förutsatt att skillnaden har betydelse för den framtida beskattningen. Summan får även särredovisas med ett totalbelopp i balansräkningen i en särskild post med lämplig beteckning.” 
Paragrafens ordalydelse har förenklats så att kravet på ”särskild” försiktighet avser en hänvisning till den allmänna försiktighetsprincipen, på samma grunder som ovan i samband med 5 a § 2 mom. i detta kapitel. 
Bokföringsnämnden har 12.9.2006 gett en allmän anvisning om behandling av latenta skatteskulder och skattefordringar i bokföringen och bokslutet. 
20 §.Eget bruk. Denna paragraf upphävs som obehövlig eftersom det är förenligt med de grundläggande bokföringsprinciperna att en tillgång som utnyttjas för eget bruk tas upp till värdet enligt balansräkningen, dvs. till den oavskrivna anskaffningsutgiften eller – i enlighet med försiktighetsprincipen – till ett lägre sannolikt överlåtelsepris. Detta förfarande är förenligt med de ovan i 19 § nämnda artiklarna 6.1 c, 12.5, 12.6 b och 12.7. 
6 kap. Koncernbokslut
I detta kapitel föreskrivs när en bokföringsskyldig utöver sitt eget bokslut ska upprätta ett koncernbokslut. Denna förpliktelse är baserad på det som i 1 kap. 5 § föreskrivs om bestämmande inflytande hos en annan bokföringsskyldig. I kapitel 6 föreskrivs också om upprättande av koncernbokslut. 
Den grundläggande principen är att effekterna av koncernföretagens interna åtgärder ska elimineras för att koncernbokslutet ska ge en bild av koncernen som en ekonomisk helhet. Efter elimineringarna ska i koncernbokslutet endast återstå de inkomster och fordringar som hänför sig till utomstående aktörer och likaså innehav i företag utanför koncernen. I princip ska transaktioner, exempelvis interna köp och försäljningar, mellan koncernföretagen inte ge upphov till noteringar i bokföringen, om den ekonomiska verksamhet som koncernen avser vore organiserad som ett enda företag i stället för som en koncern. Ett koncernbokslut gör det sålunda möjligt att sinsemellan jämföra företagshelheter som är organiserade på olika sätt. 
Särskilda bestämmelser om utformningen av koncernbokslut – om posterna i koncernbalansräkningen och -resultaträkningen – ingår i bokföringsförordningens 3 kap. och om koncernnoter i samma förordnings 4 kap. För upprättande av koncernbokslut krävs en komplex beräkningsteknik med olika elimineringar, vilket framgår av bokföringsnämndens allmänna anvisning 2.11.2006. 
På grund av det nya direktivet har i kapitlet gjorts ett antal justeringar av teknisk karaktär. Det föreslås att kapitlets 9 § om poolningsmetoden upphävs, vilket är den viktigaste ändringen i fråga om innehållet. Denna metod för eliminering av koncerninterna innehav är inte längre ett enligt direktivet tillåtet alternativ till förvärvsmetoden som föreskrivs i 8 §. 
1 §.Skyldighet att upprätta koncernbokslut. Paragrafens 1 mom. 1 - 3 punkterna motsvarar den gällande bestämmelsen om moderföretag som enligt direktivet är skyldiga att upprätta koncernbokslut. Direktivets artikel 21 lyder: ”Med avseende på tillämpningen av detta kapitel ska ett moderföretag och alla dess dotterföretag omfattas av en koncernredovisning, om moderföretaget är ett företag på vilket de samordningsåtgärder som föreskrivs i detta direktiv är tillämpliga på grundval av artikel 1.1.” 
Artikel 1.1 lyder: ”De samordningsåtgärder som detta direktiv föreskriver ska vidtas i fråga om bestämmelserna i medlemsstaternas lagar eller andra författningar om de företagsformer som förtecknas 
a) i bilaga I, 
b) i bilaga II, om alla direkta eller indirekta delägare i företaget som i övrigt har obegränsat ansvar i själva verket har begränsat ansvar, på grund av att dessa delägare är företag som 
i) är av den typ som förtecknas i bilaga I, eller 
ii) inte omfattas av lagstiftningen i en medlemsstat men har en rättslig form som är jämförbar med de former som förtecknas i bilaga I.” 
I bilaga I nämns för Finlands del som en sådan företagsform privata och publika aktiebolag och i bilaga II öppna bolag och kommanditbolag. 
Motsvarande bestämmelser ingick tidigare i det sjunde direktivets artikel 4.1 (Första stycket: ” Vid tillämpningen av detta direktiv skall ett moderföretag och alla dess dotterföretag omfattas av en sammanställd redovisning, om antingen moderföretaget eller ett eller flera av dotterföretagen har upprättats i någon av följande bolagsformer: - - n) I Finland osakeyhtiö/aktiebolag - -”. Andra stycket: ”En medlemsstat får dock medge undantag från skyldigheten enligt artikel 1.1, om moderföretaget inte har upprättats i någon av de bolagsformer som anges i punkt 1.” 
Momentet kompletteras med en ny 4 punkt som ålägger andelslag att upprätta koncernbokslut. Detta är motiverat eftersom andelslag i likhet med aktiebolag driver affärsverksamhet. 
Ovan i 1 kap. 5 § föreskrivs om bestämmande inflytande som baseras på koncernförhållande. Moderföretaget och dess dotterföretag benämns koncernföretag (1 kap. 6 § 1 mom. andra meningen). 
Paragrafens 2 mom. innebär liksom den gällande bestämmelsen att skyldigheten att upprättat koncernbokslut utsträcks också till andra moderföretag än sådana som definieras i direktivet, men i fråga om dem är det ändamålsenligt att avgränsa skyldigheten till moderföretag som driver rörelse. 
Villkoret ”driver rörelse” bör dock inte tolkas snävt. Också en bokföringsskyldig som enbart är verksam som holdingföretag anses driva rörelse och är sålunda skyldig att upprätta koncernbokslut, om den bokföringsskyldiga aktivt deltar i ledningen eller finansieringen av sina dotterföretag eller i någon annan jämförbar verksamhet. Stiftelser, ideella föreningar och pensionskassor anses på samma grunder driva rörelse (regeringens proposition 173/1997). Bokföringsnämnden har i sitt utlåtande 1519/1998 intagit den ståndpunkten att en stiftelse skulle upprätta koncernbokslut. Mellan stiftelsen och dess dotterföretag hade förekommit affärstransaktioner, stiftelsen hade gått i borgen för dotterföretagen och beviljat dem lån. Stiftelsen och dotterföretagen hade också haft samma ledning. 
Nämnden ansåg å andra sidan att en privatperson inte själv kan vara skyldig att upprätta koncernbokslut enbart på den grunden att personen i fråga på grund av aktiemajoritet eller av någon annan motsvarande orsak har bestämmande inflytande i den bokföringsskyldiga (allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 2.1). 
Till åtskillnad från moderföretag gäller kravet ”driver rörelse” inte dotterföretag. Skyldighet att upprätta koncernbokslut uppkommer trots att inte ett enda dotterföretag skulle driva rörelse. Exempelvis bostads- och fastighetsaktiebolag, som i allmänhet inte driver rörelse, kan vara av betydelse för koncernbalansräkningen (regeringens proposition 173/1997). 
I paragrafens 3 mom. föreskrivs om undantag från skyldigheten att upprätta koncernbokslut för små koncerner. Momentet har ändrats i överensstämmelse med artikel 23.1 som lyder: ”Små koncerner ska undantas från skyldigheten att upprätta en koncernredovisning och en förvaltningsberättelse för koncern, utom när ett koncernföretag är ett företag av allmänt intresse.” Motsvarande bestämmelse fanns inte i det tidigare sjunde direktivet. 
Eftersom artikeln inte är en medlemsstatsoption ska den sättas i kraft utan nationella undantag. Skyldigheten att upprätta koncernbokslut inbegriper sålunda inte små koncerner som avses i 1 kap. 6 a § 1 mom. 1 punkten. De är fråga om koncerner som överskrider högst en av de gränser som anges i kapitlets 4 b §, dvs. balansomslutning 6 000 000 euro, omsättning 12 000 000 euro eller i genomsnitt 50 anställda. 
Den grund för undantag från skyldigheten att upprätta bokslut som avses i artikeln är ovillkorlig, vilket innebär att det i den nationella lagstiftningen eller i rättspraxis inte kan förutsättas att koncernbokslut upprättas ens för att ge en rättvisande bild. En precisering har tagits in i momentet. En bokföringsskyldig som är moderföretag i en liten koncern behöver sålunda inte överväga att upprätta koncernbokslut för att ge en rättvisande bild. Trots denna allmänna målsättning att ge en rättvisande bild kan en bokföringsskyldig dock inte klandras om den inte upprättar något koncernbokslut. Det är en annan sak att det också för en sådan bokföringsskyldig kan vara ändamålsenligt att upprätta koncernbokslut. Den bokföringsskyldiga kan sålunda alltid frivilligt upprätta ett koncernbokslut. 
Medlemsstaterna har å andra sidan möjlighet – men inte skyldighet – att med stöd av artikel 23.2 undanta också medelstora koncerner från skyldigheten att upprätta koncernbokslut: ” Medlemsstaterna får undanta medelstora koncerner från skyldigheten att upprätta en koncernredovisning och en förvaltningsberättelse för koncern, utom när ett koncernföretag är ett företag av allmänt intresse.” Det är emellertid inte ändamålsenligt att i Finland utnyttja denna medlemsstatsoption, eftersom redan de gränsvärden som ger rätt att undanta små koncerner från skyldigheten är relativt höga med beaktande av de finländska företagens genomsnittliga storlek. Detta är för sin del en motivering till att i lagen inte behövs en särskild definition av medelstora företag. 
Skyldigheten att upprätta koncernbokslut gäller i princip också moderföretag som själva står under bestämmande inflytande av ett annat företag, dvs. är dess dotterföretag. I en sådan situation är det i princip inte ändamålsenligt med flera koncernbokslut, eftersom den helhetsbild av den största koncernens ekonomiska ställning och resultat som dess koncernbokslut ger är viktigast. I enlighet härmed föreskrivs i 4 mom. om de förutsättningar under vilka koncernbokslut inte behöver upprättas. 
Paragrafens 4 mom. motsvarar den gällande bestämmelsen och är baserat på artiklarna 23.3 och 23.4 som ålägger medlemsstaterna att nationellt sätta i kraft bestämmelserna om undantag från skyldigheten att upprätta koncernbokslut. Bestämmelsen innebär sålunda inte en medlemsstatsoption. Motsvarande förpliktelse följde av det sjunde direktivets artiklar 7.1 och 7.2. 
Den först nämnda artikeln 23.3 lyder: ”Trots punkterna 1 och 2 i den här artikeln får en medlemsstat i följande fall undanta varje moderföretag (det undantagna företaget) som lyder under medlemsstatens nationella lagstiftning och som också är ett dotterföretag, inbegripet ett företag av allmänt intresse såvida det inte omfattas av artikel 2.1 a, från skyldigheten att upprätta en koncernredovisning och en förvaltningsberättelse för koncern, om dess eget moderföretag lyder under lagstiftningen i en medlemsstat och 
a) moderföretaget till det undantagna företaget äger samtliga aktier eller andelar i det företag som ska undantas; därvid ska bortses från aktier eller andelar som ledamöter i det undantagna företagets förvaltnings-, lednings- eller tillsynsorgan äger på grund av en rättslig skyldighet eller i enlighet med det företagets statuter, eller 
b) moderföretaget till det undantagna företaget äger minst 90 % av aktierna eller andelarna i det undantagna företaget och de återstående aktieägarna eller delägarna i det undantagna företaget har godkänt undantaget.” 
Artikel 23.4 lyder som följer: ” De undantag som avses i punkt 3 ska uppfylla samtliga följande villkor: 
a) Det företag som ska undantas och, utan att det påverkar tillämpningen av punkt 9, alla dess dotterföretag omfattas av koncernredovisningen för en större koncern med ett moderföretag som lyder under en medlemsstats lagstiftning. 
b) Den koncernredovisning som avses i led a och förvaltningsberättelsen för koncern i större koncerner upprättas av moderföretaget i denna koncern, i enlighet med lagstiftningen i den medlemsstat som moderföretaget lyder under, i enlighet med detta direktiv eller internationell redovisningsstandard som antagits i enlighet med förordning (EG) nr 1606/2002. 
c) När det gäller det undantagna företaget offentliggörs följande dokument på sådant sätt som föreskrivs i den medlemsstat under vilkens lagstiftning det undantagna företaget lyder och i överensstämmelse med artikel 30: 
i) Den koncernredovisning som avses i led a och den förvaltningsberättelse för koncern som avses i led b. 
ii) Revisionsberättelsen. 
iii) I förekommande fall den bilaga som avses i punkt 6. 
Medlemsstaten får kräva att de handlingar som avses i leden i, ii och iii offentliggörs på den statens officiella språk och att översättningen är bestyrkt. 
d) Noterna till årsbokslutet för det företag som ska undantas innehåller följande: 
i) Namn och säte för det moderföretag som upprättar den koncernredovisning som avses i led a. 
ii) Undantaget från skyldigheten att upprätta koncernredovisning och förvaltningsberättelse för koncern.” 
Det krav i fråga om noterna som föreskrivs i artikel 23.4 c andra stycket ingår i bokföringsförordningens 2 kap. 10 § 2 mom., som behandlas nedan. 
Det nämnda andra stycket ger också Finlands lagstiftare möjlighet att kräva att utländska koncernbokslutsdokument ska översättas till finska eller svenska. Ett sådant tilläggskrav behövs emellertid inte eftersom det redan i 4 mom. 2 punkten förutsätts att de övriga ägare som i förhållande till en utländsk majoritetsägare är i minoritet har vetorätt när det gäller utnyttjande av den undantagsmöjlighet som föreskrivs i momentet. De kan sålunda i sitt övervägande att utnyttja vetorätten beakta också språkfrågan. 
Paragrafens nya 6 mom. är baserat på artikel 23.10 som ålägger medlemsstaterna att göra undantag från skyldigheten att upprätta koncernbokslut. En motsvarande bestämmelse ingick i det sjunde direktivets artikel 13.2 a, men den har inte satts i kraft i Finland. 
Den ovan nämnda artikeln 23.10 lyder: ” Utan att det påverkar tillämpningen av artiklarna 6.1 b och 21 samt punkterna 1 och 2 i den här artikeln ska varje moderföretag, inbegripet ett företag av allmänt intresse, undantas från skyldigheten i artikel 22 om 
a) det endast har dotterföretag som är av ringa betydelse, både var för sig och tillsammans, [eng. it only has subsidiary undertakings, which are immaterial, both individially and collectively) eller 
b) alla dess dotterföretag kan undantas från konsolideringen med stöd av punkt 9.” 
De ovan nämnda artiklar som det hänvisas till ovan är: 
- Artikel 6.1 b: ”Redovisningsprinciper och värderingsgrunder ska tillämpas konsekvent från ett räkenskapsår till ett annat.” 
- En sådan allmän bestämmelse ingår i 3 kap. 1 § 2 mom. I detta moment hänvisas åter till det genom att i 1 punkten uttryckligen förutsätts att dotterföretagen inte ska vara väsentliga för att ge en rättvisande bild av koncernen under den avslutade och den föregående räkenskapsperioden, för att koncernbokslut inte ska behöva upprättas. 
- Artikel 21: ”Tillämpningsområdet för koncernredovisningar och andra berättelser: Med avseende på tillämpningen av detta kapitel ska ett moderföretag och alla dess dotterföretag omfattas av en koncernredovisning, om moderföretaget är ett företag på vilket de samordningsåtgärder som föreskrivs i detta direktiv är tillämpliga på grundval av artikel 1.1.” 
- Artikel 23.1: Medlemsstatsförpliktelsen att undanta små koncerner från skyldigheten att upprätta koncernbokslut. – Motsvarande bestämmelse ingår i 3 mom. 
- Artikel 23.1: Medlemsstatsoptionen att tillåta medelstora koncerner att avvika från skyldigheten att upprätta koncernbokslut. – Denna option sätts inte i kraft i Finland, vilket framgår i samband med 3 mom. 
- Artikel 22: Kravet att upprätta en koncernredovisning. 
- Artikel 9: Undantag från skyldigheten att sammanställa dotterföretag i koncernbokslut. – Motsvarande bestämmelse ingår i 3 §. 
Paragrafens 7 mom. som delvis motsvarar gällande 5 mom. har ändrats så att den motsvarar artikel 23.4 som hänvisar till artikel 2.1a som avgränsar ett sådant finländskt moderföretag från undantag enligt 4 och 5 mom., vars värdepapper är föremål för handel på en reglerad marknad. Till åtskillnad från den gällande bestämmelsen avser begränsningen endast moderföretaget, inte dess dotterföretag. 
Det finns å andra sidan inte längre något behov av att föreskriva om motsvarande begränsning i fråga om undantag som avses i 3 mom., eftersom enligt det nämnda momentet sådana företag av allmänt intresse redan undantas till vilka med stöd av artikel 2.1 a hör företag som emitterat värdepapper som är föremål för handel på en reglerad marknad. 
I lagen föreslås inte någon bestämmelse som är baserad på medlemsstatsoptionen i artikel 23.7 som lyder: ” Punkterna 3–6 ska tillämpas utan att det påverkar tillämpningen av medlemsstaternas lagstiftning om upprättande av koncernredovisning eller förvaltningsberättelse för koncern i den mån dessa handlingar krävs 
a) för de anställdas eller deras representanters information, eller 
b) av en domstol eller en administrativ myndighet för dess eget bruk.” 
Motsvarande bestämmelse ingick också i det sjunde direktivets artikel 10. Eftersom artikelns förpliktelser som avser bokslutsinformation uteslutande för de anställda eller för en domstol dock är främmande för såväl den finländska arbetsrättsliga och den domstolsrättsliga doktrinen, skulle det inte vara ändamålsenligt att implementera bestämmelsen. 
2 §.Koncernbokslutets innehåll och upplysningar om koncernen som ska ingå i moderbolagets verksamhetsberättelse. Denna paragraf innehåller en grundläggande bestämmelse om upprättande av koncernbokslut. Koncernbokslutet ska upprättas som en sammanställning av moderföretagets och dess dotterföretags separata bokslut. Varje affärshändelse ska, oberoende av om den hänför sig till moderföretaget eller ett dotterföretag, sålunda beaktas utan något behov av att under hela räkenskapsåret föra en gemensam bokföring på hela koncernens nivå. 
Paragrafens 1 mom. motsvarar den gällande bestämmelsen kompletterad med en ny andra mening. Den första meningen om upprättande av koncernbokslut på basis av de separata boksluten innebär inte att boksluten ska sammanställas som sådana, utan de kan före sammanställningen ändras bl.a. med tanke på beräkningsprincipernas enhetlighet enligt 4 § (regeringens proposition 173/1997 rd). Artikel 24.2 lyder: ”Tillgångar [eng. assets] och skulder [eng. liabilities] i de företag som omfattas av koncernredovisningen ska i sin helhet redovisas i den koncernbalansräkningen.” Motsvarande bestämmelse ingick i det sjunde direktivets artikel 18. 
Den nya andra meningen är baserad på artikel 24.1 som lyder: ” Kapitlen 2 och 3 ska tillämpas på koncernredovisningar, med beaktande av den anpassning som är nödvändig med hänsyn till de särdrag som utmärker en koncernredovisning jämfört med årsbokslut.” Det kapitel 2 som det hänvisas till i artikeln innehåller direktivets allmänna bestämmelser och principer medan kapitel 3 innehåller direktivets bestämmelser om balansräkningen och resultaträkningen i det separata bokslutet. Motsvarande bestämmelse ingick i det sjunde direktivets artikel 17.1. 
Momentets tredje mening, som till innehållet stämmer överens med den gällande bestämmelsens andra mening, är en bokslutsteknisk informativ bestämmelse som konstaterar att koncernbokslutet ska upprättas samma dag som moderföretagets bokslut. Bestämmelsen är baserad på artikel 24.8 första stycket: ”Koncernredovisningen ska upprättas vid samma tidpunkt som moderföretagets årsbokslut.” Motsvarande bestämmelse ingick också i det sjunde direktivets artikel 27.1. 
Paragrafens 2 mom. är en nationell bestämmelse om finansieringsanalys. Skyldigheten att upprätta en finansieringsanalys preciseras så att den avser endast stora koncerner och koncerner där något av koncernföretagen är ett företag av allmänt intresse. Det förnyade momentet innebär sålunda en lättnad jämfört med den tidigare gällande bestämmelsen där skyldigheten att upprätta en finansieringsanalys omfattade dels publika aktiebolag och dels också alla sådana enskilda aktiebolag och andelslag som upprättade koncernbokslut. 
Direktivet ålägger inte medlemsstaterna att föreskriva om upprättande av finansieringsanalys och ta upp denna i koncernbokslutet. En sådan förpliktelse är emellertid tillåten enligt direktivet eftersom det i artikel 24.1 hänvisas till direktivets kapitel 2 enligt vars artikel 4.1 andra stycket som lyder: ” Medlemsstaterna får kräva att andra företag än små företag tar med andra uppgifter i årsboksluten utöver de handlingar som anges i första stycket.” 
Bokföringsnämnden behandlar i sin allmänna anvisning 30.1.2007 om finansieringsanalys också upprättande av analyser på koncernnivå (5 kap.). 
Till åtskillnad från artikel 22.1 föreskrivs i 3 mom. första meningen som motsvarar den gällande bestämmelsen inte om koncernens verksamhetsberättelse som ett separat dokument utan som en del av moderföretagets verksamhetsberättelse. 
Artikel 29.1 lyder: ”Förvaltningsberättelsen för koncernen ska, utöver eventuella andra uppgifter som krävs enligt andra bestämmelser i detta direktiv, åtminstone innehålla de upplysningar som krävs enligt artiklarna 19 och 20, med beaktande av den anpassning som är nödvändig med hänsyn till de särdrag som utmärker en förvaltningsberättelse för koncern i förhållande till en förvaltningsberättelse, på ett sätt som underlättar bedömningen av ställningen i de företag som omfattas konsolideringen i sin helhet.” 
I artikel 19 som det hänvisas till föreskrivs om förvaltningsberättelsens innehåll och i artikel 20 om företagsstyrningsrapporter som gäller enbart företag som avses i artikel 2.1 a och vilkas värdepapper har tagits upp till handel på en reglerad marknad. 
Artikel 29.2 som preciserar hänvisningarna lyder: ”Följande anpassningar av de uppgifter som krävs enligt artiklarna 19 och 20 ska tillämpas: 
a) I rapporteringen av uppgifter om egna aktier som har förvärvats ska förvaltningsberättelsen för koncernen ange antal och nominellt värde eller, i avsaknad av sådant värde, det bokförda parivärdet för alla aktier och andelar i moderföretaget som innehas av detta moderföretag, av dotterföretag till detta moderföretag eller av en person som handlar i eget namn men för något av dessa företags räkning. En medlemsstat får tillåta eller kräva att dessa uppgifter lämnas i noterna till koncernredovisningen. 
b) I rapporteringen om system för internkontroll och riskhantering ska företagsstyrningsrapporten hänvisa till huvuddragen i systemen för internkontroll och riskhantering för de företag som omfattas av konsolideringen som helhet.”. 
Momentets andra mening är en informativ hänvisning till värdepappersmarknadslagens 7 kap. 7 § där det föreskrivs om bolagsstyrningsrapporter som avses i artikel 20. Denna bestämmelse i värdepappersmarknadslagen kompletteras i syfte att sätta i kraft artikel 29.2 b. 
Paragrafens 4 mom. som motsvarar den gällande bestämmelsen är baserat på artikel 24.1 som lyder: ”Kapitlen 2 och 3 ska tillämpas på koncernredovisningar, med beaktande av den anpassning som är nödvändig med hänsyn till de särdrag som utmärker en koncernredovisning jämfört med årsbokslut.” I kapitel 2 som artikeln hänvisar till ingår artikel 4.1 enligt vars första stycke ”Årsbokslutet ska utgöra en helhet - -” samt 4.2 som förutsätter att årsbokslut ska upprättas ”på ett överskådligt sätt” (eng. clearly). (Motsvarande bestämmelser ingick också i det sjunde direktivets artikel 16.1 andra meningen: ”Dessa handlingar skall bilda en helhet.” Artikel 16.2: ”Den sammanställda redovisningen skall ge en rättvisande bild - -”). 
3 §.Undantag från skyldighet att ta med dotterföretag i koncernbokslutet. Syftet med koncernbokslutet är att ge en helhetsbild. Man bör därför förhålla sig restriktivt till alternativet att inte sammanställa dotterföretagens bokslutsinformation. I paragrafen definieras uttömmande sådana situationer där det är tillåtet att göra undantag från skyldigheten att ta med dotterföretag i koncernbokslutet. 
Paragrafens 1 mom. som till innehållet motsvarar den gällande paragrafen är baserat på artikel 23.9 som lyder: ” Ett företag, inbegripet ett företag av allmänt intresse, behöver inte omfattas av en koncernredovisning om minst ett av följande villkor är uppfyllda: 
a) I ytterst sällsynta fall om den information som behövs för att upprätta en koncernredovisning enligt detta direktiv inte kan erhållas utan oskälig kostnad eller inom rimlig tid. 
b) Aktierna eller andelarna i företaget innehas uteslutande i avsikt att säljas vidare. 
c) Betydande och varaktiga hinder föreligger som i väsentlig grad 
i) begränsar moderföretagets möjligheter att utöva sina rättigheter när det gäller företagets ledning eller tillgångar, eller 
ii) begränsar möjligheterna till enhetlig ledning av företaget, om detta står i ett sådant förhållande som avses i artikel 22.7.” 
Artikel 22.7 som hänvisningen avser lyder: ” Utan att det påverkar tillämpningen av denna artikel eller artiklarna 21 och 23 får en medlemsstat kräva att ett företag som lyder under dess lagstiftning upprättar en koncernredovisning och en förvaltningsberättelse för koncern, om 
a) detta företag och ett eller flera andra företag som företaget inte är närstående enligt beskrivningen i punkt 1 eller 2, står under enhetlig ledning i enlighet med 
i) avtal som ingåtts med det förstnämnda företaget eller 
ii) dessa andra företags stiftelseurkund eller bolagsordning, eller 
b) förvaltnings-, lednings- eller tillsynsorganen i detta företag och ett eller flera andra företag med vilka det förstnämnda företaget inte har något sådant samband som avses i punkt 1 eller 2, till större delen består av samma personer vilka har fullgjort sitt uppdrag under räkenskapsåret och fram till dess att den koncernredovisningen upprättas.” 
Bestämmelserna i artikel 22.7 som hänvisningen avser motsvarar artikel 12.1 i det tidigare sjunde direktivet. Vardera artikeln är medlemsstatsoptioner. De har i Finland inte implementerats i gällande lag och detta är inte heller enligt det nya direktivet ändamålsenligt. Genomförande av artikel 22.7 skulle nämligen innebära en förpliktelse att sätta i kraft koncernbokslutet i en situation där det inte finns något moderföretag som i enlighet med artikel 22.1 har bestämmande inflytande i företaget på grund av ägande eller avtal och inte heller något faktiskt bestämmande inflytande i enlighet med artikel 22.2. Detta skulle vara främmande för den finländska bolags- och bokslutsrättsliga doktrinen. 
Artikel 23.9 punkterna a - c ligger till grund för 2 - 4 punkterna. Motsvarande bestämmelser ingick också i det tidigare sjunde direktivets artikel 13.3. 
Momentets 1 punkt är å andra sidan inte direkt direktivbaserad men den står inte i konflikt med det nya direktivet. Det tidigare sjunde direktivet innehöll en mot 1 punkten svarande artikel 13.1 enligt vilken ett ”företag behöver inte omfattas av en sammanställd redovisning, om företaget endast har ringa betydelse med hänsyn till de syften som anges i artikel 16.3.” Den punkt som det hänvisades till lydde ”Den sammanställda redovisningen skall ge en rättvisande bild - -” Av tabellen i det nya direktivets bilaga VII framgår att som bestämmelser motsvarande det tidigare sjunde direktivets artikel 13.1 i det nya direktivet ska betraktas artiklarna 2.16 och 6.1 j som uttrycker väsentlighetsprincipen. Den sist nämnda artikeln gäller uttryckligen bl.a. upprättande av koncernbokslut. Momentets 1 punkt får sålunda kvarstå i lagen. Den tillåter nämligen i överensstämmelse med nya 2 a § i 3 kap. undantag från sammanställningsskyldigheten då utelämnandet inte äventyrar en rättvisande bild. Ordalydelsen i denna punkt har emellertid preciserats jämfört med den gällande, i syfte att understryka att denna grund är exceptionell. Också i bokföringsförordningens 4 kap. 4 § 1 mom. 2 punkten har gjorts motsvarande preciseringar. På motsvarande sätt har momentets 3 punkt kompletterats med kriteriet ”i undantagsfall”. 
Paragrafens gällande 2 mom. gäller den situationen att till koncernen hör flera sådana dotterföretag som vart och ett för sig uppfyller förutsättningarna i 1 mom. Enligt det tidigare sjunde direktivets artikel 13.2 skulle de beaktas i koncernbokslutet om de som helhet betraktade var betydelsefulla för att ge en rättvisande bild av koncernen. Någon motsvarande bestämmelse finns inte i det nya direktivet, men tabellen i direktivets bilaga VII hänvisar i fråga om den nämnda artikeln 13.2 till artiklarna 2.6 och 6.1 j som gäller väsentlighetsprincipen. På denna grund får momentet stå kvar i lagen. 
Försiktighetsprincipen understryks också i bokföringsnämndens utlåtandepraxis. I avgörandet 1807/2007 ansågs det att de förutsättningar som avses i lagrummet ska tolkas snävt. Om förutsättningarna uppfylls i fråga om flera dotterföretag är det skäl att också då beakta vilken inverkan det skulle ha på en rättvisande bild om de utelämnades ur koncernbokslutet. 
4 §.Principer för upprättande av koncernbokslut. I denna paragraf avses uttryckligen principer för sammanställning av koncernbokslut. Det föreskrivs separat om de beräkningsprinciper som ska iakttas vid upprättande av koncernföretagens egna bokslut (regeringens proposition 173/1997). 
Paragrafens 1 mom. om sammanställningsprinciperna motsvarara artikel 6.1 b som lyder: ”Redovisningsprinciper och värderingsgrunder [eng. measurement basis] ska tillämpas konsekvent [consistently] från ett räkenskapsår från ett annat.” Det hänvisas till denna artikel i direktivets kapitel 2 i artikel 24.1 som gäller upprättande av koncernbokslut, som lyder: ”Kapitlen 2 och 3 ska tillämpas på koncernredovisningar, med beaktande av den anpassning som är nödvändig med hänsyn till de särdrag som utmärker en koncernredovisning jämfört med årsbokslut”. I det tidigare sjunde direktivets artikel 25.1 förutsattes samma konsekvens i fråga om konsolideringsmetoderna. 
Artikel 4.4 i direktivets artikel 2 – som det hänvisas till i artikel 24.1 om koncernbokslut – berättigar för sin del till undantag från tillämpning av enskilda artiklar i direktivet, för undvikande av en konflikt med kravet på en rättvisande bild enligt artikel 4.3. Undantagströskeln är sålunda högre än enligt gällande lag. Som grund för ett undantag räcker nämligen inte vilken som helst ”särskild orsak” utan undantaget bör vara nödvändigt för att ge en rättvisande bild. Momentets ordalydelse har preciserats i enlighet härmed. 
Paragrafens 2 mom. motsvarar den gällande bestämmelsen och är baserat på artikel 24.10 som lyder: ”Tillgångar och skulder som ingår i koncernredovisningen ska värderas på ett enhetligt sätt och i enlighet med kapitel 2.” I det tidigare sjunde direktivets artikel 29.1 föreskrivs om en motsvarande förpliktelse. 
Bestämmelsen behövs eftersom i koncernföretag eventuellt tillämpas bokslutsprinciper exempelvis när det gäller intäktsföring av inkomster som uppkommer på grund av prestationer som kräver lång tillverkningstid, vid fastställande av anskaffningsutgiften för omsättningstillgångar, periodisering av anskaffningsutgiften för bestående aktiva eller olika typer av avskrivningspraxis för fastighetsföretag. 
Huvudregeln enligt artikel 24.4 första meningen lyder ”Ett företag som upprättar en koncernredovisning ska tillämpa samma värderingsgrunder som tillämpas i årsbokslutet”. Motsvarande bestämmelse ingick också i det sjunde direktivets artikel 29.2 a första meningen.  
Artikel 24.11 andra meningen lyder: ”Medlemsstaterna får dock tillåta eller kräva att andra värderingsgrunder i enlighet med kapitel 2 används i koncernredovisningen” (så också i det sjunde direktivets artikel 29.2 a andra meningen). Momentets första mening som alternativt tillåter tillämpning av principerna i ”koncernens huvudsakliga verksamhet” är sålunda ett alternativ enligt direktivet. 
I förarbetena till den gällande lagen preciseras begreppet ”huvudsaklig verksamhet”. Moderföretaget är inte nödvändigtvis det viktigaste företaget med tanke på koncernens rörelse, vilket innebär att t.ex. de beräkningsprinciper som tillämpas av de viktigaste dotterföretagen kan motiveras som principer för koncernbokslutet. Koncernen kan å andra sidan omfatta flera olika verksamhetsområden och företag som iakttar enhetliga men eventuellt från andra verksamhetsområden avvikande förfaranden t.ex. i fråga om fastställande av anskaffningsutgifterna för omsättningstillgångar eller intäktsföring enligt tillverkningsgraden. Det är då tillåtet att i koncernbokslutet tillämpa beräkningsprinciperna för koncernens centrala verksamhetsområde. Dessa principer ska emellertid då alltid vara baserade på bokföringslagen (regeringens proposition 173/1997). 
Dessutom ska i fråga om sådana förfaranden och motiveringar lämnas sådana upplysningar som avses i artikel 24.11 andra meningen. En motsvarande bestämmelse ingick i det sjunde direktivets artikel 29.2 a. En sådan bestämmelse ingår också i bokföringsförordningens 4 kap. 2 § 3 punkten. 
Artikel 24.12 innebär att rättelser ska göras i en situation där principerna för upprättande av bokslut för ett företag som ska sammanställas avviker från dem som med stöd av den föregående artikeln 24.11 ska tillämpas på koncernbokslut: ” Om tillgångar och skulder som ingår i koncernredovisningen har värderats av företag som omfattas av konsolideringen med användning av värderingsgrunder som skiljer sig från dem som används för konsolideringen, ska dessa tillgångar och skulder värderas på nytt i enlighet med de värderingsgrunder som används för konsolideringen. Avsteg från detta krav ska emellertid tillåtas i undantagsfall. Ett sådant avsteg ska anges i noterna till koncernredovisningen med upplysning om skälen för avsteget.” Motsvarande bestämmelser ingick i det sjunde direktivets artikel 29.3, i vars första mening uttryckligen betonades att omvärdering inte behövs om den är oväsentlig för en rättvisande bild: ”- - om inte resultatet av en sådan omvärdering skulle ha endast ringa betydelse med hänsyn till det i artikel 16.3 angivna syftet.” Motsvarande precisering behövs inte längre i det nya direktivet eftersom där föreskrivs om väsentlighet som en allmän bokslutsprincip (artiklarna 2.12 och 6.1 j). Också det på momentet baserade enhetlighetskravet gäller sålunda endast skillnader som har väsentliga verkningar. 
Sådana ”särskilda skäl” som avses i momentets andra mening och som på det sätt som avses i artikel 24.12 andra meningen berättigar till avvikelse från enhetliga beräkningsprinciper, kan enligt förarbetena till den gällande lagen vara t.ex. att ett utländskt dotterföretag på grund av en tvingande bestämmelse har tagit upp latenta skatteskulder i sin balansräkning trots att de övriga koncernföretagen inte har förfarit på detta sätt (regeringens proposition 173/1997). 
Enligt direktivets artikel 24.12 tredje meningen ska en sådan avvikelse anges i noterna till koncernredovisningen med upplysning om skälen för avsteget. Motsvarande bestämmelse ingår i bokföringsförordningens 4 kap. 2 § 4 punkten. 
Enligt det gällande momentet ska i koncernbokslut ”i tillämpliga delar iakttas 3 kap. 2 och 3 § samt 4 och 5 kap.”. Detta moment upphävs som obehövligt eftersom motsvarande bestämmelse med nästan samma ordalydelse ingår i det nya 1 mom. som föreslås i 2 § i detta kapitel. 
5 §.Dotterföretagets räkenskapsperiod och skyldighet att upprätta mellanbokslut. Paragrafens 1 mom. har samband med 7 § i lagen om koncernbidrag vid beskattningen (825/1986) som lyder: ”En förutsättning för koncernbidrag är att både givarens och mottagarens räkenskapsperioder utgår samtidigt.” Direktivet ställer inte något sådant krav men ett sådant villkor kan uppställas nationellt eftersom direktivet i detta avseende är en minimireglering. Enligt artikel 24.8 första stycket ska koncernredovisningen upprättas vid samma tidpunkt som moderföretagets årsbokslut. 
Paragrafens 2 och 3 mom. är baserade på artikel 24.8 som lyder: ”En medlemsstat får dock tillåta eller kräva att koncernredovisningen upprättas någon annan dag, så att balansdagen för de flesta eller de viktigaste av de företag som omfattas av koncernredovisningen kan beaktas, förutsatt att 
a) detta anges i noterna till koncernredovisningen med upplysning om skälen, 
b) hänsyn tas till eller upplysning lämnas om viktiga händelser avseende tillgångar, skulder, ekonomisk ställning och resultat för ett företag som omfattas av koncernredovisningen, om händelserna har inträffat mellan detta företags balansdag och dagen för den koncern balansräkningen, och 
c) om balansdagen för ett företag ligger mer än tre månader före eller efter dagen för den koncernbalansräkningen, ska detta företag tas in i koncernredovisningen på grundval av en delårsrapport med samma balansdag som den koncernbalansräkningen.”. 
En motsvarande bestämmelse ingår i det sjunde direktivets artiklar 27.2 och 27.3. 
Om dotterföretagets bokslutsdag infaller tre månader tidigare än dagen för koncernbokslutet ska dotterföretaget i enlighet med 3 mom. per koncernens bokslutsdag upprätta ett mellanbokslut som sammanställs med koncernbokslutet. Momentet motsvarar den gällande bestämmelsen. 
Om skillnaden mellan dotterföretagets och koncernens bokslutsdagar är kortare än tre månader – då sammanställningen får göras utan att något mellanbokslut upprättas – förutsätts enligt 2 mom. att detta framgår av koncernbokslutets noter. Detta förfarande är baserat på artikelns andra stycke leden a och b. Från det gällande momentet överförs bestämmelserna om innehållet i noterna från den andra meningen till bokföringsförordningens 4 kap. 2 § 5 a punkten. 
7 §.Koncerninterna poster och minoritetsandelar. Paragrafens 1 mom. är baserat på artikel 24.7 första och andra meningen, som reglerar elimineringen av koncerninterna poster och sålunda styr sammanställningsåtgärderna. Motsvarande bestämmelse ingick i det sjunde direktivets artikel 26.1. 
Artikel 24.7 lyder: ”I koncernredovisningen ska för de företag som omfattas av denna anges tillgångar, skulder, ekonomisk ställning och resultat, som om dessa företag utgjorde ett enda företag. Särskilt följande ska elimineras från koncernredovisningen: 
a) Fordringar och skulder mellan företagen. 
b) Intäkter och kostnader som hänför sig till transaktioner mellan företagen. 
c) Vinster och förluster som hänför sig till transaktioner mellan företagen, när dessa ingår i de bokförda tillgångsvärdena.” 
Den allmänna principen för eliminering av interna poster kan vara till hjälp för styrningen av enskilda åtgärder. Slutresultat ska vara detsamma som om koncernföretagen utgjorde ett enda företag. 
Ovan i 4 § föreskrivs om att koncernföretagen ska tillämpa enhetliga redovisningsprinciper då de sammanställs i koncernbokslutet I paragrafens 2 och 3 mom. föreskrivs om koncerninterna poster som ska dras av då koncernens resultaträkning och balansräkning upprättas. Det första nämnda momentets första mening har dessutom kompletterats med en bestämmelse i enlighet med artikel 24.5 och den första meningen i 3 mom. har kompletterats med en bestämmelse i enlighet med artikel 24.2. Motsvarande bestämmelser ingick i det sjunde direktivets artiklar 22 och 18, men de har inte uttryckligen implementerats i finsk lag. De nämnda artiklarna i det nuvarande direktivet lyder:  
- Artikel 24.5: ”Intäkter och kostnader i de företag som omfattas av konsolideringen ska i sin helhet redovisas [eng. shall be incorporated in full] i den koncern resultaträkningen.” 
- Artikel 24.2: ”Tillgångar och skulder i de företag som omfattas av koncernredovisningen ska i sin helhet redovisas i den koncernbalansräkningen.” 
Sådana intäkter i ett koncernföretags resultaträkning och motsvarande kostnader i andra koncernföretags resultaträkning som är baserade på koncerninterna affärshändelser ― exempelvis interna försäljning och köp ― ska elimineras med stöd av 2 mom. första meningen som motsvarar artikel 24.7 b. Bestämmelsen motsvarar artikel 26.1 b i det tidigare sjunde direktivet. Exempelvis försäljning av omsättningstillgångar till ett annat koncernföretag ska dels dras av från säljarens omsättning och dels från köparens kostnader. Det saknar betydelse vilket koncernföretag ― moderföretaget eller dotterföretaget ― som är i säljarens respektive köparens ställning (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 5.2). 
Elimineringen inverkar inte på resultatet och inte heller på det egna kapitalet, eftersom båda noteringarna påverkar resultaträkningen och är lika stora åt båda hållen. Elimineringen endast leder till mindre siffror i koncernresultaträkningen på så sätt att denna visar endast handel och annan omsättning med utomstående aktörer, dvs. med andra än koncernföretag. Elimineringen ska alltid göras till fullt belopp oberoende av om det i koncernföretagen finns minoriteter, dvs. utomstående ägare. 
Enligt paragrafens 2 mom. första meningen ska också koncernföretagens utdelningar till varandra och annan motsvarande vinstutdelning dras av från intäkterna vid upprättandet av koncernresultaträkning och läggas till vinsten eller förlusten från tidigare räkenskapsperioder (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 5.2). Det finns ingen direkt motsvarighet till detta lagrum i direktivet, men till karaktären stämmer lagrummet överens med de elimineringsförpliktelser som framgår av de ovan nämnda artiklarna 24.7 a och 24.7 b. Motsvarande bestämmelser ingick i det sjunde direktivets artiklar 26.1 a och 26.1 b. 
Bokföringstekniskt ska en vinstandel elimineras i det mottagandet koncernföretagets resultaträkning och återföras till vinstmedlen i det utdelande koncernföretagets balansräkning, dvs. till posten ”Balanserande vinst (förlust) från tidigare räkenskapsperioder” enligt schemat i bokföringsförordningens 1 kap. 6 § 1 mom. En sådan eliminering inverkar på koncernresultatet eftersom den görs endast i mottagarens resultaträkning medan den andra sidan av elimineringen görs i det utdelande företagets balansräkning. 
Mellan koncernföretag kan förekomma skuld- och fordringsförhållanden som är baserade på interna försäljningar eller andra transaktioner, t.ex. finansiering av dotterföretag. Sådana transaktioner är i samtliga fall helt koncerninterna och berör inte aktörer utanför koncernen som helhet. Sålunda ska med stöd av 3 mom. första meningen elimineras sådana koncerninterna fordringar och motsvarande skulder som tagits upp i koncernföretagens egna balansräkningar (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 5.2). I och med dessa elimineringar återstår i koncernbalansräkningen endast skulder och fordringar som hänför sig till andra aktörer än koncernföretag. 
För fordrings- och skuldelimineringarna saknar det betydelse om det finns minoritetsägande i koncernföretagen. Elimineringarna ska således göras till sitt fulla balansvärde. Förfarandet är också oberoende av vilket av koncernföretagen som är gäldenär respektive borgenär. Denna eliminering ändrar inte heller resultatet eller det egna kapitalet. Elimineringsskyldigheten är baserad på artikel 24.7 a som behandlas ovan i samband med 1 mom. Motsvarande bestämmelse ingick i det sjunde direktivets artikel 26.1 a. 
Enligt artikel 24.7 c ska från koncernredovisningen elimineras vinster och förluster som hänför sig till transaktioner mellan företagen, när dessa ingår i de bokförda tillgångsvärdena. I finländska bokföringssammanhang kallas ett sådant ”resultat” internvinst. Paragrafens 2 mom. tredje meningen och 3 mom. första meningen är baserade på den nämnda artikeln. Motsvarande bestämmelse ingick också i det tidigare sjunde direktivets artikel 26.1.c. 
Dessutom innehöll det sjunde direktivets artikel 26.2 en medlemsstatsoption som innebar tillåtelse att avvika från elimineringsbestämmelserna på två villkor. För det första skulle transaktionen ha ägt rum på ”normala marknadsvillkor” och elimineringen av internvinsten skulle ”föra med sig oskäliga kostnader”. I förarbetena till den gällande lagen har man inte tagit ställning till denna artikel och i vår lagstiftning har man inte föreskrivit om den undantagsmöjlighet som artikeln avser. I det nya direktivet finns ingen motsvarande uttrycklig bestämmelse men i direktivet föreskrivs å andra sidan om den allmänna väsentlighetsprincipen i artikel 6.1 j, enligt vilken ”krav som anges i detta direktiv när det gäller redovisning, värdering, utformning, upplysning och koncernredovisning behöver inte uppfyllas om följderna av att uppfylla dem är oväsentliga.” Moderföretaget har sålunda möjlighet att bedöma om en vinsteliminering ska anses vara så obetydlig till sina verkningar när det gäller att ge en rättvisande bild, att den inte behöver göras. 
Om koncerninternt sålda tillgångar inte har utnyttjats av det mottagande koncernföretaget under räkenskapsperioden ― vilket innebär att de vid utgången av räkenskapsperioden finns i företagets lager ― ingår i lagervärdet den vinst som dotterföretaget som säljarpart har lagt till anskaffningspriset för sålda tillgångar. Eftersom försäljningen har skett mellan koncernföretag ska dessa interna vinster (interna lagervinster) sålunda elimineras i koncernens omsättningstillgångar och egna kapital. 
Internvinsten i ingående lager elimineras från balanserad vinst (förlust) från tidigare räkenskapsperioder och ändringen i internvinsten från räkenskapsperiodens resultat. Elimineringen ska vid upprättande av koncernresultaträkning enligt kostnadsslag, på det sätt som avses i bokföringsförordningens 1 kap. 1 § 1 mom., hänföras till posten ”Material, förnödenheter och varor - Förändring av lager” och i koncernresultaträkningen enligt funktion till posten ”Kostnader för inköp och tillverkning”. Likaså ska koncernens internvinst som ingår i anskaffningsutgiften för en tillgång under bestående aktiva och avskrivningar på den elimineras på motsvarande sätt så att internvinsten inte påverkar koncernens ackumulerade vinst eller förlust från tidigare räkenskapsperioder och inte heller koncernens resultat för räkenskapsperioden (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 5.3). 
Paragrafens4 mom. är baserat på det tidigare sjunde direktivets artikel 26.3 som ålade medlemsstaterna att tillåta eliminering av fordringar och skulder mellan företag samt intern vinstutdelning och eliminering av koncerninterna vinster, om elimineringen inte behövdes för att ge en rättvisande bild. I det gällande direktivet finns ingen motsvarande bestämmelse, men jämförelsetabellen i direktivets bilaga VII hänvisar i detta avseende till väsentlighetsprincipen i artikel 6.1 j. Momentet kan sålunda hållas kvar i lagen som en bestämmelse av informativ karaktär. 
Paragrafens 5 mom. om uppdelning av reserver och avskrivningsdifferensen i eget kapital respektive latent skatteskuld är inte baserat på direktiven. Momentet är sålunda en bestämmelse som är nationell för Finland. Det står emellertid inte i strid med direktivet och kan sålunda hållas kvar i lagen. 
Enligt den andra meningen i kapitlets 8 § 1 mom. ska i dotterföretagets eget kapital även räknas in den ackumulerade avskrivningsdifferensen och skattemässiga reserver med avdrag av latenta skatteskulder. I koncernbalansräkningen åsterstår i det egna kapitalet sålunda dels moderföretagets reserver och avskrivningsdifferenser och dels dotterföretagens efter anskaffningstidpunkten ackumulerade reserver och avskrivningsdifferenser. 
Den latenta skatteskuldens andel av avskrivningsdifferensen och reserverna fastställs per koncernföretag i första hand med användning av den skattesats som gäller för upprättande av koncernbokslutet. Bokföringsnämndens allmänna anvisning 12.9.2006 om latenta skatteskulder och skattefordringar innehåller närmare anvisningar om förfarandet. 
I paragrafens gällande 6 mom. föreskrivs att en liten koncern inte behöver göra en sådan uppdelning i eget kapital och latent skatteskuld som avses i det föregående momentet. Denna undantagsmöjlighet behövs emellertid inte längre eftersom små koncerner inte behöver upprätta koncernbokslut. Om en liten koncern dock anser att den behöver ett koncernbokslut är det konsekvent att detta upprättas enligt samma regler som de som tillämpas av bokföringsskyldiga som är skyldiga att upprätta koncernbokslut. Det föreslås sålunda att momentet upphävs. 
8 §.Förvärvsmetoden. I denna paragraf som motsvarar den gällande bestämmelsen föreskrivs om eliminering av koncernbolags interna aktieinnehav, i överensstämmelse med den förvärvsmetod som avses i artikel 24.3. Motsvarande bestämmelser ingick i det tidigare sjunde direktivets artikel 19.1. 
Från koncernentitetens synpunkt är dotterföretagens innehav av aktier och andelar uteslutande koncerninternt och ska sålunda från bokföringsmässig synpunkt elimineras med tanke på koncernbokslutet. Förvärvsmetoden innebär att dotterföretagens förvärv av aktier och andelar teoretiskt ska omvandlas till förvärv av tillgångar och skulder. 
Elimineringen innebär att mot varandra avräknas dels anskaffningsutgiften för dotterföretagets aktier och dels en sådan andel av dotterföretagets ägarandel av koncernens eget kapital vid bokslutstidpunkten som motsvarar dotterföretagets eget kapital vid förvärvstidpunkten. Ägarandelen i dotterbolag beräknas baserat på den relativa andelen aktier eller andelar, vilket innebär att eventuella skillnader t.ex. i rösträtten mellan olika slag av aktier inte har någon betydelse. Som ett resultat av elimineringen kommer endast det belopp av dotterföretagets egna kapital att beaktas i koncernens egna kapital, som har ackumulerats efter tidpunkten för dotterföretagets förvärv. 
Metoden innebär att moderföretagets och dotterföretagens resultaträkningar och balansräkningar sammanställs rad för rad, för att koncernbokslutet ska ge en bild av hur koncernentitetens resultat och förmögenhetsställning uppkommit. Om moderföretaget för sitt innehav i ett dotterföretag har betalat mer eller mindre än den motsvarande andelen av detta dotterföretags eget kapital vid förvärvstidpunkten, ger beräkningsdifferensen upphov till koncernaktiva eller koncernpassiva som beräkningstekniskt ska behandlas så som föreskrivs nedan i denna paragraf. I det fall att moderföretaget har agerat som dotterföretagets enda grundare eller ägare ska moderföretagets anskaffningsutgift för aktierna å andra sidan alltid motsvara dotterföretagets eget kapital, vilket innebär att någon elimineringsdifferens inte uppkommer. 
Artikel 24.3 som det hänvisas till ovan lyder: ” Det bokförda värdet av aktier eller andelar i företag som ska konsolideras ska elimineras genom att avräknas mot den andel av dessa företags egna kapital som aktierna eller andelarna representerar, i enlighet med följande: 
a) Med undantag för sådana aktier eller andelar i moderföretaget som ägs av detta eller av något annat företag som omfattas av konsolideringen, vilka ska behandlas som egna aktier eller andelar i enlighet med kapitel 3, ska elimineringen utföras på grundval av de bokförda värdena den dag då dessa företag omfattas av en konsolidering för första gången. De differenser som uppkommer vid elimineringen ska i möjligaste mån öka eller minska värdet av sådana poster (eng. items) i koncernbalansräkningen vilkas verkliga värden överstiger eller understiger posternas bokförda värde (which have values above or below their book values; motsvarar i det sjunde direktivet artikel 19.1 a första och andra meningen). 
b) En medlemsstat får tillåta eller kräva att elimineringen på grundval av värden hos identifierbara poster på aktiv- och passivsidan (eng. identifiable assets and liabilities) ska hänföra sig till värdena vid tidpunkten för förvärvet av aktierna eller andelarna (at the date of acquisition) eller, då det handlar om successiva förvärv, den tidpunkt då företaget blev dotterföretag (motsvarande bestämmelse i det sjunde direktivets artikel 19.1 b). 
c) Den eventuella differens som återstår efter tillämpningen av led a eller som följer av tillämpningen av led b ska redovisas som goodwill i den koncernbalansräkningen (jfr det sjunde direktivets artikel 30.1: ” En i artikel 19.1 c angiven särskild post som motsvarar en positiv skillnad vid sammanställningen skall behandlas enligt föreskrifterna i direktiv 78/660/EEG om posten "Goodwill"”). 
d) De metoder som används för att beräkna värdet på goodwill samt väsentliga värdeförändringar i förhållande till det föregående räkenskapsåret ska förklaras i noterna till den finansiella rapporten (motsvarar det sjunde direktivets artikel 19.1 c andra meningen). 
e) Om avräkningen [eng. the offsetting] av positiv och negativ goodwill är godkänd av medlemsstaten ska noterna till den finansiella rapporten även innehålla en analys av goodwill [jfr det sjunde direktivets artikel 19.1 c tredje meningen: ” Om en medlemsstat tillåter att positiva och negativa differenser avräknas mot varandra, skall en uppdelning av dessa differenser göras i noterna.” 
f) Negativ goodwill får överföras (eng. may be transferred) till den koncern resultaträkningen när en sådan behandling överensstämmer med de principer som fastställs i kapitel 2.” (jfr det sjunde direktivets artikel 31: ” Ett belopp som redovisas som en särskild post enligt artikel 19.1 c och som motsvarar en negativ skillnad vid sammanställningen får föras över till den sammanställda resultaträkningen endast a) om differensen motsvarar en vid förvärvstidpunkten förväntad ogynnsam resultatutveckling i företaget eller förväntade kostnader i detta, i den mån förväntningarna förverkligas, eller b) i den mån differensen motsvarar en realiserad vinst.”) 
Första meningen i 1 mom. som motsvarar den gällande bestämmelsens första och andra mening är baserad på ingressen i artikel 24.3. Konstaterandet att elimineringen inte gäller moderföretagets egna aktier eller andelar behöver emellertid inte tas in i lagen, eftersom momentets första mening begränsar förfarandet enbart till innehav i dotterföretag. 
Preciseringen i den andra meningen, dvs. att i dotterföretagets eget kapital som är föremål för eliminering även ska räknas in den ackumulerade avskrivningsdifferensen och skattemässiga reserver, med avdrag av den latenta skatteskulden, stämmer överens med direktivet, vilket framgår av den engelskspråkiga versionen av ingressen där termen lyder ”capital and reserves” medan uttrycket ”egna kapital” och ”oma pääoma” som används i den svenska respektive finska texten är alltför snävt.  
Såsom konstateras ovan i samband med 7 § 5 mom. är förfarandet att indela reserverna och avskrivningsdifferensen i latent skatteskuld och eget kapital inte direkt baserat på direktivet utan det är här fråga om en nationell precisering. Förfarandet är emellertid förenligt med försiktighetsprincipen i 6.1 c eftersom det är strängare än direktivet i fråga om fastställandet av dotterföretagets eget kapital. Direktivet skulle tillåta att reserverna och avskrivningsdifferensen jämställs med det egna kapitalet till bruttobelopp, dvs. utan att skatteskulden dras av från dem. Detta framgår av det ovan nämna engelska uttrycket ”reserves”. Direktivet förbjuder inte medlemsstaterna att nationellt tillämpa en strängare tolkning än direktivet i fråga om reserver (”reserves”) som kan jämställas med eget kapital. Också bokföringsnämnden understryker i detta avseende försiktighetsprincipen (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 6.2.3). 
Huvudregeln enligt kapitel 24.14 är på motsvarande sätt att värdejusteringar som gjorts uteslutande av skatteskäl (eng. value adjustments solely for tax purposes) ska elimineras innan tillgångarna tas in i koncernbokslutet. Det är sålunda förenligt med direktivets syfte att beakta reserver och avskrivningsdifferens. Eftersom koncernföretags reserver och avskrivningsdifferens i koncernbokslutet indelas i latent skatteskuld och eget kapital, är det motiverat att förfara på detta sätt i alla skeden då koncernbokslutet upprättas, också när dotterföretagets eget kapital fastställs vid förvärvstidpunkten (regeringens proposition 173/1997). I koncernbalansräkningen kvarstår sålunda i det egna kapitalet dels moderföretagets reserver och avskrivningsdifferens minskade med den latenta skatteskulden och dels dotterföretagens efter förvärvstidpunkten ackumulerade reserver och avskrivningsdifferens. 
Den tredje meningen i det gällande momentet innehåller emellertid ett undantag från regeln att den latenta skatteskulden ska beaktas i små koncerner. Undantaget är inte baserat på direktivet utan syftet är att göra det lättare att upprätta koncernbokslut i sådana små koncerner där det finns ett behov av ett koncernbokslut trots att ett sådant inte behöver upprättas med stöd av undantagsbestämmelsen i kapitlets 1 § 3 mom. 
Enligt momentets tredje mening får ett småföretag analogt tillämpa undantagsförfarandet enligt 7 § 6 mom. också när det gäller eliminering av anskaffningsutgiften för aktier och andelar i dotterföretag. Det är konsekvent att tillåta att ett småföretag som upprättar koncernbalansräkning, då det med stöd av det nämnda lagrummet inte drar av den latenta skatteskuldens andel från avskrivningsdifferensen och reserverna, tillämpar motsvarande förfarande också vid eliminering av interna aktieinnehav (regeringens proposition 189/2000). 
Bestämmelsen i den tredje meningen är emellertid inte tvingande. Möjligheten till lindring av bestämmelserna hindrar inte moderföretaget i en liten koncern som upprättar koncernbokslut att till dotterföretagets egna kapital vid anskaffningstidpunkten hänföra ackumulerad avskrivningsdifferens och reserver med avdrag av den latenta skatteskulden. Sålunda kommer den totala skillnaden mellan tillgånger och skulder i dotterbolagets balansräkning vid anskaffningstidpunkten att elimineras mot anskaffningsutgiften för aktierna i dotterföretaget, vilket innebär att en upplösning av de avskrivningsdifferenser och reserver som dotterbolaget hade vid anskaffningstidpunkten inte längre inverkar på koncernens resultat eller egna kapital (bokföringsnämndens allmänna anvisning 7.11.2006 om upprättande av koncernbokslut, punkt 6.2.3). 
I artikel 2.6 ingår en allmän definition av begreppet anskaffningspris. Med anskaffningspris avses sålunda ”inköpspris och övriga med förvärvet sammanhängande kostnader minus sammanhängande minskningar av kostnaderna för förvärvet.” På denna definition baseras 4 kap. 5 § 1 mom. enligt vilket med anskaffningsutgift avses ”de direkta utgifterna för anskaffning och tillverkning av en tillgång.” 
I direktivet föreskrivs inte i vilken ordning ett dotterföretags eget kapital ska elimineras. Enligt bokföringsnämndens allmänna anvisning 7.11.2006 (punkt 6.2.4) kan elimineringen av eget kapital vid anskaffningstidpunkten i allmänhet utföras i sådan ordning att beloppet som skall elimineras minskas från det egna kapitalet vid bokslutstidpunkten i enlighet med posternas ordning i bokföringsförordningens balansräkningsschema, uppifrån och ned så långt beloppet som skall elimineras räcker till. För aktiebolag innebär detta att elimineringen först sker från aktiekapitalet, därefter från övriga poster inom det bundna kapitalet och slutligen från ackumulerade vinstmedel. Denna ordning grundar sig på antagandet att posterna inom det bundna egna kapitalet har uppstått som kapitalplaceringar och därtill eventuellt genom överföringar från fritt eget kapital till bun-det. För att posterna inom dotterföretagets egna kapital skall förbli oförändrade, får elimi-neringen inte ske mot en uppskrivningsfond som bildats efter anskaffningstidpunkten och inte heller mot andra poster inom det bundna egna kapitalet vilka har uppstått på annat sätt än genom överföringar från fritt eget kapital till bundet. 
Elimineringen kan inte hänföras till en aktiekapitalinvestering enligt aktiebolagslagens 11 kap. 1 § 3 punkten,det är fråga om en placering som i praktiken fördelar sig jämnt mellan alla aktieägare utan att påverka förhållandena i deras bestämmanderätt, eftersom den som gör en sådan investering inte får extra aktier som vederlag. Eftersom en placering i aktiekapital inte elimineras i samband med elimineringen av internt innehav kan koncernens aktiekapital avvika från moderföretagets aktiekapital (bokföringsnämndens allmänna anvisning 7.11.2006 om upprättande av koncernbokslut, punkt 6.2.4). 
I 2 mom. första meningen som motsvarar den gällande bestämmelsen avses med ”den tidpunkt då företaget blev dotterföretag”, dvs. med anskaffningstidpunkten enligt bokföringsnämndens allmänna anvisning 7.11.2006 om upprättande av koncernbokslut (punkt 6.2.3) i regel det ögonblick då äganderätten eller den på något annat sätt uppkomna bestämmanderätten till det anskaffande dotterföretaget har övergått. Om de ansvar och risker som sammanhänger med det köpta företaget har övergått på köparen vid en annan tidpunkt än då äganderätten övergick, fastställs det egna kapitalet vid anskaffningstidpunkten enligt denna tidpunkt. 
Om olika enheter i koncernen har skaffat aktier i ett dotterföretag kan förvärvet behandlas på samma sätt som om det skulle ha gjorts av ett enda företag. Härvid kan hela den förvärvade posten behandlas i en enda valuta, förutsatt att förvärvet gjorts i en valuta. 
Enligt artikel 24.3 b som nämns ovan i motiveringen till 1 mom. får en medlemsstat ”tillåta eller kräva att elimineringen på grundval av värden hos identifierbara poster på aktiv- och passivsidan, ska hänföra sig till värdena vid tidpunkten för förvärvet av aktierna eller andelarna eller, då det handlar om successiva förvärv, den tidpunkt då företaget blev dotterföretag.” Finlands lagstiftare har utnyttjat denna möjlighet i den första meningen genom att tillåta ett sådant förfarande som i artikeln nämns som det andra alternativet. 
Momentets andra mening är baserad på artikel 24.3 a som motsvarar det tidigare sjunde direktivets artikel 19.1 a. Syftet med bestämmelsen är att underlätta upprättandet av koncernbokslut i sådana fall då den bokföringsskyldiga blir skyldig att upprätta ett koncernbokslut eller att sammanställa ett dotterföretag med koncernbokslutet först efter den räkenskapsperiod då dotterföretaget förvärvades (regeringens proposition 173/1997). 
I artikeln föreskrivs inte om det krav som ställs i momentets andra mening, dvs. att detta förfarande ”inte har en väsentlig inverkan på den rättvisande bild som ska ges av koncernens resultat och ekonomiska ställning.” Detta krav är emellertid ”endast” informativt till sin karaktär då det hänvisar till att också syftet med ett koncernbokslut är att ge en rättvisande bild. Detta ska vara förenligt med direktivets syfte. Enligt artikel 24.1 ska på koncernbokslut tillämpas kapitel 2 och i dess artikel 4.3 första stycket förutsätts det att årsbokslutet ger en rättvisande bild. 
Om anskaffningsutgiften för aktier eller andelar inte är lika stor som det egna kapitalets belopp vid anskaffningstidpunkten, uppkommer det en elimineringsdifferens. Moderföretaget har eventuellt för dotterföretaget betalat ett pris som överstiger dotterföretagets eget kapital vid förvärvstidpunkten. Då anskaffningspriset för dotterföretagets aktier eller andelar är större för moderföretaget än moderföretagets ägarandel av dotterföretagets eget kapital vid förvärvstidpunkten, är benämningen på elimineringsdifferensen enligt 3 mom. koncernaktiva och i det motsatta fallet koncernpassiva. Momentet är baserat på artikel 24.3 a andra meningen enligt vilken de differenser som uppkommer vid elimineringen ”ska i möjligaste mån öka eller minska värdet av sådana poster [eng. items] i koncernbalansräkningen vilkas verkliga värde överstiger eller understiger posternas bokförda värde” [eng. which have values or below their book values]. Motsvarande bestämmelse ingick i det tidigare sjunde direktivets artikel 19.1 a andra meningen. 
Det som sägs ovan betyder i praktiken att koncernaktiva uppkommer då det förvärvade dotterföretagets tillgångsposter i balansräkningen understiger de värden som koncernen skulle ha betalat för posterna om de köpts separat eller då koncernens inkomstförväntningar är högre än det bokförda värdet på det förvärvade dotterföretagets tillgångsposter. Dessutom kan koncernaktiva uppkomma i en situation då det förvärvade dotterföretagets skulder eller avsättningar i balansräkningen har tagits upp till ett alltför högt värde från koncernens synpunkt (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, 6.2.5). 
Koncernaktiva baseras på att moderföretaget då det förvärvat dotterföretaget har betalat ett pris som överstiger dotterföretagets eget kapital, eftersom moderföretaget har värderat dotterföretagets tillgångsposter till ett högre värde än det som framgår av dotterföretagets balansräkning. Av denna anledning är det konsekvent att koncernaktiva fördelas mellan de tillgångsposter hos dotterföretaget på vilka koncernaktiva baserades vid förvärvstidpunkten. 
Fördelningen av koncernaktiva innebär att beloppet för koncernaktiva läggs till tillgångsposternas bokföringsvärde och minskas från skuldposternas bokföringsvärde vid upprättandet av koncernbalansräkning. Koncernaktiva får fördelas endast på sådana tillgångsposter som ett stöd av 5 kap. 5 - 11 § kan aktiveras av en enskild bokföringsskyldig. Med skulder jämställs även reserver (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut (punkt 6.2.5). 
Dotterföretagets koncernaktiva kan fördelas på tillgångsposter högst till ett sådant belopp att posternas bokföringsvärde efter fördelningen inte överstiger det sannolika överlåtelsepriset eller ett på annat sätt definierat verkligt värde för tillgångsposterna i fråga. Om beloppet för koncernaktiva inte räcker till för att fördelas på ett sådant sätt att alla tillgångsposters värde höjs så att värdet motsvarar posternas verkliga värde, och om ingen annan fördelningsgrund kan motiveras, ska beloppet för koncernaktiva fördelas jämnt i förhållande till det verkliga värdet på de olika egendomsposterna (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 6.2.5). 
Det belopp som ska fördelas på skulder och avsättningar minskas från bokföringsvärdet för dessa poster, dock högst så mycket att skuldernas och avsättningarnas bokföringsvärden efter fördelningen inte understiger deras sannolika värden (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 6.2.5). 
Koncernaktiva som fördelats på tillgångsposter ska enligt bokföringsnämndens allmänna anvisning kostnadsföras enligt samma principer som anskaffningsutgifterna för posterna i fråga. Koncernaktiva som hänförts till tillgångar bland bestående aktiva kostnadsförs således i takt med avskrivningarna eller nedskrivningarna för ifrågavarande tillgångsposter eller i samband med försäljning av tillgångarna. Exempelvis den andel av koncernaktiva som hänförts till en fastighet ska avskrivas i samma takt som avskrivningar görs på fastigheten i övrigt. 
Koncernaktiva som hänförts till dotterföretagets skulder och avsättningar minskas i koncernbalansräkningen från bokföringsvärdet för dessa poster så länge ifrågavarande skulder eller avsättningar finns i dotterföretagets balansräkning. Det minskade beloppet kostnadsförs i takt med att skulderna eller avsättningarna minskar i dotterföretagets balansräkning (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 6.2.5). 
Koncernpassiva som avses i paragrafens 4 mom. uppstår till exempel i följande situationer: 1) tillgångsposterna i det förvärvade företaget är övervärderade ur koncernens synvinkel, 2) de verkliga skulderna i det förvärvade företaget är större än de skulder som upptagits i balansräkningen, 3) det förvärvade företaget förväntas gå med förlust under pågående räkenskapsperiod eller under följande räkenskapsperioder, eller 4) förvärvet har gjorts till ett förmånligt pris (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 6.2.6). 
Varken detta moment eller föregående 3 mom. är direkt baserade på det nya direktivet eller på det tidigare sjunde direktivet, men momentet stämmer överens med artikel 24.3 i fråga om förvärvsmetoden. 
Fördelningen innebär att beloppet för koncernpassiva i koncernbalansräkningen minskas från tillgångsposternas bokföringsvärde och läggs till skuldposternas bokföringsvärde. Koncernpassiva fördelas enligt koncernens ägarandel på de tillgångs- och skuldposter hos dotterföretaget till vilka koncernpassiva kan hänföras. Med skulderna jämställs även reserver (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 6.2.6). 
Den del av koncernpassiva som fördelats på tillgångsposter upptas som intäkt i takt med att anskaffningsutgifterna för ifrågavarande tillgångsposter upptas som kostnad. Koncernpassiva som fördelats på skuldposter upptas som inkomst i det skede då motsvarande skuld har upptagits i balansräkningen och den post som skulden bokförts mot har upptagits som kostnad (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 6.2.6). 
Paragrafens 5 mom. motsvarar första meningen i den gällande bestämmelsen. Koncerngoodwill som avses i momentet beror på inkomstförväntningar till vilka hörande andelar av anskaffningsutgifter inte kan upptas skilt bland någon av dotterföretagets tillgångsposter (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 6.2.5). 
Bestämmelsen om avskrivning av koncerngoodwill har utformats så att den stämmer överens med 5 kap. 11 §. Avskrivningstiden enligt den gällande bestämmelsen är baserad på det tidigare sjunde direktivets artikel 30.1 som i sin tur hänvisar till det tidigare fjärde direktivets artikel 37.2 om avskrivning av goodwill. På denna grund ska den ickefördelade delen av koncernaktiva, dvs. koncerngoodwill, skrivas av under fem år eller, om verkningstiden är längre än så, under verkningstiden dock högst under 20 år. Den fördelade andelen ska å andra sidan kostnadsföras i enlighet med periodiseringsbestämmelserna om balansposten i fråga. Artikel 24.3 c i det gällande direktivet förutsätter på motsvarande sätt att ickefördelad koncerngoodwill ska redovisas som goodwill i koncernbalansräkningen. I artikel 12.11 andra stycket i det nya direktivet har den längsta avskrivningstiden för goodwill å andra sidan förkortats till 10 år, dvs. till hälften av maximitiden enligt det tidigare fjärde direktivets artikel 37.2. Momentet har ändrats i syfte att beakta detta. 
Vid bedömningen av inkomstförväntningar bör man enligt bokföringsnämnden beakta rörelsens karaktär och förutsägbarhet. Om verkningstiden för koncerngoodwill ändras ska avskrivningsplanen ändras. Detta kan också medföra att hela den resterande delen av beloppet för koncerngoodwill på en gång måste kostnadsföras. Enligt 8 § 4 mom. i detta kapitel kan beloppet för koncerngoodwill inte avskrivas direkt genom att debitera det egna kapitalet. Avskrivningen kan inte heller göras på en gång, om inte inkomstförväntningarna i motsvarande mån har förändrats (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 6.2.5). 
Bokföringsnämnden understryker att inkomstförväntningarna i samband med koncernaktiva som fördelats i samband med koncerngoodwill ska beräknas försiktigt. Beräkningen ska vid behov justeras (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 6.2.5). 
Den latenta skatteskulden för fördelad koncernaktiva ska upptas i koncernens balansräkning. Härvid ökar koncerngoodwill med beloppet för den latenta skatteskulden (den allmänna anvisningen 12.9.2006 om latenta skatteskulder och fordringar 4.4.2). 
Det belopp som motsvarar uppskrivningar i dotterföretagets balansräkning – som genomförts med stöd av 5 kap. 17 § – utgör ur koncernens synvinkel en del av anskaffningsutgiften eftersom det pris som motsvarar anskaffningsutgiften har betalts till utomstående för skillnaden mellan anskaffade tillgångs- och skuldposter. Också denna del av anskaffningsutgiften ska i koncernbokslutet avskrivas (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 6.2.5). 
Avskrivning av koncerngoodwill under räkenskapsperioden ska i koncernresultaträkningen redovisas under punkten avskrivningar och nedskrivningar (bokföringsförordningens 3 kap. 2 § 1 mom.) och det belopp som återstår efter avskrivningen ska enligt artikel 24.3 c redovisas som en egen post bland koncernbalansräkningens bestående aktiva i gruppen immateriella tillgångar (bokföringsförordningens 3 kap. 3 § 1 mom. första meningen). Motsvarande bestämmelse ingick i det sjunde direktivets artikel 19.1 c. 
Koncernreserven utgör till sin karaktär varken en avsättning eller främmande kapital och den ska sålunda tas upp som en egen post utanför huvudgrupperna, på samma sätt som minoritetsandelen. Denna bestämmelse hålls kvar som den andra meningen i bokföringsförordningens 3 kap. 3 § 1 mom., trots att det inte är direkt baserad på direktivet. 
Bokföringsförordningens 3 kap. 3 § 1 mom. tredje meningen, enligt vilken den oavskrivna koncerngoodwill samt den koncernreserv som inte har intäktsförts får tas upp som en post i koncernbalansräkningen, är enligt artikel 24.3 e en medlemsstatsoption. Motsvarande bestämmelse ingick i det sjunde direktivets artikel 19.1 c tredje meningen. 
Enligt det tidigare sjunde direktivets artikel 30.2 fick en medlemsstat tillåta att en positiv skillnad vid sammanställningen omedelbart och på ett tydligt sätt dras ifrån reserverna. I Finland har denna möjlighet inte utnyttjats och av lagens förarbeten framgår inga grunder för en sådan lösning (jfr. regeringens proposition 173/1997). I det nya direktivet finns emellertid ingen motsvarande bestämmelse. 
Paragrafens nya 6 mom. motsvarar till innehållet andra meningen i gällande 5 mom. Med begreppet ”koncernreserv” avses en del av koncernpassiva som inte fördelats av sådana skäl som avses i 1) och 2) punkterna som nämndes i samband med 4 mom. samt koncernpassiva som uppstår av sådana skäl som avses i 3) och 4) punkterna och som i allmänhet inte kan fördelas. Koncernreserven ska enligt bokföringsförordningens 3 kap. 3 § 1 mom. tas upp i koncernbalansräkningen som en särskild post före främmande kapital. 
Inkomstföringen eller upptagandet av koncernreserven som en intäkt i resultaträkningen baseras på artikel 24.3 f enligt vilken negativ goodwill ”får överföras till den koncernresultaträkningen när en sådan behandling överensstämmer med de principer som fastställs i kapitel 2.” Av dessa principer är framför allt försiktighetsprincipen i artikel 6.1 c viktig. I enlighet med den förutsätts i momentet att koncernreserven tas upp som en intäkt då motsvarande utgift eller förlust har redovisats som en kostnad i dotterföretagets resultaträkning eller då den motsvaras av en realiserad intäkt.  
Momentets ordalydelse har kompletterats så att den anger hur koncernreserven ska tas upp i balansräkningen. Kompletteringen har emellertid inte några verkningar i procedurhänseende jämfört med den andra meningen i gällande 5 mom. som är baserad på det tidigare sjunde direktivets artikel 31 som lyder: ” Ett belopp som redovisas som en särskild post enligt artikel 19.1 c och som motsvarar en negativ skillnad vid sammanställningen får föras över till den sammanställda resultaträkningen endast a) om differensen motsvarar en vid förvärvstidpunkten förväntad ogynnsam resultatutveckling i företaget eller förväntade kostnader i detta, i den mån förväntningarna förverkligas, eller b) i den mån differensen motsvarar realiserade intäkter,” Koncernreserv som uppkommit på grund av förväntade förluster upptas som inkomst i den mån som förlusterna realiseras. Med uttrycket realiserad intäkt avses enligt bokföringsnämnden till exempel en situation där förväntade förluster inte realiseras. Försiktighetsprincipen förutsätter att koncernreserv som uppkommer av olika orsaker eller på grund av ett förmånligt köp, inte intäktsförs på en gång, utan småningom (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 6.2.6). 
9 §.Poolningsmetoden. Denna paragraf upphävs. Direktivet innehåller inte bestämmelser om den poolningsmetod (eng. pooling) som avsågs i det tidigare sjunde direktivets artikel 20 och som under vissa förutsättningar kunde tillämpas i stället för förvärvsmetoden. I ett internationellt perspektiv är metoden exceptionell. 
Poolningsmetoden skiljer sig från förvärvsmetoden i det avseendet att i balansräkningen vid tillämpning av den inte tas upp koncernaktiva eller -passiva och inte heller koncerngoodwill eller koncernreserv. Detta beror på att elimineringen vid tillämpningen av poolningsmetoden genomförs enkelt genom sammanställning av vardera partens tillgångar, skulder och egna kapital i koncernbalansräkningen. På så sätt inverkar värderingarna enligt de båda separata boksluten med hela sitt belopp på koncernbokslutet. En annan viktig skillnad är att den vinst eller förlust som har uppkommit hos dotterföretaget före förvärvet, enligt poolningsmetoden ingår i det fria egna kapitalet i koncernbokslutet för det aktiebolag som utgör moderföretag (bokföringsnämndens allmänna anvisning 7.11.2006 om upprättande av koncernbokslut, punkt 6.3.3). 
10 §.Moderföretagets aktier eller andelar som innehas av dotterföretaget. Ingressen i artikel 24.3 a förbjuder tillämpning av förvärvsmetoden på aktier eller andelar i moderföretaget som ägs av detta eller av något annat företag som omfattas av konsolideringen, vilka ska behandlas som egna aktier eller andelar i enlighet med kapitel 3. Motsvarande bestämmelse ingick i det sjunde direktivets artikel 19.2. 
Enligt direktivets bilaga III ska med stöd av punkt D.III på passivsidan under ”tillgångar” tas upp ”egna aktier eller andelar”, om nationell lagstiftning medger att de redovisas i balansräkningen. Motsvarande bestämmelse ingår i bilaga IV i balansschemat i punkt D.III.2. 
En förutsättning för tillämpning av artikel 24.3 a är att det i den nationella lagstiftning som gäller företaget i fråga föreskrivs om upptagande av egna aktier i balansräkningen. Detta är inte fallet i Finland eftersom nya 8 § i 4 kap. uttryckligen förbjuder upptagande av egna aktier i balansräkningen. I och med det nämnda lagrummet har denna paragraf blivit obehövlig och upphävs sålunda. 
11 §.Latenta skattepåföljder av sammanställning. Denna paragraf vars ordalydelse i stort sett motsvarar den gällande bestämmelsen är baserad på artikel 24.13 som lyder: ”Uppskjutna skattebelopp (eng. deferred tax balances) ska redovisas i koncernredovisningen förutsatt att de inom en förutsebar framtid (eng. in the foreseeable future) sannolikt kommer att leda till en skattskyldighet för något av de företag som omfattas av konsolideringen.” 
Motsvarande bestämmelse ingick i det tidigare sjunde direktivet enligt vars artikel 29.4 det skulle tas hänsyn till den skillnad som vid den sammanställda redovisningen uppkommer mellan å ena sidan de skatter (eng. tax chargeable) som har påförts detta och tidigare räkenskapsår samt å andra sidan de skatter som har betalats (tax payable) eller ska betalas för dessa år, förutsatt att skillnaden inom en förutsebar framtid kommer att leda till en faktiskt kostnad (actual charge to tax) för något av de företag som omfattas av den sammanställda redovisningen. 
Sådan ”sammanställning” som avses i paragrafen omfattar dels ändring av bokslut i överensstämmelse med enhetliga beräkningsprinciper och dels eliminering av koncerninterna poster. Trots att i direktivet nämns endast framtida skattekostnader måste också latenta skattefordringar beaktas, med iakttagande av försiktighetsprincipen. Latenta skatteskulder och -fordringar ska beaktas också i det fall att sammanställningen inte direkt påverkar koncernens resultat. Exempelvis om aktiverade internvinster inte förändras mellan två bokslut ska en latent skattefordran dock hållas kvar i koncernbalansräkningen om det fortfarande är sannolikt att detta förfarande kan medföra skattemässig nytta (regeringens proposition 173/1997). 
I bokföringsnämndens allmänna anvisning 12.9.2006 om latenta skatteskulder och skattefordringar konstateras det att dessa i koncernbokslut föranleder följande åtgärder (punkt 1.2): 
- separata bokslut ändras för att motsvara koncernens beräkningsprinciper,  
- avskrivningsdifferensen och reserver upptas uppdelade i eget kapital och latent skatteskuld, och 
- sammanställning. 
Paragrafen är baserad på artikel 24.13 som är tvingande för medlemsstaterna till åtskillnad från 5 kap. 18 § som gäller bokföringsskyldiga och där det föreskrivs att det är frivilligt att i ett separat bokslut ta upp latenta skatteskulder och skattefordringar. 
Jämfört med den gällande bestämmelsen skiljer sig momentets första mening inte i något väsentligt avseende skillnad i förhållande till kriteriet som innebär en jämförelse mellan koncernresultatet och de sammanställda företagets sammanräknade resultat. Ändringen förtydligar beskrivningen av förfarandet men den har ingen betydelse i praktiken, då beräkningen alltid utförs oberoende hur liten skillnaden är. 
Det finns ingen allmängiltig definition på vad som avses med försiktighet vid behandling av latenta skatteeffekter. Bokföringsnämnden har gett det riktgivande utlåtandet 1671/2002 enligt vilket när en latent skattefordran, som uppkommer av bekräftade förluster eller av sådana som ska bekräftas, tas upp i balansräkningen ska särskild försiktighet iakttas. När förutsättningarna för registrering bedöms, ska det alltid beaktas om man sannolikt kommer att kunna utnyttja den latenta skattefördel som erhålls av bekräftade förluster. Detta förutsätter att företaget får beskattningsbara inkomster till ett belopp som motsvarar de bekräftade förlusterna under den tid då förlusten kan dras av. Som ett tillräckligt bevis kan anses tillräckligt välmotiverade budgeter eller andra planeringskalkyler, som visar att en tillräckligt stor beskattningsbar inkomst flyter in under en nära framtid. 
I nämndens praxis har å andra sidan definierats den tidsmässiga dimensionen när det gäller särskild försiktighet enligt 5 kap. 11 §. I utlåtandet 1887/2012 anses det att en metod där man periodiserar provisionsutgifterna på den räkenskapsperiod de fastställdes och de två följande räkenskapsperioderna kan tas som utgångspunkt. 
12 §.Skyldighet att sammanställa ett intresseföretags bokslutsuppgifter. I denna paragraf föreskrivs om upptagande i koncernbokslut av uppgifter om intresseföretag som avses i 1 kap. 8 §. Den nya första meningen i paragrafens 1 mom. är baserad på artikel 27.1 som lyder: ”Om ett företag som omfattas av en koncernredovisning har ett intresseföretag ska det intresseföretaget redovisas i den koncernbalansräkningen under en särskild post med lämplig beteckning.” Det tidigare sjunde direktivet innehöll en motsvarande bestämmelse i artikel 33.1. 
Den sammanställningsmetod för intresseföretag som avses i denna paragraf kallas i bokföringspraxis kapitalandelsmetoden. Eftersom metoden är en förenklad version av fullständig sammanställning, och den innebär att intresseföretagens tillgångar och skulder ingår i en post i koncernbalansräkningen och intäkter och kostnader på motsvarande sätt i en post i koncernresultaträkningen, används också begreppet enradskonsolidering (eng. one-line-consolidation) för metoden i fråga. Effekten av intresseföretagens sammanställning på koncernens resultat och egna kapital är den samma som om intresseföretagen skulle sammanställas som dotterföretag, fullständigt rad för rad i koncernbokslutet (den allmänna anvisnigen 7.11.2006 om upprättande av koncernbokslut, punkt 9.3). Syftet med kapitalandelsmetoden är sålunda att i koncernens balansräkning ta upp en andel av intresseföretagets nettotillgångar. 
Momentets andra mening är baserad på artikel 27.4 som lyder: ”Det bokförda värde - - som motsvarar andelen av intresseföretagets egna kapital ska ökas eller minskas med beloppet för alla ändringar som har skett under räkenskapsåret i den andel av intresseföretagets egna kapital som det ägarintresset representerar. En minskning ska äga rum som motsvarar beloppet av utdelningar som hänför sig till det ägarintresset.” Enligt denna artikel ― liksom enligt motsvarande bestämmelse i det tidigare sjunde direktivet (artikel 33.4) ― ska uppgifter om intresseföretag sammanställas med den s.k. kapitalandelsmetoden. Emellertid får ett intresseföretag som uppfyller kännetecknen på ett samföretag enligt 15 § i detta kapitel sammanställas i enlighet med det nämnda lagrummet. 
Kapitalandelsmetoden bygger på tankegången att balansvärdet av ett intresseföretag i koncernbokslutet är beroende av förändringen av eget kapital i intresseföretagets separata bokslut. Sammanställningsskyldigheten gäller endast sådan vinst eller förlust och sådan förändring av eget kapital i intresseföretaget, som har uppkommit efter förvärvet av intresseföretaget (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 9.2). Såsom närmare föreskrivs i 13 § ska beaktas en mot koncernens ägarandel svarande andel av intresseföretagets vinst eller förlust för den avslutade räkenskapsperioden samt annan sådan förändring av eget kapital som har uppkommit under ägandet av intresseföretaget, och från detta belopp ska i bokföringen dras av utdelningar eller annan vinstutdelning från intresseföretaget. Om intresseföretagets räkenskapsperiod har varit vinstbringande ökar värdet av ägandet i intresseföretaget enligt koncernbokslutet. En förlustbringande räkenskapsperiod innebär på motsvarande sätt att ägandets värde minskar. 
I enlighet med 13 § 4 mom. som behandlas nedan ska ett intresseföretags bokslutsuppgifter sålunda sammanställas så att ett belopp motsvarande ägarandelen i koncernföretagen av intresseföretagens vinst för räkenskapsperioden ska tas upp i koncernresultaträkningen som intäkt medan motsvarande belopp av förlusten ska redovisas som kostnad. Koncernens andel av intresseföretagets resultat som genereras efter förvärvet av intresseföretaget och av andra förändringar i eget kapital ska i koncernbalansräkningen läggas till anskaffningsutgiften för intresseföretagets aktier eller andelar och koncernens eget kapital (eller dras av från båda om det ackumulerade resultatet eller en annan förändring av eget kapital är negativa). En utdelning eller annan motsvarande vinstandel som erhållits från intresseföretaget ska däremot dras av från koncernens resultat och anskaffningsutgiften för aktierna. 
Det ändrade 2 mom. är dels baserat på artikel 27.9 som lyder: ”Denna artikel behöver inte tillämpas om ägarintresset i intresseföretagets kapital är oväsentligt.” och dels på artiklarna 23.9 och 6.1 j som behandlas ovan i samband med 3 §. 
Det gällande momentet är baserat på det tidigare sjunde direktivets artikel 33.9 som föreskrev om en generell grund för undantag, dvs. att uppgifterna om ett intresseföretag inte behövde tas upp i koncernbokslutet om en sammanställning av dem inte behövdes för att ge en rättvisande bild. Trots att det sjunde direktivet har upphävts kan denna undantagsgrund kvarstå i momentet eftersom den är förenlig med kravet på en rättvisande bild enligt artikel 4.2 i direktivets 2 kap., och artikel 24.1 förutsätter att nämnda 2 kap. tillämpas i koncernbokslut. Å andra sidan ska i fråga om en rättvisande bild alltid beaktas väsentlighetsprincipen enligt artikel 6.1 j. Då dessutom tillämpningen av undantagsgrunderna enligt artikel 23.9 inte är begränsad enbart till sammanställningen av dotterföretag utan artikeln mera allmänt gäller alla företag som ska ”tas upp” i koncernbokslutet, hör också intresseföretag till tillämpningsområdet för denna paragraf. Det vore inkonsekvent om förutsättningarna för att sammanställa dotterföretag inte skulle tillämpas också på intresseföretag. Sålunda innebär väsentlighetskriteriet för en rättvisande bild enligt momentets 1 punkt ― som också täcker den situationen enligt den nämnda artikeln 27.9 att ägarintresset är oväsentligt ― att utelämnande enligt 2 punkten är tillåtet också på någon annan sådan grund enligt artikel 23.9 och 3 § dvs. om 
- innehavet i dotterföretaget är kortvarigt och enbart avsett att överlåtas vidare, 
- de uppgifter som är nödvändiga för att upprätta koncernbokslutet inte kan erhållas inom den tid som bestämts för upprättandet av bokslutet eller om anskaffandet av uppgifterna medför oskäliga utgifter, eller om 
- betydande och varaktiga hinder i väsentlig grad begränsar moderföretagets möjligheter att utöva inflytande i intresseföretaget. 
I enlighet med bokföringsnämndens utlåtande 1292/1994 kan förutsättningarna dock beroende på karaktären av ägandet i intresseföretaget tolkas på ett något lindrigare sätt. 
Om den bokföringsskyldiga utnyttjar den möjlighet som avses i 2 mom. ska, i fråga om ett icke sammanställt intresseföretag, av koncernresultaträkningens och koncernbalansräkningens noter framgå namn och hemort samt den sammanlagda ägarandel som koncernföretaget har i detta dotterföretag och likaså information om företagets eget kapital och om räkenskapsperiodens vinst eller förlust enligt det senast upprättade bokslutet (bokföringsförordningens 4 kap. 3 § 1 mom. 4 punkten). Denna bestämmelse i förordningen är baserad på artikel 28.2 d. I det tidigare fjärde direktivet ingick motsvarande bestämmelse i artikel 34.5. 
Om något koncernbokslut inte upprättas ska dessutom fordringar och skulder som berör intresseföretag liksom motsvarande uppgifter om ägarintresseföretag enligt 1 kap. 7 § presenteras i balansräkningen enligt bokföringsförordningens 1 kap. 6 § 1 mom., liksom finansiella intäkter i resultaträkningen enligt kostnadsslag (10 b punkten) eller i resultaträkning enligt funktion enligt 2 § 1 mom. (9 b punkten). 
13 §.Sammanställning av intresseföretags bokslutsuppgifter. I denna paragraf föreskrivs om de principer enligt vilka uppgifter om intresseföretag ska sammanställas i koncernbokslutet. Trots att det är skäl att också i fråga om intresseföretag eftersträva enhetliga beräkningsprinciper framgår det av 1 mom. första meningen, som motsvarar den gällande bestämmelsen, att man kan avvika från denna regel. 4 § 2 mom. som det hänvisas till i meningen lyder: ” Koncernföretagens bokslut skall före sammanställningen ändras så att i dem enhetligt tillämpas de bokslutsprinciper enligt denna lag som följs antingen i moderföretaget eller i koncernens huvudsakliga verksamhet. Undantag från detta får göras av särskilda skäl.” 
Bestämmelsen är baserad på följande punkter i det gällande direktivet. Motsvarande bestämmelser ingick också i det sjunde direktivets artikel 33.3. 
- Artikel 27.3 första meningen: ” Om ett intresseföretags tillgångar eller skulder har värderats enligt andra metoder än de som används vid konsolidering i enlighet med artikel 24.11, får tillgångarna eller skulderna - - omvärderas enligt de metoder som används vid konsolideringen.” 
- Artikel 27.3 andra meningen: ”Om en sådan omvärdering inte har genomförts ska detta anges i noterna till koncernredovisningen.” 
- Artikel 27.3 tredje meningen: ” En medlemsstat får kräva att en omvärdering ska äga rum.” 
Av dessa direktivbestämmelser framgår att medlemsstaterna i enlighet med momentet kan bevilja undantag från principerna. En sådan förpliktelse som avses i artikelns tredje mening skulle å andra sidan inte vara ändamålsenlig, eftersom ett koncernföretag saknar bestämmanderätt i ett intresseföretag, vilket innebär att det inte nödvändigtvis finns att tillgå tillräcklig information för en sådan ändring (regeringens proposition 173/1997 och den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 9.2). 
Artikel 27.3 andra meningen förutsätter att om en omvärdering inte har genomförts ska detta anges i noterna till koncernredovisningen. En motsvarande bestämmelse ingår i bokföringsförordningens 4 kap. 2 § 5 punkten. Motiveringen till undantaget kan ― t.ex. på grund av avsaknad av bestämmanderätt ― vara att information som behövs för ändring av ett intresseföretags bokslut i överensstämmelse med koncernens bokslutsprinciper inte har kunnat fås (den allmänna anvisnigen 7.11.2006 om upprättande av koncernbokslut, punkt 9.2). 
Momentets andra mening gäller omräkning av ett utländskt intresseföretags bokslutsposter till finsk valuta. Denna bestämmelse är nationell men den kan inte anses stå i strid med direktivet, lika litet som 6 § som det hänvisas till i fråga om ändring av uppgifter om ett utländskt dotterföretag. 
Vid omräkningen tillämpas samma principer som i fråga om ett utländskt dotterföretags bokslutsposter, dvs. den omräkningsdifferens som uppkommer ska tas upp i koncernbalansräkningen bland eget kapital. I noterna ska dessutom anges grunderna för omräkningskursen (bokföringsförordningens 4 kap. 2 § 8 punkten Om aktier eller andelar som koncernen innehar i ett intresseföretag, eller en del av dessa säljs, realiseras omräkningsdifferensen som intäkt eller kostnad och upptas som en del av försäljningsvinsten eller förlusten. (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 9.11). 
Ordalydelsen i paragrafens 2 mom. har förenklats jämfört med den gällande och momentets innehåll har delvis omfördelats med 3 mom. Momentet är baserat på artikel 27.2 första stycket som lyder: ” När denna artikel tillämpas för första gången på ett intresseföretag ska detta företag redovisas i den koncernbalansräkningen, antingen 
a) till sitt bokförda värde, beräknat enligt värderingsreglerna i kapitlen 2 och 3; skillnaden mellan detta värde och det belopp som motsvarar den andel av det egna kapital som ägarintresset i det intresseföretaget representerar ska anges särskilt i den koncernbalansräkningen eller i noterna till koncernredovisningen; skillnaden ska beräknas med hänsyn till förhållandena vid den tidpunkt då metoden tillämpas första gången; eller 
b) till ett belopp som motsvarar den andel av intresseföretagets egna kapital som ägarintresset i det intresseföretaget representerar; skillnaden mellan detta belopp och det bokförda värdet beräknat enligt värderingsreglerna i kapitlen 2 och 3 ska anges särskilt i den koncernbalansräkningen eller i noterna till koncernredovisningen; skillnaden ska beräknas med hänsyn till förhållandena vid den tidpunkt då metoden tillämpas första gången.” 
Uppgifter om den differens som uppkommer vid tillämpning av de metoder som avses i artiklarna 27.2 a och 27.2 b kan sålunda i stället tas in i noterna, så som föreskrivs i gällande 4 kap. 4 § 5 punkten. Differensen motsvarar koncernaktiva eller -reserv som uppkommer vid förvärv av ett dotterföretag (regeringens proposition 173/1997). 
I nämnda artikel 27.2 andra stycket föreskrivs om tillämpning av medlemsstatsoptionen enligt artikel 27.2 a eller alternativt 27.2 b: ”En medlemsstat får föreskriva att antingen led a eller led b ska tillämpas. I sådana fall ska det i den koncernbalansräkning eller i noterna till koncernredovisningen anges vilket av alternativen som har tillämpats.” Det är åndamålsenligt att i Finland utnyttja denna option eftersom i koncernbokslutspraxis hos oss i allmänhet tillämpas endast förfarandet enligt artikel 27.2 a. Eftersom detta val görs på basis av lagstiftningen och inte enligt den bokföringsskyldigas egen prövning behövs sådana noter som avses i stycket inte och därför har inte heller någon bestämmelse om saken tagits in i lagen eller i bokföringsförordningen. 
Bestämmelser som motsvarar artikel 27.2 första och andra stycket ingick också i det tidigare sjunde direktivet artiklar 33.3 a - 33.c. 
Paragrafens 3 mom. som motsvarar den gällande bestämmelsen är baserat på medlemsstatsoptionen i artikel 27.2 tredje stycket, som lyder: ”Dessutom får en medlemsstat tillåta eller kräva att skillnaden - - beräknas med hänsyn till förhållandena vid den tidpunkt då aktierna eller andelarna förvärvades eller - - den tidpunkt då företaget blev ett intresseföretag.” Samma bestämmelse ingick i det sjunde direktivets artikel 33.3 d. Bestämmelsen har hållits kvar i lagen eftersom det alternativa förfarande som den föreskriver har visat sig vara behövligt i bokföringspraxis. 
Paragrafens 4 mom. som är av nästan samma lydelse som den gällande bestämmelsen är baserat på artiklarna 27.4 och 27.6 som gäller sammanställning av bokslutsuppgifter med koncernbokslut under räkenskapsperioderna, efter förvärvet av ett intresseföretag. Motsvarande bestämmelser ingick också i det sjunde direktivets artiklar 33.4 och 33.6. I momentet har gjorts uteslutande språkliga justeringar. De nämnda bestämmelserna i direktivet lyder: 
- Artikel 27.4: ” Det bokförda värde som avses i punkt 2 a eller det belopp enligt punkt 2 b som motsvarar andelen av intresseföretagets egna kapital ska ökas eller minskas med beloppet för alla ändringar som har skett under räkenskapsåret i den andel av intresseföretagets egna kapital som det ägarintresset representerar. En minskning ska äga rum som motsvarar beloppet av utdelningar som hänför sig till det ägarintresset.” 
- Artikel 27.6: ” Den del av resultatet i ett intresseföretag som hänför sig till ägarintressen i sådana intresseföretag ska redovisas i den koncernresultaträkningen under en särskild post med lämplig beteckning.” 
Momentet förutsätter att när intresseföretagets bokslutsuppgifter efter den första gången sammanställs med koncernbokslutet, ska i koncernbalansräkningen utöver anskaffningsutgiften för aktierna eller andelarna i intresseföretaget tas upp en mot koncernens innehav svarande andel av intresseföretagets vinster eller förluster. Från anskaffningsutgiften ska dessutom dras av de utdelningar och andra motsvarande vinstandelar som koncernföretagen under denna period erhållit från intresseföretaget. Motsvarande avdrag ska också göras från de utdelningsintäkter som tagits upp i koncernresultaträkningen (regeringens proposition 173/1997). 
Av intresseföretagets vinst för räkenskapsperioden ska ett belopp som motsvarar koncernföretagens ägarandel tas upp i koncernresultaträkningen som intäkt och motsvarande andel av förlusten som kostnad. En närmare bestämmelse om saken finns i bokföringsförordningens 3 kap. 2 § 2 mom. enligt vilket posterna i koncernresultaträkningen ska redovisas sammanräknade i gruppen intäkter och kostnader med benämningen ”Andel av intresseföretagens vinst (förlust).” Om postens särkaraktär kräver det, ska den dock tas upp antingen bland de intäkter och kostnader som redovisas före rörelsevinsten eller bland extraordinära intäkter och kostnader (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, bilaga 1). 
Andelen av intresseföretagens vinst eller förlust får tas upp bland intäkterna och kostnaderna före rörelsevinsten då intresseföretagets verksamhet ansluter sig till koncernens rörelseverksamhet. Så är till exempel fallet då intresseföretaget fungerar som inköpare av råmaterial, energiproducent eller försäljare eller marknadsföringsföretag för de produkter som koncernen tillverkar (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 9.4). 
Den i enlighet med denna paragrafs 4 - 7 punkt korrigerade anskaffningsutgiften för andelarna i ett intresseföretag ska i enlighet med bokföringsförordningens 3 kap. 3 § 2 mom. tas upp som en särskild post bland bestående aktiva i koncernbalansräkningen (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, bilaga 1). 
Så som ovan redan konstaterats ska andelen av intresseföretagens resultat och ändringar i eget kapital sammanställas från och med det att företaget blev ett intresseföretag Andelen av ett sålt intresseföretags resultat sammanställs i mån av möjlighet med koncernbokslutet fram till försäljningstidpunkten. Om inte givandet av en rättvisande bild enligt 3 kap. 2 § 1 mom. äventyras, kan andelen av intresseföretagets resultat för räkenskapsperioden under vilken försäljningen ägde rum lämnas utanför sammanställningen, varvid försäljningens inverkan på koncernen redovisas på basen av bokslutet för föregående räkenskapsperiod (den allmänna anvisnigen 7.11.2006 om upprättande av koncernbokslut, punkt 9.3). 
Paragrafens 5 mom. som motsvarar den gällande bestämmelsen är en nationell norm som inte är direkt baserad på direktivet. Liksom 8 § 1 mom. om dotterföretagets eget kapital, som stämmer överens med detta moment, står 5 mom. dock inte i strid med direktivet. 
Med stöd av momentet ska i intresseföretagets eget kapital även räknas in det sammanlagda beloppet av den ackumulerade avskrivningsdifferensen och de skattemässiga reserverna med avdrag av den latenta skatteskulden. Också vid beräkning av ett intresseföretags vinst eller förlust beaktas förändringen i avskrivningsdifferensen och de skattemässiga reserverna med avdrag av förändringen i den latenta skatteskulden. 
Med stöd av 7 § 6 mom. får en liten koncern i sitt koncernbokslut låta bli att utföra uppdelningen av avskrivningsdifferens och reserver i eget kapital och latent skatteskuld. Denna lindring av bestämmelserna hindrar inte moderföretaget i en liten koncern att vid upprättandet av koncernbokslut räkna avskrivningsdifferensen och reserverna med avdrag av den latenta skatteskulden till intresseföretagets eget kapital och förändringen av avskrivningsdifferens och reserver med avdrag av förändringen i den latenta skatteskulden till räkenskapsperiodens resultat (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 9.3). 
Paragrafens 6 mom. är i det närmaste identisk med den gällande bestämmelsen och baserad på artikel 27.5: ”Om en positiv skillnad enligt [artiklarna 27.2 a] och [27.2 b] inte kan hänföras till något visst slag av tillgångar eller skulder ska skillnaden behandlas i enlighet med de regler som gäller för posten ’goodwill’ som anges i artiklarna 12.6 d, 12.11 första stycket, 24.3 c samt bilagorna III och IV.” Också det tidigare sjunde direktivets artikel 33.5 föreskrev om en förpliktelse som gällde goodwill. 
I momentet har gjorts några tekniska justeringar på grund av ändringar i de övriga lagrum som hänvisningarna avser. 
Koncernaktiva och koncernpassiva ska enligt 8 § 5 mom. som det hänvisas till i momentet i första hand hänföras till de tillgångs- och skuldposter i intresseföretaget som de anses relatera till. Kostnadsföringen av koncernaktiva som uppdelats på tillgångsposter ska göras på basis av den post som den hänför sig till. Den del som hänförs överförs dock inte i koncernbalansräkningen till ifrågavarande balansposter, utan hålls som en del av intresseföretagets aktier eller andelars bokföringsvärde i koncernbalansräkningen (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 9.5). 
Den hänförda delen kostnadsförs genom avskrivningar eller antecknas som intäkt i samma takt som motsvarande tillgångsposter kostnadsförs eller skuldposter minskar. Den andel som inte kan hänföras kostnadsförs genom avskrivningar eller intäktsförs på samma sätt som koncerngoodwill eller koncernreserv som uppkommit vid sammanställning av ett dotterföretag Avskrivningarna av intresseföretagens koncernaktiva och -goodwill samt intäktsföringen av koncernpassiva och -reserv upptas i koncernresultaträkningen på samma rad som andelen av intresseföretagets vinst eller förlust. I koncernbalansräkningen minskas avskrivningens belopp från aktiernas eller andelarnas anskaffningsutgift och intäktsföringen läggs till den. (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 9.5). 
I koncernresultaträkningens och balansräkningens noter ska anges det ännu oavskrivna beloppet av koncernaktiva eller det ännu inte intäktsförda beloppet av koncernpassiva som beror på intresseföretag (bokföringsförordningens 4 kap. 4 § 5 punkten). 
Också den del av koncernaktiva eller -passiva i ett intresseföretag som inte överförts ingår i intresseföretagets aktiers eller andelars bokföringsvärde i koncernbalansräkningen (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 9.5) Enligt momentets hänvisningsbestämmelse ska den del av intresseföretagets koncernaktiva som inte hänförts, dvs. koncerngoodwill, avskrivas. Avdraget av den del av intresseföretagets koncernpassiva som inte hänförts, koncernreserven, ska å andra sidan tas upp i koncernresultaträkningen beroende på hur motsvarande utgift eller förlust har kostnadsförts vid beräkningen av dotterföretagets resultat eller hur det motsvaras av realiserad intäkt (regeringens proposition 173/1997). 
Avskrivningarna av intresseföretagens koncernaktiva och -goodwill samt intäktsföringen av koncernpassiva och -reserv redovisas i koncernresultaträkningen på samma rad som andelen av intresseföretagets vinst eller förlust. Med andra ord ska det sammanlagda beloppet av avskrivningar av koncerngoodwill och minskning av koncernreserv tas upp tillsammans med intresseföretagets resultatandel. I koncernbalansräkningen minskas avskrivningens belopp från aktiernas eller andelarnas anskaffningsutgift och intäktsföringen läggs till den (regeringens proposition 173/1997 och den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 9.5). 
Paragrafens 7 mom. motsvarar den gällande bestämmelsen och är baserad på artikel 27.7 som lyder ”Eliminering enligt artikel 24.7 ska äga rum i den mån de uppgifter som krävs föreligger eller är tillgängliga.” Samma bestämmelse ingick i det tidigare sjunde direktivets artikel 33.7. 
Ordalydelsen i paragrafens andra mening har anpassats till justeringen i 3 § 1 punkten. Ändringen är lagteknisk. 
Enligt artikel 24.7 ska i koncernredovisningen för de företag som omfattas av denna anges tillgångar, skulder, ekonomisk ställning och resultat, som om dessa företag utgjorde ett enda företag. Särskilt följande ska då från koncernredovisningen elimineras fordringar och skulder mellan företagen, intäkter och kostnader som hänför sig till transaktioner mellan företagen samt vinster och förluster som hänför sig till transaktioner mellan företagen, när dessa ingår i de bokförda tillgångsvärdena. 
På motsvarande sätt som enligt denna artikel hänvisas i momentet till 7 § 2 och 3 mom. Sålunda ska internvinster i koncern- eller intresseföretags balansräkningar dras av från bokföringsvärdet av intresseföretagets aktier eller andelar i koncernbalansräkningen. Om bokföringsvärdet efter minskningen blir negativt ska det belopp som borde dras av upptas som passiv resultatregleringspost enligt 4 kap. 6 § 2 mom. Den förändring i internvinsten som ingår i koncern- eller intresseföretagets resultat elimineras i koncernresultaträkningen från intresseföretagets resultatandel. Emellertid ska endast de internvinster mellan intresseföretaget och koncernföretagen elimineras, som uppkommit efter att företaget blev ett intresseföretag (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 9.6). 
Om intresseföretagsförhållandet har uppkommit tidigare än intresseföretagen måste sammanställas, kan elimineringen av internvinster påbörjas senast från början av den räkenskapsperiod då intresseföretaget första gången sammanställdes med koncernbokslutet (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 9.6). 
Om intresseföretagets innehav av aktier i koncernens moder- eller dotterföretag skulle tas upp i koncernbalansräkningen, skulle samma tillgångar finnas upptagna två gånger i koncernbalansräkningen, vilket inte är förenligt med de centrala principerna för koncern-bokslut. Därför bör intresseföretagets innehav av aktier i koncernföretag enligt bokföringsnämnden elimineras vid upprättande av koncernbokslut. Elimineringen sker genom att från koncernens andel av intresseföretagets eget kapital, före sammanställningen av intresseföretaget med koncernbalansräkningen minska den till koncernen hörande andelen av bokföringsvärdet för de aktier i moder- eller dotterföretaget som finns upptagna i intresseföretagets balansräkning (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 9.8). 
De från koncernföretag erhållna dividender som ingår i intresseföretagets resultat, be-handlas till den del de motsvarar andelen för koncernens innehav, på samma sätt som koncernens interna dividendutdelning. De dras sålunda av från andelen i intresseföretagets inkomst och läggs till balanserad vinst (förlust) från tidigare räkenskapsperioder i koncernbalansräkningen. Koncernföretagens minoritetsägares andel bör beaktas i detta sammanhang (den allmänna anvisningen 7.11.2006 om upprättande av koncernbokslut, punkt 9.8). 
16 §.Intresseföretagets koncernbokslut. Denna paragraf som motsvarar den gällande bestämmelsen är baserad på den tvingande artikeln 27.8: ”Om ett intresseföretag upprättar en koncernredovisning ska punkterna 1-7 tillämpas på det egna kapitalet i en sådan koncernredovisning.” Samma bestämmelse ingick i det sjunde direktivets artikel 33.8. Syftet med paragrafen är att det inte ska vara tillåtet att sammanställa ett intresseföretags, som har ställningen av moderföretag, och dess dotterföretags bokslutsinformation i koncernbokslutet, trots att ett sådant arrangemang inte skulle inverka på slutresultatet. 
Paragrafens utformning har kompletterats för att förtydliga att från intresseföretaget i en sådan situation ska sammanställas uppgifterna i koncernbokslutet. 
7 kap. Yrkesutövares bokföring
Lagens 7 kap. upphävs eftersom motsvarande bestämmelser om yrkesutövares bokföringsskyldighet har tagits in i nya 1 a § i 1 kap. Bestämmelserna är i sin helhet nationella eftersom Europeiska unionens direktiv inte gäller verksamhet av detta slag. I likhet med den gällande lagen tillåts yrkesutövare att ha enkel bokföring, vilket innebär att det i slutet av räkenskapsperioden ska upprättas en resultaträkning men inte någon balansräkning. 
7 a kap. Bokslut och koncernbokslut som ska upprättas enligt internationella redovisningsstandarder
Enligt lagens 7 a kap. får bokslut upprättas enligt internationella IFRS-standarder och koncernbokslut får upprättas också av andra bokföringsskyldiga än sådana företag som avses i IAS-förordningen och har emitterat aktier eller andra värdepapper som är föremål för offentlig handel. IFRS-standarderna är det enda alternativet: i Finland är det inte tillåtet att tillämpa något annat internationellt redovisningssystem vid upprättande av bokslut som avses i bokföringslagen. 
Kapitlet innehåller bestämmelser om både obligatorisk (2 §) och frivillig (3 §) tillämpning av standarderna. Vidare förtydligas i kapitlet förhållandet mellan standarderna och lagens övriga bestämmelser (4 §). Motsvarande bestämmelse finns också i bokföringsförordningens 1 §. 
Kapitlets bestämmelser gäller endast innehållet i bokslutet, då standarderna inte ger några anvisningar om verksamhetsberättelser. Vidare ska tillämpas bestämmelserna i 2 kap. om bokföring under räkenskapsperioden ― innan IFRS-bokslut upprättas ― och likaså bestämmelserna i 3 kap. om offentliggörande av bokslut och andra förfaranden. 
1 §.Internationella redovisningsstandarder. I denna paragraf definieras begreppet internationella redovisningsstandarder. Bestämmelsen motsvarar IAS-förordningens artiklar 2 och 3 enligt vilka med sådana standarder avses IFRS-standarder som kommissionen antagit för tillämpning inom Europeiska unionen samt de officiella SIC- och IFRIC-tolkningarna. Paragrafens ordalydelse har förenklats genom tillämpning av den nya definitionen av IAS-förordningen i 1 kap. 4 d §. 
De bokföringsskyldiga har varken skyldighet eller rätt att tillämpa standarden eller den officiella tolkningen av den, som inte (ännu) har antagits inom Europeiska unionen. Om en standard som inte ännu antagits inte står i konflikt med antagna standarder kan den ge vägledning om hur finansiella rapporter ska utformas (IAS 1 - ”Utformning av finansiella rapporter”, eng. Presentation of Financial Standards, punkt 22). Enligt nämnda punkt ska den bokföringsskyldiga då det varken finns någon lämplig IFRS-standard eller SIC-tolkning, efter eget övervägande välja det sätt som producerar möjligast nyttig information för användarna av bokslutet. Ledningen ska också beakta krav på och instruktioner för likartade frågor som behandlas i standarderna (regeringens proposition 126/2004). 
2 §.Obligatorisk tillämpning av internationella redovisningsstandarder. I paragrafens 1 mom. som preciserats i överensstämmelse med den gällande värdepappersmarknadslagen ska tillämpningsområdet för den obligatoriska användningen av internationella redovisningsstandarder omfatta koncernbokslut för företag vars värdepapper är föremål för handel på en reglerad marknad. Bestämmelsen motsvarar i sak artikel 4 i IAS-förordningen (regeringens proposition 126/2004). Som värdepapper betraktas enligt IAS-förordningen och sålunda också vid tillämpningen av denna paragraf inte bara aktier utan också skuldebrev. 
Bestämmelsen gäller handel som ordnats på börsen eller på någon annan reglerad marknad i Finland samt i andra EES-länder. Handel utanför EES, oberoende av om den avser värdepapper som emitterats av ett finländskt aktiebolag eller av någon annan bokföringsskyldig, hör inte till tillämpningsområdet för bestämmelsen. 
En medlemsstat kan med stöd av IAS-förordningen tillåta eller kräva att ett bolag som avses i artikel 4 vid sidan av sitt koncernbokslut också upprättar sitt årsbokslut i enlighet med de internationella redovisningsstandarderna (artikel 5 a). En bestämmelse om detta har tagits in i 2 mom. för att borsnoterade företag som inte är skyldiga att upprätta koncernbokslut enligt bokföringslagen ska vara skyldiga att upprätta separata IFRS-bokslut (regeringens proposition 126/2004). 
8 kap. Särskilda bestämmelser
I lagens 8 kap. föreskrivs om behörighet i bokföringsärenden. Tillsynen fördelas mellan patent- och registerstyrelsen samt arbets- och näringsministeriet, om det inte är fråga om finansierings- eller försäkringsverksamhet (1 §). I kapitlet föreskrivs vidare om bokföringsnämndens befogenhet att ge utlåtanden och bevilja undantag (2 §). Bestämmelsen om bokföringsförseelse (4 §) kompletterar strafflagens 30 kap. 9, 9 a och 10 § om bokföringsbrott. 
En viktig bestämmelse är också kapitlets 5 § enligt vilken bokföringslagen är subsidiär i förhållande till andra lagar. Dessutom ingår i kapitlet ett bemyndigande att utfärda närmare bestämmelser (6 §). 
1 §.Främjande av lagens syfte samt tillsyn. Enligt den allmänna bestämmelsen i 1 mom. åläggs arbets- och näringsministeriet att övervaka efterlevnaden av bokföringslagen, om inte någon annan myndighet uttryckligen har befullmäktigats att sköta samma uppgift. Ministeriet bedriver inte regelmässig tillsynsverksamhet utan vidtar i stället åtgärder på basis av inkomna anmälningar. Sådana är emellertid ytterst sällsynta och bestämmelsen har sålunda inte fått någon större betydelse. Under de senaste tio åren har till ministeriet inte inkommit anmälningar av det slag som avses ovan. En bestämmelse som de facto har större betydelse för tillsynen är 28 § 2 mom. i lagen om Skatteförvaltningen (503/2010) som berättigar Skatteförvaltningen att anmäla ärenden som gäller bokföringsbrott till polisen för undersökning. 
Arbets- och näringsministeriets tillsyn syftar i praktiken till att på ett allmänt plan följa efterlevnaden av lagen. Denna uppföljning sker indirekt genom bokföringsnämndens anvisningar, så som föreskrivs i 2 §. För att beskriva nämndens uppgifter har momentets första mening ändrats. 
Den gällande andra meningen har ersatts med in informativ bestämmelse enligt vilken ministeriet publicerar nämndens ställningstaganden för att främja god bokföringssed. Ställningstagandena publiceras numera på ministeriets webbsidor. Förfarandet motsvarar 1 § 1 punkten i förordningen om bokföringsnämnden (784/1973) enligt vilken nämnden genom förmedling av ministeriet meddelar allmänna råd och anvisningar om tillämpningen av bokföringslagen och om bokföring, då nämnden för främjande av enhetlig god bokföringssed anser skäl därtill föreligga. 
I överensstämmelse med dessa ändringar har också lagrummets rubrik kompletterats för att ange att paragrafen utöver tillsyn gäller också främjande av lagens syfte. 
Paragrafens 2 mom. som motsvarar den gällande bestämmelsen föreskriver att patent- och registerstyrelsen ska övervaka att de bokföringsskyldiga sänder in sina bokslutsdokument till patent- och registerstyrelsens offentliga register. Om anmälningsskyldigheten åsidosätts kan patent- och registerstyrelsen förelägga vite för att en bokföringsskyldig ska uppfylla sin anmälningsskyldighet. 
Paragrafens 3 mom. har förenklats i lagtekniskt hänseende, men till innehållet motsvarar momentet den gällande bestämmelsen. Momentets 1 punkt avgränsar på finansierings- och försäkringsmarknaden verksamma företags bokföringar utanför arbets- och näringsministeriets tillsynsansvar. Också sådana företag är å andra sidan skyldiga att i enlighet med 3 kap. 9 och 10 § sända in sina bokslutsdokument till patent- och registerstyrelsen för registrering och publicering. 
I fråga om de internationella redovisningsstandarder som avses i momentets 2 punkt sträcker sig Finansinspektionens tillsynsbefogenheter enbart till företag som är skyldiga att iaktta standarderna. Med stöd av den allmänna bestämmelsen i denna paragrafs 1 mom. är det å andra sidan arbets- och näringsministeriet som ska övervaka bokföringsskyldiga som i enlighet med 7 a kap. 3 § frivilligt tillämpar IFRS-standarderna. 
Om ett bokslut enligt Finansinspektionens uppfattning inte stämmer överens med standarderna kan Finansinspektionen uppmana den bokföringsskyldiga att korrigera sitt bokslut i överensstämmelse med standarderna. Finansinspektionens uppfattning kan hänskjutas till bokföringsnämnden för omprövning, eftersom den bokföringsskyldiga i enlighet med 2 § 3 mom. i detta kapitel kan be nämnden ge ett utlåtande om saken. 
2 §.Bokföringsnämnd. Ordalydelsen i paragrafens 1 mom. har justerats eftersom ministeriet bytt namn samt i överensstämmelse med föregående 1 § 1 mom. De uppgifter som enligt momentet ankommer på bokföringsnämnden kompletteras i 1 § i förordningen om nämnden så att nämnden kan ge allmänna råd och anvisningar om tillämpningen av bokföringslagen och om bokföring, då nämnden anser det vara befogat för att i enlighet med 1 kap. 3 § främja god bokföringssed. Dessutom kan nämnden till arbets- och näringsministeriet göra framställningar och ge utlåtanden om sådana frågor som avses ovan. Ansökan till nämnden ska göras skriftligen (förordningen om bokföringsnämnden, 3 § 1 mom. första meningen). 
De aktörer som nämns i momentet är i praktiken endast exempel. Nämnden har nämligen gett utlåtanden bl.a. i sådana fall då sökanden varit en aktieägare som bett nämnden ge ett utlåtande om ett bostadsaktiebolags bokföring, trots att sökanden inte skött bokföringen (utlåtande 1825/2008). En förutsättning är dock alltid att utlåtandet behövs för att i enlighet med lagens 1 kap. 3 § styra god bokföringssed. I en sådan situation brukar nämnden inte avvisa begäran enbart av formella skäl. 
Ordalydelsen i paragrafens 2 mom. har preciserats. En bokföringsskyldig kan enligt momentet beviljas undantag från en tvingande bestämmelse i lag. Undantag kan inte beviljas genom nämndens utlåtande som gäller tolkning av gällande bestämmelser. 
Efter 2004 års lagändring har bokföringsnämnden relativt små befogenheter att bevilja undantag. Undantag kan inte över huvud taget beviljas i fråga om omfattningen av eller innehållet i bokslut och verksamhetsberättelse. Undantagen begränsas till bestämmelser om tiden för upprättande av bokslut och verksamhetsberättelse (3 kap. 6 §) samt om räkenskapsperioden för dotterföretag och moderföretag (6 kap. 5 § 1 mom.) och till 2 kap. 9 § om förvaring av bokföringsmaterial utomlands. Det föreslås emellertid att i nämnda 2 kap. 9 § stryks specialbestämmelserna om förvaring utomlands, vilket innebär att inte heller undantagsmöjligheten i fråga om detta lagrum längre behöver kvarstå i momentet. 
En ovillkorlig förutsättning för beviljande av undantag är alltid att undantaget inte strider mot Europeiska unionens bestämmelser om redovisning och koncernredovisning. Bokföringsnämnden har å andra sidan bl.a. i sina utlåtanden 1518/1998 och 1560/1999 fäst avseende också vid den doktrin om s.k. direkt rättsverkan som förekommer i direktiven. Enligt de nämnda utlåtandena fick en bokföringsskyldig som var ett sådant företag som avses i Europeiska unionens redovisningsdirektiv gällande finansinstitut, tillämpa resultaträknings- och balansräkningsscheman som ingick i ministeriebeslutet varmed direktivet genomfördes, trots att beslutet inte var förpliktande för den bokföringsskyldiga på grund av att denna inte var ett kreditinstitut som omfattades av tillsynen. Nämnden ansåg att förutsättningarna för direkt tillämpning av direktivet var uppfyllda eftersom den bokföringsskyldiga var ett sådant finansinstitut i aktiebolagsform som avses i direktivet och eftersom det var fråga om ett enskilt företags rätt gentemot en myndighet, dvs. om den bokföringsskyldigas rätt att uppfylla skyldigheten att lämna in sina bokslutsdokument till handelsregistret. Förfarandet förutsatte inte att nämnden beviljade undantag. Nämnden har emellertid numera i sitt utlåtande 1828/2008 behandlat en liknande fråga om direktivets direkta effekt. 
Enligt 3 § 1 mom. andra meningen i förordningen om nämnden ska ansökan om undantag i stadgandena angående bokslut dessutom göras i så god tid att beslutet kan fattas innan bokslutet ska upprättas enligt bokföringslagen. 
Bokföringsnämndens undantagsbeslut är avgiftsbelagda i enlighet med arbets- och näringsministeriets förordning av avgiftsbelagda prestationer. Utlåtandena är avgiftsfria eftersom publiceringen av dem har en allmän betydelse för styrningen av god bokföringssed enligt lagens 1 kap. 3 §. 
Enligt paragrafens 3 mom. första meningen gäller bokföringsnämndens befogenheter och uppgifter inte bokföringsskyldiga som omfattas av Finansinspektionens tillsynsansvar och inte heller tolkningen av de internationella redovisningsstandarderna. Enligt momentet kan nämnden dock utan hinder av det som nämns ovan ge utlåtanden om tillämpningen av standarderna till Finansinspektionen och likaså till bokföringsskyldiga som begärt utlåtande om tillämpningen av en standard i ett enskilt fall. 
Nämnden kan också ta ställning till frågor som gäller upprättande av bokslut i enlighet med de internationella redovisningsstandarderna, till den del som det är fråga om tillämpning av bokföringslagens bestämmelser. Avsikten med momentet är inte heller att inskränka den i nämndens allmänna anvisningar och utlåtanden vedertagna praxisen enligt vilken man vid tillämpningen av bokföringslagen ― med beaktande av redovisningsdirektivets tvingande bestämmelser ― som kompletterande eller alternativa normer kan tillämpa redovisningsmetoder som är baserade på standarderna (regeringens proposition 209/2004). 
Till nämndens sammansättning enligt 4 mom. har av hävd hört redovisningsforskare samt experter på bokföringstjänster, revision och beskattning. Också inrikesministeriet, finansministeriet, social- och hälsovårdsministeriet och Finansinspektionen har varit representerade i nämnden. Nämndens snäva befogenheter när det gäller undantag understryks i 5 mom. enligt vilket kravet på nämndens juridiska sakkunskap gäller uttryckligen behandlingen av ansökningar om undantag. 
I förordningen om nämnden föreskrivs om den i paragrafens 6 mom. avsedda kommunsektionens uppgifter, sammansättning, tillsättning och beslutförhet. Enligt den gällande paragrafen har nämnden också en IFRS-sektion. Eftersom denna sektion inte på flera år har fått frågor om upprättande av IFRS-bokslut kan den dras in som obehövlig. Nämnden kan i fortsättningen separat ta ställning till eventuella tolkningsfrågor i den ordning som föreskrivs i 36 § i lagen om Finansinspektionen. Av denna anledning upphävs i förordningen om bokföringsnämnden (784/1974) 1 b § som gäller IFRS-sektionen. 
Enligt paragrafens 7 mom. ska bokföringsnämndens sekreteraruppgifter skötas av tjänstemän vid arbets- och näringsministeriet. Nämnden har också anlitat sekreterare i bisyssla, bl.a. för att säkerställa den särskilda sakkunskap som behövs för beredningen av allmänna anvisningar. 
Bokföringsnämnden är en förvaltningsmyndighet. Det ovillkorliga förbudet enligt 8 mom. att söka ändring i dess beslut ― varmed avses undantagsbeslut baserade på 2 § 2 mom. i detta kapitel ― är i förvaltningsrättsligt hänseende atypiskt, eftersom var och en enligt grundlagens (732/1999) 21 § 1 mom. har rätt att få ett beslut som gäller hans eller hennes rättigheter och skyldigheter behandlat vid domstol eller något annat oavhängigt rättskipningsorgan. 
Enligt förvaltningslagens (434/2003) 48 § ska den bestämmelse som ligger till grund för ett besvärsförbud anges i beslutet. Besvärsförbudet innebär att nämndens beslut vinner laga kraft omedelbart då det ges. 
4 §.Bokföringsförseelse. Det anses i allmänhet vara motiverat att påföra en straffrättslig påföljd endast då skadeståndsansvaret inte anses vara en tillräcklig effektiv påföljd. Detta beror vanligen på en situation där det är svårt att leda i bevis hur skadan uppkommit och hur allvarlig den är (regeringens proposition 109/2005, s. 210). Också i fråga om bokföringen har lagstiftaren identifierat situationer där hot om straffrättsliga påföljder behövs. Också Europeiska unionens lagstiftning förutsätter sanktionshot. Enligt offentlighetsdirektivets artikel 6 ska medlemsstaterna fastställa påföljder för sådana fall då balansräkningen och resultaträkningen inte offentliggörs. 
Bokföringsbrott och -förseelser är ofta accessoriska i den bemärkelsen att syftet med dem är främja t.ex. ett skattebrott eller gäldenärsbrott. Då ska bestämmelserna om båda brotten tillämpas, men straffmätningen ska baseras på en bedömning av brotten som en helhet. 
I paragrafens 1 mom. räknas uttömmande upp gärningar och försummelser som kan betraktas som bokföringsförseelse. Den grundlagsfästa legalitetsprincipen förutsätter detta (regeringens proposition 173/1997). 
Momentet är subsidiärt i förhållande till de strängare bestämmelserna i strafflagens 30 kap. 9, 9 a och 10 § men en dom också för en bokföringsförseelse ― oberoende av att den är ”lindrig” ― förutsätter alltid subjektiv skuld, dvs. bevis på uppsåt eller grov oaktsamhet så som nämns i momentet. Uppsåt innebär att gärningsmannen eftersträvat resultat som motsvarar rekvisiten eller åtminstone uppfattat detta som en relativt sannolik konsekvens av gärningen eller försummelsen, medan en person som handlar oaktsamt, däremot medvetet eller omedvetet tar en risk. Vid bedömningen av grovhetsgraden beaktas hur betydande den åsidosatta aktsamhetsplikten är, hur viktiga de äventyrade intressena och hur sannolikt kränkningen är, hur medveten gärningsmannen är om att han eller hon tar en risk samt övriga omständigheter som har samband med gärningen och gärningsmannen (strafflagens 3 kap. 7 § 2 mom.). 
Momentets ordalydelse begränsar inte kretsen av gärningsmän. För en förseelse kan ― liksom för ett bokföringsbrott som definieras i SL 30 kap. 9 § 1 mom. ― dömas en fysisk person som är bokföringsskyldig i egenskap av rörelseidkare eller yrkesutövare eller en företrädare för denna och likaså den som är medlem i eller annars representerar en bokföringsskyldig sammanslutnings eller stiftelses organ. Straffhotet sammanhänger emellertid inte enbart med den formella ställningen utan det sträcker sig dessutom till personer som på grund av sitt ägande eller annars utövar faktisk beslutanderätt i sammanslutningen. I strafflagsbestämmelsen nämns ytterligare den åt vilken bokföringen har uppdragits. Denna straffbestämmelse gäller sålunda också den som är anställd hos en bokföringsbyrå. 
Hänvisningen i momentets 1 punkt till noteringar i bokföringen ändras så att den avser 4 mom. i 2 kap. 4 §. Dessutom preciseras 3 punkten så att den avser 2 kap. 9 § i dess helhet, eftersom det ovan föreslås att den i paragrafen nämnda begränsningen gällande förvaring utomlands ska strykas i lagen. Detta påföljdshot främjar för sin del åtgärder som avser bekämpning av grå ekonomi. 
Momentets 2 och 4 punkt motsvarar de gällande bestämmelserna. 
Ett aktiebolag som åsidosätter sin registreringsskyldighet enligt 5 punkten får enligt aktiebolagslagens 20 kap. 4 § också försättas i likvidation eller strykas ur handelsregistret. Dessförinnan kan registermyndigheten dock i praktiken ålägga en styrelseledamot eller verkställande direktören att uppfylla anmälningsskyldigheten (aktiebolagslagens 8 kap. 11 § 3 mom.) Den som till handelsregistret lämnar in en handling som han eller hon vet att är felaktig till innehållet kan bestraffas med böter eller fängelse i högst sex månader, om inte strängare straff för gärningen bestäms på något annat ställe i lag (strafflagens 16 kap. 8 § 1 mom.). 
Enligt paragrafens 2 mom. ska till straff för bokföringsförseelse inte dömas om förseelsen är ”ringa”. Bedömningen ska i första hand göras från den persons synpunkt som utnyttjar bokslutsinformationen. 
Finlands lagstiftning uppfyller i detta avseende de krav som framgår av EU-domstolens avgöranden. Domstolen har ansett att medlemsstaterna ska genomföra direktiven så att nationell rätt för myndigheterna innebär rätt och skyldighet att övervaka registreringen av bokslutshandlingar. Domen 29.9.1998 i målet C - 191/95 (kommissionen mot Tyskland) gällde tysk lagstiftning. EU-kommissionen framhöll att trots att det i Tysklands handelslag (Handelsgesetzsbuch) föreskrivs om kapitalassociationers skyldighet att offentliggöra sina årsbokslut, föreskrivs det i den nationella lagstiftningen inte om effektiva rättsliga metoder att säkerställa iakttagandet av denna skyldighet. I handelslagen föreskrivs visserligen att vite kan utdömas för det fall att företrädare för en kapitalassociation inte iakttar skyldigheten att offentliggöra årsbokslut, men den domstol som för registret kan inte ex officio förelägga sådant vite (punkt 64). 
Detta sätt att genomföra redovisningsdirektivet var enligt domstolens åsikt otillräckligt. Det fanns således anledning att fastställa att Förbundsrepubliken Tyskland underlåtit att uppfylla sina skyldigheter för de fall då kapitalassociationer underlåter att uppfylla det obligatoriska kravet på att offentliggöra sina årsbokslut (punkt 69). 
5 §.Bestämmelser om bokföring i andra lagar. Av paragrafens 1 mom. framgår att bokföringslagen är subsidiär i förhållande till bokförings- och bokslutsbestämmelser i andra lagar och i myndighetsföreskrifter. Sådana specialbestämmelser åsidosätter därför bokföringslagens motsvarande bestämmelser. 
Till paragrafen fogas ett nytt 2 mom. som motsvarar direktivets maximiregleringsprincip i fråga om små- och mikroaktiebolag. Enligt artikel 4.5 och artikel 16.2 fjärde stycket får medlemsstaterna kräva att andra företag än små företag i sina årsbokslut lämnar upplysningar som går utöver det som krävs enligt direktivet. 
Paragrafens nya 3 mom. är baserat på artikel 4.6 enligt vilken medlemsstaterna när de angivna förutsättningarna är uppfyllda får lämna upplysningar som går utöver kraven i direktivet, men enbart av skatteuppbördsskäl. 
6 §.Närmare bestämmelser. Paragrafens 1 mom. kompletteras med en delegeringsbestämmelse som bemyndigar statsrådet att för små- och mikroföretag utfärda en särskild förordning om uppgifter som ska tas upp i deras bokslut. Förordningen innehåller så som direktivet förutsätter uttömmande bestämmelser om informationskraven för sådana bokföringsskyldiga. 
I paragrafens 2 mom. uppdateras ministeriets namn och hänvisningarna till de definitionsbestämmelser som avser företagsstorlek. I momentet har också strukits den onödiga bestämmelsen om justering till följd av förändringar i penningvärdet. 
Ikraftträdande- och övergångsbestämmelserför 2015 års lagändringar 
Bestämmelsens 1 mom. är baserat på direktivets artikel 53.1 andra stycket enligt vilket medlemsstaterna får föreskriva att de nya bestämmelserna ska tillämpas första gången på finansiella rapporter för det räkenskapsår som börjar den 1 januari 2016 eller därefter, trots att den nämnda artikeln förutsätter att medlemsstaterna ska genomföra direktivet senast den 20 juli 2015. Enligt traditionen i bokföringslagstiftning får bokföringsskyldiga möjligheten att tillämpa denna lag även till bokslut, som upprättas efter att lagen trädde i kraft. 
Motiveringen till 2 mom. framgår ovan i anslutning till 5 kap. 2 a §. 
Motiveringen till 3 mom. är densamma som till 5 kap. 5 b § och till 4 mom. densamma som till kapitlets 8, 9 och 11 §. 
1.2
Lag om offentliggörande av sådana betalningar till myndigheter som gjorts av företag som är verksamma i utvinningsindustrin eller inom avverkning av narturskog
1 §.Tillämpningsområde. Paragrafens 1 mom. är baserat på den ovillkorliga artikeln 42.1 som lyder: ”Medlemsstaterna ska kräva att stora företag och alla företag av allmänt intresse som är verksamma inom utvinningsindustrin eller avverkning av primärskog upprättar och offentliggör en årlig rapport om betalningar som gjorts till offentliga myndigheter.” 
Denna rapport kallas i momentet årsrapport, för att beskriva att den ska offentliggöras regelbundet. 
I direktivets ingress beskrivs bakgrunden till förpliktelsen på följande sätt: 
- ”För att sörja för ökad öppenhet när det gäller betalningar som görs till offentliga myndigheter bör stora företag och företag av allmänt intresse som är verksamma i utvinningsindustrin eller inom avverkning av primärskog (9) redovisa väsentliga betalningar till offentliga myndigheter i länder där de är verksamma i en särskild rapport som lämnas årligen” (punkt 44 första meningen). 
- ”Rapporten bör tjäna till att underlätta för offentliga myndigheter i resursrika länder att genomföra EITI:s principer och kriterier och gentemot sina medborgare redogöra för betalningar sådana offentliga myndigheter mottar från företag som är verksamma i utvinningsindustrin eller inom avverkning av primärskog inom sin jurisdiktion” (punkt 45 första meningen). 
- ”Initiativet kompletterar också Europeiska unionens handlingsplan för skogslagstiftningens efterlevnad samt förvaltning av och handel med skog (EU Flegt) och Europaparlamentets och rådets förordning (EU) nr 995/2010 av den 20 oktober 2010 om fastställande av skyldigheter för verksamhetsutövare som släpper ut timmer och trävaror på marknaden (10), som föreskriver att de som handlar med timmerprodukter ska säkerställa att olagligt avverkat timmer inte kommer in på unionsmarknaden” (punkt 44 fjärde meningen)  
Genom 2 mom. utesluts företag av mindre storlek från lagens tillämpningsområde, med hänvisning till artikel 3.4 och motsvarande gränser för storföretag. 
2 §.Definitioner. I paragrafens 1 mom. 1 punkten definieras de företagsformer som avses i lagen. Dessa är för det första artikel 1.1 aktiebolag och i artikeln närmare definierade personbolag vilkas ägare uteslutande är aktiebolag eller andra sådana personbolag. Med sådana företag jämställs finländska andelslag, för att företagsverksamhetens juridiska karaktär inte ska inverka på offentliggörande av betalningar i enlighet med lagen.  
Definitionen av begreppet företag av allmänt intresse i momentets 2 punkt motsvarar definitionen i bokföringslagens 1 kap. 9 §, medan definitionen av begreppet utvinningsindustri i 3 punkten motsvarar artikel 43.1. I Europaparlamentets och rådets förordning 1893/2006 som det hänvisas till i den sist nämnda punkten räknas upp följande verksamhetsområden: ”Stenkolsutvinning, Brunkolsutvinning, Utvinning av råpetroleum, Utvinning av naturgas, Järnmalmsutvinning, Utvinning av uran- och thoriummalm, Utvinning av annan malm, Brytning av natursten, kalk- och gipssten, krita och skiffer, Utvinning av sand, grus och berg; utvinning av lera och kaolin, Övrig utvinning av mineral, Brytning av kemiska mineral, Torvutvinning, Saltutvinning och diverse övrig utvinning av mineral. 
Momentets 4 punkt om avverkning av naturskog motsvarar artikel 41.2. Förordningen 1893/2006 som det hänvisas till i artikeln innehåller ingen definition av begreppet naturskog, men i direktiv 2009/28/EG finns följande definition: ”naturligt föryngrad skog med inhemska arter, där det inte finns några klart synliga tecken på mänsklig verksamhet och där de ekologiska processerna inte störts i betydande utsträckning”.  
Motsvarande definition av begreppet naturskog finns i 7 § 1 punkten i lagen om biodrivmedel och flytande biobränslen (393/2013), som lyder: ”Råvaran får inte komma från mark som i januari 2008 eller därefter har varit 1) naturskog eller annan trädbevuxen mark där det inte finns några klart synliga tecken på mänsklig verksamhet och där de ekologiska processerna inte störts i betydande utsträckning”. 
Motiveringen till nämnda lag (regeringens proposition 13/2013 s. 22) lyder: ”Vid bedömningen av om marken ska betraktas som naturskog enligt hållbarhetskriteriet för biologisk mångfald kan man som hjälp vid tolkningen använda sig av den definition av naturskog som nämns i skäl 69 i RES-direktivets [dvs. Europaparlamentets och rådets direktiv 2009/28/EG om främjande av användningen av energi från förnybara energikällor och om ändring och ett senare upphävande av direktiven 2001/77/EG och 2003/30/EG] ingress och som FN:s organisation för livsmedel och jordbruk (FAO) använder i sin globala bedömning av skogsresurserna. Enligt FAO:s arbetsdokument om viktiga särdrag för naturskogar som avses i definitionen kännetecknas naturskogar av skogens naturliga dynamik med avseende på trädartsammansättningen, förekomst av död ved och naturlig åldersstruktur och naturlig föryngring. De bör också vara tillräckligt vidsträckta för att särdragen ska kunna bevaras, och de bör inte ha påverkats av mänsklig verksamhet i någon betydande utsträckning eller en tillräckligt lång tid ska ha förflutit sedan de påverkades av mänsklig verksamhet. Enligt skäl 69 i direktivets ingress bör vissa andra skogar där den mänskliga inverkan är liten jämställas med dessa naturskogar. Däremot bör t.ex. modifierad naturlig skog, halvnaturlig skog och planterad skog inte betraktas som naturskog.” 
Begreppet myndighet i 5 punkten vari inbegrips underlydande ämbetsverk, definieras i enlighet med respektive rättssystem. I fråga om uttrycket ”bestämmande inflytande” hänvisas till bokföringslagens 1 kap. 5 § enligt vilken bestämmande inflytande utgör grunden för ett koncernförhållande. Punkten motsvarar artikel 41.3 enligt vilken med offentlig myndighet avses ”en nationell, regional eller lokal myndighet i en medlemsstat eller ett tredje land. Häri inbegrips en avdelning, en byrå eller ett företag som kontrolleras av den myndigheten enligt vad som föreskrivs i artikel 22.1–6 i detta direktiv.”. 
I momentets 6 punkt definieras begreppet projekt i enlighet med artikel 41.4 första meningen: ”projekt: de operativa verksamheter som styrs av ett enda kontrakt, en enda licens, ett enda arrende, en enda koncession eller ett enda liknande lagenligt avtal och som ligger till grund för betalningsansvar gentemot en offentlig myndighet.” Motsvarande definition ingår i direktivets ingress, punkt 45 tredje meningen. 
I momentets sista punkt, dvs. 7 punkten, definieras på ett heltäckande sätt de olika typerna av betalning i överensstämmelse med artikel 41.5. I direktivingressens punkt 44 tredje meningen föreskrivs följande om betalningarna: ” Rapporten bör inkludera typer av betalningar jämförbara med dem som öppet redovisats av ett företag som deltar i utvinningsindustrins initiativ för ökad öppenhet (EITI).” I den nämnda EITI-organisationens standard, punkt 4.1 b ingår en klassificering som motsvarar direktivets: ”The following revenue streams should be included: 
The host government’s production entitlement (such as profit oil). 
National state-owned enterprise production entitlement. 
Profits taxes. 
Royalties. 
Dividends. 
Bonuses, such as signature, discovery and production bonuses. 
Licence fees, rental fees, entry fees and other considerations for licences and/or concessions. 
Any other significant payments and material benefit to government."  
I paragrafens 2 mom. hänvisas som en definition av stora koncerner till motsvarande bestämmelser i nya 6 a § i bokföringslagens 1 kap., som är baserad på artiklarna 3.5 och 3.6. 
Paragrafens 3 mom. preciserar definitionen av begreppet projekt i 1 mom. 6 punkten i överensstämmelse med artikel 41.4 andra meningen som lyder: ”Om flera sådana kontrakt i väsentlig grad är sammankopplade ska dessa dock anses utgöra ett projekt.” I direktivets ingress, punkt 45 femte och sjätte meningen, beskrivs situationen på följande sätt: ” ”I väsentlig grad sammankopplade” lagenliga avtal bör ses som en uppsättning operativt och geografiskt integrerade kontrakt, licenser, arrenden, koncessioner eller till varandra kopplade avtal med i allt väsentligt liknande villkor som har undertecknats med en offentlig myndighet och som leder till betalningsansvar. Sådana avtal kan styras av ett enda kontrakt, ett enda konsortium, ett enda produktionsdelningsavtal, eller ett enda annat övergripande lagenligt avtal.” 
I paragrafens 4 mom. föreskrivs hur vinstutdelning och andra utdelningar ska beaktas i årsrapporten. Bestämmelsen är baserad på direktivingressens punkt 48, första och andra meningen som lyder: ”Ett företag med verksamhet i utvinningsindustrin eller inom avverkning av primärskog behöver i allmänhet inte uppge utdelningar som gjorts till en regering som innehar stamaktier eller vanliga aktier i det företaget, under förutsättning att utbetalningen görs till regeringen på samma villkor som till övriga aktieägare. Företaget kommer emellertid att behöva uppge eventuella utdelningar som gjorts i stället för produktionsrättigheter eller royaltyer.” 
Paragrafens 5 mom. förbjuder konstlade arrangemang för kringgående av anmälningsskyldigheten. Bestämmelsen är baserad på artikel 43.4 andra meningen som lyder: ”Betalningar och verksamheter får inte på ett konstlat sätt delas upp eller slås ihop i syfte att undgå tillämpningen av detta direktiv.” Detta förbud kompletteras genom 3 § 4 mom. som är baserat på första meningen i nämnda artikel och understryker vikten av att uppgifternas faktiska karaktär beaktas. 
3 §.Årsrapportens innehåll. Den specificering av uppgifterna i årsrapporten som förutsätts enligt paragrafens 1 mom. stämmer överens med artiklarna 43.2 a och 43.2 b: ” I rapporten ska följande uppgifter för motsvarande räkenskapsår redovisas med avseende på verksamheter som beskrivs i artikel 41.1 och 41.2. 
a) De totala belopp som har utbetalats till varje offentlig myndighet. 
b) Det totala belopp per typ av betalning som anges i artikel 41.5 a–g som har utbetalats till varje offentlig myndighet.” 
Paragrafens 2 mom. kompletterar i överensstämmelse med artikel 43.2 c det specificeringskrav i fråga om projekt som avses i det föregående momentet: ”Om sådana betalningar har hänförts till ett specifikt projekt, det totala belopp per typ av betalning som anges i artikel 41.5 a–g som har utbetalats för varje sådant projekt samt det totala utbetalade beloppet för varje sådant projekt.” 
I paragrafens 3 mom. föreskrivs om gränsdragningen mellan redovisning per projekt respektive redovisning per enhet på motsvarande sätt som i artikel 43.2 andra stycket: ” Betalningar från ett företag för skyldigheter som åläggs företag på enhetsnivå får redovisas per enhet i stället för per projekt” (eng. Payments made by the undertaking in respect of obligations imposed at entity level may be disclosed at the entity level rather than at project level). Detta förtydligas i direktivets ingress, punkt 47 första och andra meningen: ” Företag med verksamhet i utvinningsindustrin eller inom avverkning av primärskog bör inte vara skyldiga att dela upp betalningar och tilldela dem på projektbasis när det gäller betalningar som avser skyldigheter som påförs företag på enhetsnivå snarare än projektnivå. Om ett företag till exempel har fler än ett projekt i ett värdland och det landets regering beskattar företagets inkomster i landet som helhet och inte grundar beskattningen på ett visst projekt eller viss verksamhet i landet, skulle företaget tillåtas att uppge den resulterande betalningen eller de resulterande betalningarna av inkomstskatt utan att specificera vilket projekt som kan kopplas till betalningen.” 
Principen om att innehåll går före form betonas i 4 mom. som anknyter till föregående 2 § 5 mom. som förbjuder kringgående av anmälningsskyldigheten genom konstlade arrangemang. Denna principbestämmelse är baserad på artikel 43.4 första meningen: ”Redovisningen av de betalningar som avses i denna artikel ska återspegla den berörda betalningens eller verksamhetens innebörd snarare än dess form.” Direktivingressens punkt 49 andra meningen lyder: ”Därför bör företaget inte kunna undgå uppgiftskravet genom att till exempel ge en ny beteckning åt en verksamhet som annars skulle ha omfattats av detta direktiv.” 
4 §.Årsrapport för koncerner. Enligt paragrafens 1 mom. ska ett företag upprätta en årsrapport för hela sin koncern i sådana fall då det i egenskap av moderföretag är skyldigt att upprätta koncernbokslut och företaget självt eller dess dotterföretag är verksamt i utvinningsindustrin eller inom avverkning av naturskog. Bestämmelsen är tvingande. I en koncernsituation är det sålunda inte möjligt att upprätta en årsrapport separat för varje företag som bedriver verksamhet. Momentet stämmer överens med artikel 44.1 första och andra stycket. 
De enskilda dotterföretagen i koncernen slipper ge en årsrapport då moderföretaget upprättar en gemensam rapport också för dem. Artikel 42.2:” Denna skyldighet ska inte gälla företag som lyder under en medlemsstats lagstiftning som är ett dotterföretag eller moderföretag där följande båda villkor är uppfyllda: 
a) Moderföretaget omfattas av lagstiftningen i en medlemsstat. 
b) Betalningarna till offentliga myndigheter från ett sådant företag omfattas av den konsoliderade rapport om betalningar till offentliga myndigheter som moderföretaget upprättat i enlighet med artikel 44.” 
Den skyldighet att ge en årsrapport som avses i direktivet gäller enligt artikel 44.1 endast storföretag och företag av allmänt intresse. Av ovan nämnda artikel 42.2 framgår att ett koncernförhållande inte har någon betydelse för denna begränsning. Om ett koncernföretag i utvinningsindustrin eller inom avverkning av naturskog inte är ett storföretag och inte heller ett företag av allmänt intresse, utgör ett koncernförhållande sålunda ingen grund för att upprätta årsrapport, eftersom företaget i fråga inte skulle ha denna skyldighet heller som en självständig enhet. Koncernförhållandet innebär sålunda inte någon skyldighet att rapportera om smärre verksamhet på samma sätt som när det är fråga om ett självständigt storföretag. 
Också 2 mom. eliminerar den inverkan som ett koncernförhållande har på uppkomsten av rapporteringsskyldighet. Bestämmelsen gäller den situationen att koncernföretag inom utvinningsindustrin eller avverkning av naturskog (dvs. moderföretag och dotterföretag), granskade för sig, underskrider de storleksgränser som leder till skyldighet att upprätta en årsrapport, medan de sammanräknade överskrider storleksgränserna. Momentet är förenligt med direktivets syfte trots att direktivet inte innehåller någon motsvarande artikel. 
Paragrafens 3 mom. 1 punkten innebär – i överensstämmelse med artiklarna 44.2 a och 44.2 b – att moderföretag i en sådan liten eller medelstor koncern som avses i 2 § 2 mom. avgränsas utanför skyldigheten att upprätta en årsrapport för koncernen, om till koncernen inte som dotterföretag hör ett sådant företag av allmänt intresse som definieras i 2 § 1 mom. 2 punkten. 
Momentets 2 punkt tillåter att det görs undantag från skyldigheten att upprätta årsrapport för en koncern då det finländska moderföretaget i fråga självt i egenskap av dotterföretag hör till en större koncern vars moderföretag lyder under lagstiftningen i en EES-stat. Detta undantag är baserat på artikel 44.2 c. 
Paragrafens 4 mom. är ett förtydligande i överensstämmelse med artikel 44.1 tredje stycket som lyder ” Den konsoliderade rapporten ska endast omfatta betalningar som härrör från utvinningsverksamhet och/eller verksamhet som avses avverkning av primärskog.” 
Paragrafens 5 mom. om undantag som innebär att i koncernens årsrapport inte behöver tas in uppgifter om dotterföretag, motsvarar bokföringslagens 6 kap. 3 § 1 mom. 2, 3 och 4 punkten om upprättande av koncernbokslut, där det föreskrivs om möjligheten att inte sammanställa dotterbolags bokslutsuppgifter. Om ett dotterföretag utelämnas ur koncernens årsrapport är det på motsvarande sätt inte möjligt att beakta heller dess bokslutsuppgifter i koncernbokslutet. Momentet motsvarar artikel 44.3 första och andra stycket.  
5 §.Hur betalningen fastställs. Paragrafens 1 och 2 mom. är baserade på artikel 43.1 som lyder: ”I rapporten behöver man inte ta hänsyn till en betalning, vare sig det gäller en enskild betalning eller ett flertal till varandra hörande betalningar, om beloppet för betalningen understiger 100 000 EUR under ett räkenskapsår.” 
Direktivingressens punkt 46 andra meningen lyder: ”Detta innebär att ett företag vid alla typer av arrangemang avseende periodiska inbetalningar eller delbetalningar (t.ex. hyresavgifter) måste ta hänsyn till det sammanlagda beloppet för de till varandra hörande periodiska inbetalningarna eller delbetalningarna av de till varandra hörande betalningarna när det avgör om tröskelvärdet har nåtts för dessa till varandra hörande betalningar och följaktligen om upplysningar krävs.” 
Paragrafens 3 mom. gäller sådana fall där något annat vederlag än pengar har använts för en betalning. Bestämmelsen motsvarar artikel 43.3 första och andra meningen: ”I de fall betalningar in natura görs till en offentlig myndighet ska de rapporteras i värde och, i förekommande fall, i volym. Kompletterande noter ska lämnas som förklarar hur deras värde har beräknats.” 
6 §.Språk och valuta. Denna paragraf stämmer överens med bokföringslagens 3 kap. 5 § om språk och valuta i bokslut. Direktivet innehåller inga särskilda bestämmelser om årsrapporter i dessa avseenden. 
7 §.Datering och underskrift. Artikel 45.2 lyder: ”Medlemsstaterna ska se till att medlemmarna av ett företags ansvariga organ, inom ramen för de befogenheter som nationell lagstiftning ger dem, har ansvar för att se till att rapporten om betalningar till offentliga myndigheter såvitt de vet och efter bästa förmåga utarbetas och offentliggörs i enlighet med kraven i detta direktiv.” I överensstämmelse med artikeln föreskrivs om undertecknande av årsrapporten på samma sätt som enligt bokföringslagens 3 kap. 7 § 1 mom. i fråga om bokslut. 
8 §.Registering och offentliggörande. Förfarandet enligt paragrafens 1, 2 och 4 mom. stämmer överens med bl.a. förfarandet vid registrering och offentliggörande av aktiebolags bokslut. Detta motsvarar artikel 45.1: ”Den rapport som avses i artikel 42 och den konsoliderade rapport som avses i artikel 44 om betalningar till offentliga myndigheter ska offentliggöras enligt vad som fastställs i lagstiftningen i varje medlemsstat i enlighet med kapitel 2 i direktiv 2009/101/EG.” 
Möjligheten att i enlighet med paragrafens 3 mom. förelägga vite för fullgörande av skyldigheten att registrera årsrapporten motsvarar bestämmelserna i 8 kap. 10 § 2 mom. i aktiebolagslagen och i 8 kap. 10 § 2 mom. i lagen om andelslag om överlämnande av bokslutet till registermyndigheten. 
9 §.Årsrapportsförseelse. Straffhotet enligt denna paragraf motsvarar bestämmelsen om bokföringsförseelse i bokföringslagens 8 kap. 4 §. Detta är en sådan effektiv sanktion som medlemsstaterna ska fastställa enligt artikel 51: ”Medlemsstaterna ska fastställa sanktioner vid överträdelser av de nationella bestämmelser som antas i enlighet med detta direktiv och vidta alla nödvändiga åtgärder för att se till att de genomförs. Sanktionerna ska vara effektiva, proportionella och avskräckande.” 
10 §.Ikraftträdande. I artikel 53.1 första stycket förutsätts det att medlemsstaterna ska sätta i kraft de bestämmelser som avses i direktivet senast den 20 juli 2015. Enligt andra stycket i den nämnda artikeln får bestämmelserna första gången tillämpas på bokslut som upprättas för räkenskapsperioder som börjar den 1 januari 2016 och därefter. Paragrafen stämmer överens med dessa bestämmelser och motsvarar bokföringslagens 9 kap. 2 aa § om ikraftträdande av bokföringsrättsliga ändringar. 
1.3
Lag om ändring av 8 kap. 5 och 9 § och 13 kap. 5 § i aktiebolagslagen
8 kap. Eget kapital, bokslut, verksamhetsberättelse och koncern
5 §. Paragrafen preciseras för att förtydliga att småföretag är skyldiga att i sin bokslutsinformation ange endast sådana omständigheter som uttryckligen föreskrivs i bokföringslagen och i den förordning om små- och mikroföretags bokslut som utfärdas med stöd av den. 
9 §. Paragrafens 2 mom. kompletteras i syfte att genomföra artikel 23.1. Artikeln lyder: ”Små koncerner ska undantas från skyldigheten att upprätta en koncernredovisning och en förvaltningsberättelse för koncern, utom när ett koncernföretag är ett företag av allmänt intresse.” (eng. shall be exempted). Bakgrunden till denna ändring behandlas mera utförligt i den allmänna motiveringens avsnitt 3.8. Ändringen skulle även gälla situationer som innebär upprättandet av bokslutet för distribution av interimdividend. 
13 kap. Utbetalning av medel
5 §. I denna paragraf bibehålls hänvisningen till bokföringslagens 5 kap. 8 § 3 mom. enligt vilket utvecklingsutgifternas aktiverade belopp begränsar beloppet av utdelningsbart fritt eget kapital. 
I enlighet med artikel 53.1 föreskrivs om lagändringens ikraftträdande på motsvarande sätt som i bokföringslagens 9 kap. 2 a §, vilket innebär att de nya bokslutsbestämmelserna i aktiebolag måste tillämpas under den räkenskapsperiod som börjar den 1 januari 2016 eller därefter. 
1.4
Lag om ändring av 8 kap. 9 § och 16 kap. 6 § i lagen om andelslag
8 kap. Eget kapital, bokslut, verksamhetsberättelse och koncern
9 §. Denna paragraf kompletteras med ett undantag som gäller upprättande av koncernbokslut, på motsvarande sätt som enligt nya 2 mom. i aktiebolagslagens 8 kap. 9 §. I fråga om andelslag är redovisningsdirektivet emellertid inte direkt förpliktande, eftersom dess tillämpningsområde inte omfattar andelslag. I lagen om andelslag kan sålunda i princip föreskrivas att koncernbokslut ska upprättas som en förutsättning för att småföretag ska få dela ut medel, trots att detta krav frångås i aktiebolagslagen. Detta skulle emellertid inte vara ändamålsenligt från konkurrenssynpunkt, eftersom verksamhetsförutsättningarna och förpliktelserna bör vara så enhetliga som möjligt, oberoende av i vilken rättslig form företaget bedriver verksamhet. 
De andelslagsrättsliga kraven på verksamhetsberättelsen och bokslutet begränsas å andra sidan inte i fråga om små- och mikroandelslag på samma sätt som enligt aktiebolagslagens 8 kap. 5 - 8 § i fråga om små- och mikroaktiebolag. Skillnaden mellan ett andelslags respektive ett aktiebolags bokslutsinformation beror på att syftet med andelslagets verksamhet i första hand är att stödja medlemmarnas ekonomi eller näringsutövning (1 kap. 5 § i lagen om andelslag) och inte att, som i fråga om aktiebolag, bereda vinst åt aktieägarna (1 kap. 5 § i aktiebolagslagen). 
16 kap. Utbetalning av medel
6 §. Bestämmelsen i paragrafens 1 mom. om utdelningsbart fritt eget kapital kompletteras med en hänvisning till begränsningen som gäller aktiverade utvecklingsutgifter i enlighet med bokföringslagens 5 kap. 8 § 3 mom., på motsvarande sätt som i aktiebolagslagens 13 kap. 5 §. 
Ikraftträdandebestämmelsen för lagändringen motsvarar innehållsmässigt bokföringslagens 9 kap. 2 a § och aktiebolagslagen i fråga om de ändrade bestämmelserna. Andelslagen ska sålunda iaktta de nya bokslutsbestämmelserna senast den räkenskapsperiod som börjar den 1 januari 2016 eller därefter. 
Med stöd av vad som anförts ovan föreläggs riksdagen följande lagförslag: 
Lagförslag
1. 
Lag 
om ändring av bokföringslagen 
I enlighet med riksdagens beslut 
upphävs i bokföringslagen (1336/1997) 1 kap. 5 § 3 mom., 2 kap. 5 § 6 mom. och 8 §, 3 kap. 8 § och 12 § 2 mom., 4 kap. 2 §, 5 kap. 20 §, 6 kap. 7 § 6 mom., 9 och 10 § samt 7 kapitel, sådana som de lyder i 1 kap. 5 § 3 mom. i lagen 1304/2004, 3 kap. 8 § delvis i lagen 1304/2004, 3 kap. 12 § 2 mom. i lagen 460/2007 och 6 kap. 7 § 6 mom. i lagen 629/2001 
ändras 1 kap. 1 och 2 §, 5 § 1 mom. samt 8 § 1 mom., 2 kap. rubriken i 2 § och 1 mom., 3 § 2 mom., 4 §, 5 § 1 och 2 mom., 6, 7 och 9 samt 10 § 1 och 2 mom., 3 kap. 1—4 § , 9 § 2 mom., 10 § 3 mom., 11 § 2 mom. och13 § 2 mom., 4 kap. 1 och5 §, 5 kap. 2, 2 a, 5, 5 a samt 8-18 § , 6 kap. 1—4 §, 5 § 2 mom., 7 § 5 mom., 8 och 11 §, 12 § 2 mom. samt 13 och 16 §, 7 a kap. 1 § och 2 § 1 mom. samt 8 kap. 1 §, 2 § 1, 2, 6 och 7 mom., 4 § 1 mom. och 6 §, sådana som de lyder i 1 kap 1 § delvis i lagarna 300/1998, 529/1998, 456/2003 och191/2014, 2 kap. 4 §, 3 kap. 3 §, 5 kap. 12 och14 § samt 6 kap. 1 § delvis i lagen 1304/2004, 2 kap. 9 § och 5 kap. 17 § i lagarna 300/1998 och1304/2004, 3 kap. 1, 2 och 4 §, 9 § 2 mom., 10 § 3 mom. och 11 § 2 mom., 5 kap. 2 a, 5, 5 a, 8 och 18 §, 6 kap. 2 § och 5 § 2 mom., 7 a kap. 1 § och 2 § 1 mom. samt 8 kap. 2 § 2 mom. och 6 § i lagen 1304/2004, 4 kap. 5 § samt 6 kap. 8 och 13 § delvis i lagarna 629/2001, 5 kap. 9 § i lagen 629/2001, 6 kap. 7 § 5 mom. i lagen 300/1998, 8 kap. 1 § delvis i lagarna 304/2010, 610/2010 och191/2014, 8 kap. 2 § 6 mom. i lagen 1312/2004 och8 kap. 4 § 1 mom. i lagen 399/2013, samt 
fogas till 1 kap. en ny 1 a §, till 4 § en ny 3 mom., till kapiteln en ny 4 a—4 d, 6 a och 9 §, till 2 kap. 2 § en ny 3 mom. samt en ny 5 b och 7 a §, till 3 kap en ny 1 a, 2 a och 7 a §, till 4 kap en ny 8 §, till 5 kap en ny 2 b, 5 b och 5 c § samt till 8 kap. 5 §, sådan den lyder i lag 1304/2004, en ny 2 och 3 mom., som följer: 
1 kap. 
Allmänna bestämmelser 
1 §  
Juridiska personers bokföringsskyldighet 
Bokföringsskyldiga är utöver vad som föreskrivs någon annanstans i lag 
1) öppna bolag, kommanditbolag, aktiebolag, andelslag, föreningar, stiftelser och andra privaträttsliga juridiska personer, samt 
2) registrerade religionssamfund och deras registrerade lokalsamfund enligt 2 kap. i religionsfrihetslagen (453/2003). 
Om det för att en juridisk person enligt 1 mom. 1 punkten ska ha rättsförmåga krävs att denna är införd i handelsregistret eller något annat register, är den juridiska personen bokföringsskyldig också för sin verksamhet före registreringen. Bokföringsskyldig är också konkursboet för en juridisk person enligt 1 mom. 1 punkten, om konkursboet fortsätter den juridiska personens verksamhet. 
Utländska juridiska personer är inte bokföringsskyldiga enligt denna lag. I 17 a § i handelsregisterlagen (129/1979) föreskrivs om registrering av bokslutshandlingar för utländska näringsidkare som har etablerat filial i Finland. 
1 a § 
Fysiska personers bokföringsskyldighet 
Fysiska personer, med undantag för lantbrukare och fiskare, är bokföringsskyldiga för rörelse som de driver och yrke som de utövar. Bokföringsskyldigheten gäller också dödsbon och konkursbon som fortsätter yrkesutövares och rörelseidkares verksamhet. 
Affärshändelser ska bokföras så att beloppet av leverantörsskulder och försäljningsfordringar samt behövliga uppgifter för fullgörande av skattskyldigheten kontinuerligt framgår av bokföringen. Trots vad som föreskrivs i 2 § i detta kapitel är yrkesutövare och rörelseidkare inte skyldiga att ha dubbel bokföring, ifall högst en av följande förutsättningar har uppfyllts under både den avslutade och den föregående räkenskapsperioden: 
1) balansomslutningen överskrider 100 000 euro, 
2) omsättningen eller motsvarande intäkter överskrider 200 000 euro, eller 
3) det genomsnittliga antalet anställda överskrider tre personer. 
Yrkesutövare och rörelseidkare är skyldiga att upprätta bokslut om minst två av de gränser som anges i 4 b § har överskridits både under den avslutade och den omedelbart föregående räkenskapsperioden. Bokslutet ska upprättas med iakttagande av bestämmelserna om små företags bokslut i denna lag och av bestämmelser som utfärdats med stöd av den.  
Trots bestämmelserna i denna paragraf är en fysisk person skyldig att iaktta vad som föreskrivs om bokföringsskyldigheten någon annanstans i lag eller bestäms eller föreskrivs med stöd av en sådan lag, om det yrke som personen utövar eller den rörelse som personen driver förutsätter tillstånd eller om verksamheten annars är ställd under myndighetstillsyn. 
2 § 
Dubbel bokföring 
Med undantag för fysiska personer och som avses i 1 a § 2 mom. ska bokföringsskyldiga ha dubbel bokföring. 
4 § 
Räkenskapsperiod 
Med avvikelse från 1 mom. är räkenskapsperioden för yrkesutövare och rörelseidkare alltid kalenderåret. 
4 a § 
Små företag 
I denna lag avses med små företag bokföringsskyldiga för vilka högst ett av följande tre gränsvärden överskrids på bokslutsdagen för både den avslutade och den omedelbart föregående räkenskapsperioden: 
1) balansomslutning 6 000 000 euro, 
2) omsättning 12 000 000 euro, 
3) genomsnittligt antal anställda under räkenskapsperioden 50 personer 
4 b § 
Mikroföretag 
I denna lag avses med mikroföretag bokföringsskyldiga för vilka högst ett av följande tre gränsvärden överskrids på bokslutsdagen för både den avslutade och den omedelbart föregående räkenskapsperioden: 
1) balansomslutning 350 000 euro, 
2) omsättning 700 000 euro, 
3) genomsnittligt antal anställda under räkenskapsperioden 10 personer 
4 c § 
Stora företag 
I denna lag avses med stora företag bokföringsskyldiga för vilka minst två av följande tre gränsvärden överskrids på bokslutsdagen för både den avslutade och den omedelbart föregående räkenskapsperioden: 
1) balansomslutning 20 000 000 euro, 
2) omsättning 40 000 000 euro, 
3) genomsnittligt antal anställda under räkenskapsperioden 250 personer. 
4 d § 
IAS-förordningen 
I denna lag avses med IAS-förordningen Europaparlamentets och rådets förordning (EG) nr 1606/2002/EG om tillämpning av internationella redovisningsstandarder. 
5 § 
Bestämmande inflytande 
En bokföringsskyldig anses ha bestämmande inflytande i en annan bokföringsskyldig eller i ett motsvarande utländskt företag (målföretag), om den bokföringsskyldiga 
1) innehar mer än hälften av rösterna för samtliga aktier eller andelar i målföretaget och denna röstmajoritet grundar sig på ägande, medlemskap, bolagsordningen, bolagsavtalet eller därmed jämförbara stadgar eller något annat avtal,  
2) har rätt att utse eller avsätta flertalet av ledamöterna i målföretagets styrelse eller motsvarande organ eller i ett organ som har denna rätt, och rätten grundar sig på samma omständigheter som den röstmajoritet som avses i 1 punkten, eller  
3) i övrigt har faktiskt bestämmande inflytande i målföretaget. 
6 a § 
Små och stora koncerner  
I denna lag avses med 
1) små koncerner sådana koncerner där högst ett av de gränsvärden som anges i 4 a § överskrids, 
2) stora koncerner sådana koncerner där minst två av de gränsvärden som anges i 4 c § överskrids. 
Överskridande av gränsvärdena enligt 1 mom. bestäms på moderföretagets bokslutsdag på basis av koncernföretagens sammanräknade tal. 
8 § 
Intresseföretag 
Ett intresseföretag är ett ägarintresseföretag i vilket den bokföringsskyldiga innehar minst en femtedel och högst hälften av det röstetal som ägarintresseföretagets aktier eller andelar medför. Om den bokföringsskyldiga innehar en femtedel eller en mindre andel av röstetalet samt utövar ett betydande inflytande över den driftsmässiga och finansiella styrningen, ska ett ägarintresseföretag betraktas som intresseföretag om inte den bokföringsskyldiga visar annat. 
9 § 
Företag av allmänt intresse 
Företag av allmänt intresse enligt artikel 2.1 i Europaparlamentets och rådets direktiv 2013/34/EU om årsbokslut, koncernredovisning och rapporter i vissa typer av företag, om ändring av Europaparlamentets och rådets direktiv 2006/43/EG och om upphävande av rådets direktiv 78/660/EEG och 83/349/EEG (nedan direktivet) är i Finland 
1) finländska sammanslutningar som har emitterat aktier, skuldebrev eller andra värdepapper som är föremål för handel på en reglerad marknad enligt 2 kap. 5 § i värdepappersmarknadslagen (746/2012), 
2) kreditinstitut enligt 1 kap. 7 § i kreditinstitutslagen (610/2014), och 
3) försäkringsbolag enligt 1 kap. 1 § i försäkringsbolagslagen (521/2008) 
2 kap. 
Bokföring av affärshändelser samt bokföringsmaterial 
2 § 
Bokföringskonton, kontoplan och bokföringar 
Affärshändelserna ska bokföras enligt sin art på olika konton (notering). Varje konto ska bibehållas oförändrat till sitt innehåll. Kontots innehåll kan likväl ändras på grund av verksamhetens utveckling, ändring av den kontoplan som avses i 2 mom. eller av annan särskild anledning. 
Bokföringen indelas i en huvudbokföring ur vars noteringar bokslutet härleds samt i eventuella delbokföringar från vilka uppgifterna överförs till huvudbokföringen som sammanställda noteringar. 
3 § 
Bokföringsgrunder 
Utgifter och inkomster får även bokföras på grundval av fakturering (faktureringsprincipen) eller på grundval av betalning (kontantprincipen). Om utgifter och inkomster bokförs enligt kontantprincipen, ska leverantörsskulderna och försäljningsfordringarna kunna klarläggas fortlöpande. 
4 § 
Bokföringsordning och bokföringstid 
Bokföringen ska ordnas så att noteringarna kan granskas kronologiskt och systematiskt. 
En förutsättning för bokföringsordningen är att kontantbetalningar noteras i bokföringen för varje dag. Övriga noteringar och de sammanställda noteringar i delbokföringarna som överförs till huvudbokföringen får göras månadsvis eller för någon annan motsvarande period, om det inte i någon annan lag eller i bestämmelser som utfärdats med stöd av den förutsätts kronologiskt mer exakta noteringar. 
Kontantbetalningar bokförs utan dröjsmål. Övriga noteringar ska göras i så god tid att 
1) i denna eller i någon annan lag förutsatta anmälningar eller deklarationer till myndigheterna för beskattning eller andra syften kan upprättas på det sätt som föreskrivs om uppdaterad bokföring i 6 § andra meningen, och att 
2) den som ansvarar för ett företags eller en stiftelses bokföring kan uppfylla sin tillsynsskyldighet. 
5 § 
Verifikation 
Bokföringen ska grunda sig på en daterad och systematiskt numrerad eller på motsvarande sätt specificerad verifikation över affärshändelser. Sambandet mellan en affärshändelse, verifikationen och bokföringen måste kunna konstateras utan svårighet. 
Av en utgiftsverifikation ska framgå den mottagna produktionsfaktorn och av en inkomstverifikation den överlåtna prestationen. Tidpunkten för mottagandet av en produktionsfaktor och överlåtelsen av en prestation ska kunna visas med hjälp av en verifikation. 
5 b § 
Verifikation till noter 
Bokslutsnoter ska, om grunden inte annars är uppenbar, baseras på verifikation av innehållet (verifikation till noter). Sambandet mellan noten och verifikationen måste kunna konstateras utan svårighet. 
6 § 
Verifieringskedja 
Bokföringen ska ordnas så att sambandet mellan affärshändelser, verifikationer och noteringar dels via eventuella delbokföringar och huvudbokföringen och dels vidare till bokslutet utan svårighet kan konstateras i båda riktningarna. Detsamma gäller regelbundna anmälningar och deklarationer till myndigheterna för beskattning och andra ändamål. 
7 § 
Bokföringsmaterial 
Verifikationer, bokföringar och annat bokföringsmaterial ska behandlas och förvaras så att innehållet utan svårighet kan granskas och vid behov skrivas ut i läsbar form. 
Efter att bokslutet upprättats får innehållet i verifikationer, bokföringar och annat bokföringsmaterial inte ändras eller strykas. Ändringar eller strykningar i innehållet får inte heller göras efter det att en sådan anmälan eller deklaration som avses i 6 § lämnats eller efter att den bokföringsskyldiga har offentliggjort eller gett en utomstående tillgång till ett mellanbokslut som den bokföringsskyldiga upprättat på basis av materialet eller något annat motsvarande dokument. 
Formatet för verifikationer, bokföringar och annat bokföringsmaterial får ändras om detta är nödvändigt för behandlingen, överföringen eller förvaringen. Innehållet och verifieringskedjan måste då säkerställas. 
7 a § 
Förteckning över bokföringar och material 
Den bokföringsskyldiga ska ha en förteckning över de bokföringar som ligger till grund för bokslutet samt över de olika slagen av verifikationer och annat bokföringsmaterial. Av förteckningen ska det framgå vilka de inbördes sambanden mellan bokföringarna, verifikationerna och bokföringsmaterialet är och hur materialet förvaras. 
9 § 
Förvaring av bokföringsmaterial 
Bokslut, bokföringar, verifikationer och annat bokföringsmaterial ska förvaras omsorgsfullt på ett sätt som uppfyller kraven i 7 § så att de utan ogrundat dröjsmål ska kunna granskas av myndigheter och revisorer med utgångspunkt i Finland. 
10 § 
Arkiveringstid för bokföringsmaterial 
Bokslut, verksamhetsberättelser, bokföringar, kontoplaner samt förteckningar över bokföringar och material ska bevaras i minst 10 år efter räkenskapsperiodens utgång så att kraven i 6, 7 och 9 § uppfylls. 
Om längre bevaringstid inte föreskrivs någon annanstans i lag ska räkenskapsperiodens verifikationer, korrespondens om affärshändelser och annat bokföringsmaterial än sådant som nämns i 1 mom. bevaras minst sex år från utgången av det år då räkenskapsperioden har upphört så att kraven i 6, 7 och 9 § uppfylls. 
3 kap. 
Bokslut och verksamhetsberättelse 
1 § 
Bokslutets innehåll 
För varje räkenskapsperiod ska upprättas ett bokslut som består av 
1) en balansräkning som ger en bild av den ekonomiska ställningen på bokslutsdagen, 
2) en resultaträkning som beskriver hur resultatet har uppkommit, 
3) en finansieringsanalys som beskriver anskaffningen och användningen av medel, om den bokföringsskyldiga är ett storföretag eller ett företag av allmänt intresse, samt 
4) uppgifter som ska lämnas i bilagor till balansräkningen, resultaträkningen och finansieringsanalysen (noter). 
För varje post i balansräkningen, resultaträkningen och finansieringsanalysen ska motsvarande uppgifter för den närmast föregående räkenskapsperioden anges (jämförelsetal). Om specificeringen av balansräkningen, resultaträkningen eller finansieringsanalysen har ändrats, ska jämförelsetalet om möjligt korrigeras. På samma sätt ska förfaras, om jämförelsetalet av någon annat skäl inte är användbart. 
Till bokslutet ska fogas en verksamhetsberättelse enligt 1 a §, om den bokföringsskyldiga är 
1) ett publikt aktiebolag, 
2) ett sådant andelslag eller privat aktiebolag som inte är ett mikro- eller småföretag, eller 
3) ett företag av allmänt intresse. 
Handlingar som ingår i bokslutet och som fogats till bokslutet ska vara överskådliga och bilda en helhet. 
1 a § 
Verksamhetsberättelse 
I verksamhetsberättelsen ska beskrivas 
1) utvecklingen och resultatet av den bokföringsskyldigas verksamhet, 
2) den bokföringsskyldigas ekonomiska situation, och 
3) de mest relevanta riskerna och osäkerhetsfaktorerna. 
När det är nödvändigt för att förstå beskrivningen enligt 1 mom. ska även anges 
1) ekonomiska nyckeltal, och 
2) andra än ekonomiska nyckeltal för personal och miljökonsekvenser. 
Den beskrivning som avses i 1 mom. ska med avseende på den bokföringsskyldigas storlek och struktur vara neutral och heltäckande. Den ska vid behov hänvisa till omständigheter som framgår av bokslutet och ge kompletterande information om dem. 
Utöver vad som föreskrivs ovan i denna paragraf ska verksamhetsberättelsen innehålla 
1) uppgifter om väsentliga händelser som inträffat efter räkenskapsperioden, 
2) en uppskattning av den bokföringsskyldigas sannolika framtida utveckling, 
3) en utredning om omfattningen av forsknings- och utvecklingsverksamheten, 
4) uppgifter om filialer,  
5) uppgifter om finansiella instrument som tagits upp till verkligt värde enligt 5 kap. 2 a § 5 mom., 
6) sådana uppgifter om förvärv och avyttring av egna aktier och andelar som avses i 8 kap. 8 § i aktiebolagslagen (624/2006) och 8 kap. 8 § i lagen om andelslag (421/2013), samt 
7) uppgifter som förutsätts någon annanstans i lagstiftningen. 
2 § 
En rättvisande bild 
Bokslutet och verksamhetsberättelsen ska ge en rättvisande bild av den bokföringsskyldigas verksamhetsresultat och ekonomiska ställning i enlighet med väsentlighetsprincipen samt med beaktande av arten och omfattningen av den bokföringsskyldigas verksamhet. 
Om inte iakttagande av de förpliktelser som föreskrivs någon annanstans i denna lag leder till en rättvisande bild enligt 1 mom. ska den bokföringsskyldiga med beaktande av 2 a § i noterna uppge de omständigheter som är behövliga för detta. 
Om iakttagande av någon annan bestämmelse i denna lag än 3 § på ett betydande sätt skulle äventyra möjligheterna att ge en rättvisande bild, ska den inte tillämpas. Bestämmelsen i fråga ska specificeras i noterna och dessutom ska en utredning ges om grunderna för att den inte tillämpas och hur detta påverkar verksamhetsresultatet och den ekonomiska ställningen. 
Närmare bestämmelser om tillämpningen av 3 mom. på mikroföretag utfärdas genom förordning av statsrådet. 
2 a § 
Väsentlighet som en allmän bokslutsprincip 
En omständighet som framgår av bokslutet eller verksamhetsberättelsen är väsentlig då utelämnanden av eller felaktigheter i den rimligen kan förväntas påverka de beslut som användarna fattar på grundval av bokslutet och verksamhetsberättelsen. Fast en omständighet i sig är oväsentlig ska väsentlighetsbedömningen avse helheten, om flera liknande omständigheter föreligger. 
När det är fråga om en sådan omständighet gällande bokslutet eller verksamhetsberättelsen som inte är väsentlig för en rättvisande bild, får avvikelse ske från denna lags bestämmelser som gäller 
1) periodisering av inkomster eller utgifter, 
2) värdering av tillgångs- eller skuldposter, 
3) framställningssätt, 
4) uppgifter som ska framgå av bokslutet eller verksamhetsberättelsen, eller 
5) upprättande av koncernbokslut. 
Bestämmelsen i 2 mom. tillämpas inte på skyldigheten enligt 2 kap. 1 § att anteckna varje affärshändelse i bokföringen. 
3 § 
Övriga allmänna bokslutsprinciper 
När bokslutet och verksamhetsberättelsen upprättas i enlighet med 2 och 2 a § samt i fråga om den ingående balansen ska följande principer följas: 
1) den bokföringsskyldiga ska förutsättas fortsätta sin verksamhet, 
2) konsekvens ska iakttas när principerna och metoderna för upprättande av bokslutet tillämpas från en räkenskapsperiod till en annan, 
3) uppmärksamhet ska fästas vid affärstransaktionernas faktiska innehåll och inte enbart vid deras juridiska form (innehållsbetoning), 
4) försiktighet ska iakttas oberoende av räkenskapsperiodens resultat, 
5) den ingående balansen ska basera sig på den föregående räkenskapsperiodens utgående balans, 
6) de intäkter och kostnader som hänför sig till räkenskapsperioden ska tas upp utan hänsyn till datum för betalningen (prestationsprincipen), 
7) varje tillgång och annan post som tas upp bland posterna i balansräkningen ska värderas särskilt för sig, samt 
8) i balansräkningen ska poster bland aktiva respektive passiva och i resultaträkningen intäkter och kostnader tas upp till fullt belopp utan att de dras av från varandra, om inte en sammanställning behövs för att ge en rättvisande bild (nettningsförbud). 
Den försiktighet som avses i 1 mom. 4 punkten förutsätter särskilt att i bokslutet och verksamhetsberättelsen tas upp 
1) endast sådana vinster som har realiserats under räkenskapsperioden och 
2) alla avskrivningar och nedskrivningar av aktiva samt uppskrivningar av skulder liksom alla förutsebara förpliktelser och möjliga förluster som har uppkommit under denna eller tidigare räkenskapsperioder, även om dessa blir kända först efter räkenskapsperiodens utgång. 
När det är fråga om en sådan väsentlig omständighet som avses i 2 a § får avvikelse från principen i 1 och 2 mom. göras endast av särskilda skäl En sådan avvikelse ska basera sig på lag eller på en bestämmelse eller föreskrift som utfärdats med stöd av lag. I noterna ska tas in en redogörelse för grunderna till avvikelsen samt en beräkning av hur avvikelsen påverkar räkenskapsperiodens resultat och den ekonomiska ställningen. 
4 § 
Rättelse och komplettering av bokföring enligt fakturerings- och kontantprincipen samt bokslut enligt kontantprincipen 
Mindre noteringar som gjorts enligt fakturerings- eller kontantprincipen behöver inte rättas och kompletteras enligt prestationsprincipen innan bokslutet och verksamhetsberättelsen upprättas, om deras totala inverkan inte är väsentlig. 
Om ett mikroföretag är en förening eller stiftelse får det upprätta sitt bokslut också enligt kontantprincipen, förutsatt att det inte är moderföretag i en koncern för vilken ska upprättas koncernbokslut. Ett bokslut som upprättas enligt kontantprincipen ska innehålla åtminstone följande noter: 
1) en bedömning av förfarandets inverkan på räkenskapsperiodens resultat och på den ekonomiska ställningen, 
2) leverantörsskulder och försäljningsfordringar som inte tagits upp i balansräkningen, 
3) förändringar i omsättningstillgångar enligt 4 kap. 4 § 2 mom., 
4) förändringar i bestående aktiva enligt 4 kap. 3 §, 
5) räntor på främmande kapital enligt prestationsprincipen, samt 
6) semesterlöneskuld enligt prestationsprincipen. 
7 a § 
Ansvar för bokslutet och verksamhetsberättelsen samt för förteckningen över bokföringar och material 
Bestämmelser om det ansvar som styrelseledamöter och medlemmar av andra motsvarande organ samt den verkställande direktören har för bokslutet och verksamhetsberättelsen finns i de lagar som gäller respektive juridiska personer. Samma ansvar gäller också i fråga om den förteckning över bokföringar och material som avses i 2 kap. 7 a §. 
9 § 
Registrering av bokslut och verksamhetsberättelse 
Bestämmelserna i 1 mom. tillämpas även på andra bokföringsskyldiga som är större än ett små företag. 
10 § 
Offentliggörande av bokslut och verksamhetsberättelse 
Den bokföringsskyldiga får även publicera sitt bokslut eller sin verksamhetsberättelse i sammandrag, förutsatt att 
1) det framgår av sammandraget att det inte innehåller alla de uppgifter som ska lämnas i ett bokslut eller i en verksamhetsberättelse enligt 1 §, 
2) till sammandraget inte fogas en revisionsberättelse, 
3) av sammandraget framgår om revisorns uttalande enligt 15 § 3 mom. första meningen i revisionslagen har lämnats utan reservation, med reservation eller med avvikande mening eller att revisorn inte har kunnat uttala sig, 
4) det framgår av sammandraget om revisorn trots att uttalandet lämnats utan reservation föreslår sådana tilläggsuppgifter som avses i 15 § 3 mom. tredje meningen i revisionslagen eller gör ett påpekande enligt 15 § 4 mom. i samma lag, och att 
5) det framgår av sammandraget i vilket register bokslutet och verksamhetsberättelsen finns tillgängliga i fullständig form eller huruvida bokslutet och verksamhetsberättelsen inte ännu har sänts för registrering. 
11 § 
Skyldighet att ge kopior 
En bokföringsskyldig som avses i 9 § 1 och 2 mom. ska på begäran ge en kopia av sitt bokslut och sin verksamhetsberättelse, om begäran har gjorts innan bokslutet och verksamhetsberättelsen anmälts för registrering. 
13 § 
Specifikationer till balansräkningen och till noterna 
På specifikationer till balansräkningen och till noterna tillämpas 2 kap. 7 och 9 § samt 10 § 1 och 3 mom. 
4 kap. 
Definitioner i anslutning till bokslutsposter 
1 § 
Omsättning 
I omsättningen ingår intäkterna från försäljning av produkter och tjänster med avdrag för beviljade rabatter samt mervärdesskatt och andra skatter som baserar sig direkt på beloppet av försäljningen. 
5 § 
Anskaffningsutgift 
Med anskaffningsutgift avses de direkta utgifterna för anskaffning och tillverkning av en tillgång. 
En rimlig andel av de indirekta utgifterna för anskaffning och tillverkning får räknas in i anskaffningsutgiften för en tillgång, till den del som dessa utgifter hänför sig till produktionsperioden. Dessa indirekta utgifter måste kunna utredas med stöd av kostnadsberäkning eller kostnadskalkyler. 
Ränteutgifterna för lån som under produktionsperioden kan hänföras till produktionen av en tillgång får räknas in i anskaffningsutgiften. 
Om inte den bokföringsskyldiga visar något annat, ska anskaffningsutgiften för tillgångar av samma slag vilka ingår i omsättningstillgångarna beräknas enligt först-in-först-ut-principen eller i motsatt anskaffnings- och överlåtelseordning. Som anskaffningsutgift för sådana tillgångar får även anges realiserade genomsnittliga anskaffningsutgifter vägda enligt motsvarande anskaffningsvolym eller ett värde som beräknats på något annat sådant allmänt använt sätt som är förenligt med god bokföringssed. 
Bestämmelserna i 4 mom. tillämpas även på de värdepapper av samma slag som tas upp i balansräkningens aktiva men inte utgör omsättningstillgångar. 
8 § 
Egna och moderföretagets aktier och andelar 
Ett aktiebolags egna aktier enligt aktiebolagslagen får inte tas upp i balansräkningen. Ett utländskt dotterbolags egna aktier eller aktier i ett finländskt moderföretag får inte tas upp i koncernbalansräkningen. I balansräkningen får inte heller tas upp ett andelslags i lagen om andelslag avsedda egna andelar och aktier i andelslaget och i dess moderföretag. 
5 kap. 
Värderings- och periodiseringsbestämmelser 
2 § 
Fordringar, finansieringstillgångar och skulder 
I balansräkningen upptas 
1) fordringar till nominellt belopp, likväl högst till det sannolika värdet, 
2) värdepapper, som utgör finansieringstillgångar, och andra sådana finansieringsmedel till anskaffningsutgiften eller, om deras sannolika verkliga marknadspris på bokslutsdagen är lägre, till detta värde, och 
3) skulder till nominellt belopp eller, om skulden är bunden vid index eller någon annan jämförelsegrund, till det högre belopp som den stiger till på grund av den förändrade jämförelsegrunden. 
Den bokföringsskyldiga får så som föreskrivs i 1 mom. 2 punkten värdera också värdepapper och andra sådana finansieringsmedel som hör till bestående aktiva. 
Då fordringar som avses i 1 mom. 1 punkten eller rörliga aktiva som avses i 2 punkten eller sådana bestående aktiva som avses i 2 mom. värderas till ett lägre värde än anskaffningsutgiften, ska skillnaden tas upp i resultaträkningen som en finansieringskostnad. 
2 a § 
Upptagande av finansiella instrument till verkligt värde samt fonden för verkligt värde 
Med avvikelse från 2 § 1 mom. 2 punkten kan derivatavtal och övriga finansiella instrument tas upp till verkligt värde. Då instrumenten tas upp till verkligt värde i bokslutet ska de internationella redovisningsstandarder iakttas som godkänts genom IAS-förordningen. Bestämmelser om undantag från tillämpning av standarderna eller från sådana tilläggskrav på de uppgifter som läggs fram i bokslutet eller i verksamhetsberättelsen och som baserar sig på tillämpningen av standarderna kan utfärdas genom förordning av statsrådet. 
Förändringar i finansiella instruments verkliga värde ska tas upp i fonden för verkligt värde, då den internationella redovisningsstandard som avses i 1 mom. förutsätter att de ska tas upp i det egna kapitalet. Bestämmelser om begränsningar i utbetalning och annan användning av fonden för verkligt värde finns i aktiebolagslagen och lagen om andelslag. 
Fonden för verkligt värde ska justeras när ett finansiellt instrument avyttras eller förfaller eller annars är föremål för en sådan nedskrivning som på det sätt som förutsätts i den standard som avses i 1 mom. ska tas upp på ett resultatpåverkande sätt. 
Om de internationella redovisningsstandarder som avses i 1 mom. inte förutsätter att motsvarande omständigheter tas upp i noterna ska av verksamhetsberättelsen, i fråga om finansiella instrument som tagits upp till verkligt värde, framgå 
1) mål och förfaranden för hantering av finansiella risker, inklusive dess säkringsförfarande för varje viktig typ av planerad transaktion där säkringsredovisning används, 
2) pris-, kredit-, likviditets- och kassaflödesrisker, om dessa uppgifter är väsentliga för bedömningen av den bokföringsskyldigas ekonomiska ställning eller resultat. 
Av moderföretagets verksamhetsberättelse ska också om koncernen framgå de uppgifter som avses i 5 mom. 
Om en bokföringsskyldig är ett mikroföretag och iakttar vad som i denna lag och med stöd av den föreskrivs om mikroföretag, får den bokföringsskyldiga inte tillämpa värderingsförfarandet för finansiella instrument enligt denna paragraf. 
2 b § 
Upptagande av förvaltningsfastigheter till verkligt värde 
Den bokföringsskyldiga får ta upp sina förvaltningsfastigheter till verkligt värde. När sådana fastigheter tas upp och presenteras i bokslutet ska de redovisningsstandarder iakttas som godkänts genom IAS-förordningen samt bestämmelserna i 2 a § 2 och 3 mom. om fonden för verkligt värde. Bestämmelser om undantag från tillämpning av standarderna eller från sådana tilläggskrav på de uppgifter som läggs fram i bokslutet eller i verksamhetsberättelsen och som baserar sig på tillämpningen av standarderna kan utfärdas genom förordning av statsrådet. 
Om en bokföringsskyldig är ett mikroföretag och iakttar vad som i denna lag och med stöd av den föreskrivs om mikroföretag, får den bokföringsskyldiga inte tillämpa värderingsförfarandet för finansiella instrument enligt denna paragraf. 
5 § 
Periodisering av anskaffningsutgiften för materiella tillgångar som genererar inkomst under flera räkenskapsperioder 
Anskaffningsutgiften för tillgångar som hör till de materiella tillgångarna och väntas generera inkomst under flera räkenskapsperioder avskrivs enligt plan så att den kostnadsförs på respektive räkenskapsperiod under sin verkningstid (avskrivning). Återstoden av anskaffningsutgiften ska efter räkenskapsperiodens avskrivning tas upp i balansräkningen bland bestående aktiva (aktivering). 
I en aktiverad anskaffningsutgift inräknade utgifter för anskaffning och tillverkning ska kunna klarläggas med hjälp av kostnadsberäkning eller kostnadskalkyler. 
Tillgångar av samma slag bland bestående aktiva, vars anskaffningsutgift är av underordnad betydelse, får i balansräkningen tas upp till samma belopp från en räkenskapsperiod till en annan, om de av den bokföringsskyldiga omsätts så att förändringarna i deras kvantitet och sammanlagda värde är obetydliga. 
5 a § 
Periodisering av anskaffningsutgiften för immateriella rättigheter 
Anskaffningsutgiften för koncessioner, patent, licenser och varumärken samt andra motsvarande rättigheter ska aktiveras om en rättighet väntas generera inkomst under flera räkenskapsperioder. 
Om den bokföringsskyldiga själv har skapat en sådan immateriell rättighet som avses i 1 mom. får anskaffningsutgiften för denna aktiveras med iakttagande av försiktighet, under förutsättning att rättigheten väntas generera inkomst under flera räkenskapsperioder. 
En aktiverad anskaffningsutgift som avses i 1 och 2 mom. ska under sin verkningstid skrivas av enligt plan. 
5 b § 
Upptagande av tillgångar som förvärvats genom finansiella leasingavtal 
När den bokföringsskyldiga har ingått ett leasingavtal som innebär att de risker och förmåner som är förknippade med tillgångarna till väsentliga delar övergår på leasingtagaren när avtalsperioden börjar, får leasinggivaren ta upp tillgångarna i sitt bokslut som om de hade sålts, medan leasingtagaren får ta upp dem som om de hade köpts. Om den bokföringsskyldiga väljer detta bokföringssätt, ska det tillämpas på alla sådana avtal som avses i detta moment. När det gäller upptagande och presenterande i bokslutet ska de redovisningsstandarder iakttas som antagits genom IAS-förordningen. Bestämmelser om undantag från tillämpning av standarderna eller från sådana tilläggskrav på de uppgifter som läggs fram i bokslutet eller i verksamhetsberättelsen och som baserar sig på tillämpningen av standarderna kan utfärdas genom förordning av statsrådet. 
5 c § 
Upptagande av kapitallån i balansräkningen 
Som en separat post i det egna kapitalet får sådana kapitallån tas upp som ett aktiebolag eller ett andelslag med beaktande av lånevillkoren anser ha karaktären av eget kapital, på det sätt som i de redovisningsstandarder som godkänts genom IAS-förordningen förutsätts i fråga om värdepapper som hänförs till eget kapital. I annat fall ska ett sådant lån tas upp i det främmande kapitalet. 
8 § 
Periodisering av forsknings- och utvecklingsutgifter 
Forskningsutgifter tas upp som kostnad under räkenskapsperioden. 
Utvecklingsutgifter får aktiveras om de väntas generera inkomst under flera räkenskapsperioder. De aktiverade utvecklingsutgifterna ska avskrivas enligt plan under sin verkningstid. Om den bokföringsskyldiga inte på ett tillförlitligt sätt kan bedöma verkningstiden, ska utvecklingsutgifterna avskrivas under högst tio år. 
Om utvecklingsutgifterna har aktiverats får den ännu icke kostnadsförda delen av aktiveringen inte delas ut av räkenskapsperiodens resultat, vinstmedel eller andra utdelningsbara fonder hos en bokföringsskyldig som är  
1) ett aktiebolag eller någon annan sammanslutning som är skyldig att iaktta aktiebolagslagen, 
2) ett sådant öppet bolag eller kommanditbolag vars samtliga ansvariga bolagsmän är aktiebolag, eller 
3) ett andelslag eller någon annan sammanslutning som är skyldig att iaktta lagen om andelslag. 
9 § 
Periodisering av anskaffningsutgiften för goodwill 
Anskaffningsutgiften för goodwill får aktiveras. Det aktiverade värdet för goodwill ska avskrivas enligt plan under sin verkningstid. Om den bokföringsskyldiga inte på ett tillförlitligt sätt kan bedöma verkningstiden ska goodwill avskrivas inom högst tio år. 
10 § 
Kapitalrabatt och emissionsutgifter för lån 
Kapitalrabatt som hänför sig till upptagande av lån och därmed jämförbara utgifter samt utgifter för emission av lån får aktiveras med iakttagande av försiktighet. De aktiverade posterna ska kostnadsföras enligt en plan som baserar sig på lånetiden, dock minst i samma förhållande som lånet återbetalas. 
11 § 
Periodisering av andra utgifter med lång verkningstid 
Har andra utgifter med lång verkningstid än de som avses i 7—10 § aktiverats, ska de avskrivas enligt plan under sin verkningstid. Om den bokföringsskyldiga inte på ett tillförlitligt sätt kan bedöma verkningstiden ska utgiften avskrivas inom högst tio år. 
12 § 
Andra än planenliga avskrivningar 
Den bokföringsskyldiga får ta upp avskrivningar som överskrider planen om det finns skattemässiga skäl till detta. 
Utan hinder av 5 § 1 mom., 5 a § 3 mom., 8 § 2 mom. och 9—11 § får fysiska personer som avses i 1 kap. 1 a § 1 och 2 mom. samt bokföringsskyldiga vars verksamhet baserar sig på besittning av fastigheter, avskriva anskaffningsutgiften för tillgångar som hör till bestående aktiva under deras verkningstid utan någon på förhand uppgjord plan. Vid sådan avskrivning måste man iaktta kontinuitet och konsekvens. Vad som föreskrivs ovan i detta moment berättigar inte till avvikelse från aktiveringsskyldigheten då en utgift väntas generera inkomst under flera räkenskapsperioder och inte heller från den maximala avskrivningstiden. 
13 § 
Nedskrivning 
Om den sannolika framtida inkomsten av en tillgång eller investering som hör till bestående aktiva beräknas bli varaktigt mindre än den ännu oavskrivna anskaffningsutgiften, ska skillnaden kostnadsföras som en nedskrivning. 
14 § 
Framtida utgifter och förluster samt avsättningar 
I resultaträkningen ska dras av de utgifter och förluster som orsakas av framtida förpliktelser, om 
1) de hänför sig till räkenskapsperioden eller en tidigare räkenskapsperiod, 
2) de ska anses vara säkra eller sannolika vid den tidpunkt då bokslutet upprättas, 
3) den inkomst som motsvarar dem inte är säker eller sannolik, och 
4) de baserar sig på lag eller den bokföringsskyldigas förpliktelse gentemot en utomstående. 
Om det exakta beloppet av en utgift eller förlust som avses i 1 mom. eller datum för dess realisering är känt ska det, beroende på dess karaktär, tas upp i balansräkningen som främmande kapital eller som en resultatregleringspost. I annat fall ska beloppet tas upp som en avsättning. 
Förluster och utgifter som avses i 1 mom. samt avsättningar som avses i 2 mom. ska i resultaträkningen och balansräkningen tas upp till sitt sannolika belopp. 
Avsättningar får inte användas för nedskrivning av tillgångsposter till ett belopp som är mindre än det som tagits upp i balansräkningens aktiva. 
15 § 
Skattemässiga reserver 
I bokslutet får överföring göras till investerings-, drifts- och andra sådana skattemässiga reserver. 
16 § 
Rättelse av kostnadsföring 
Om en kostnadsföring som har gjorts tidigare än under den räkenskapsperiod som bokslutet avser beträffande finansieringstillgångar enligt 2 §, omsättningstillgångar enligt 6 § 1 mom. eller balansräkningens bestående aktiva enligt 13 § visar sig vara obefogad, ska den tas upp som en rättelse av kostnadsföringen. Rättelsen avser dock inte goodwill. 
17 § 
Uppskrivning 
Om det sannolika överlåtelsepriset för ett jord- eller vattenområde eller ett annat värdepapper än ett i 2 a § avsett finansiellt instrument, som hör till bestående aktiva på bokslutsdagen, varaktigt är väsentligt högre än den ursprungliga anskaffningsutgiften, får i balansräkningen utöver den ännu oavskrivna delen av anskaffningsutgiften med iakttagande av konsekvens och försiktighet tas upp en uppskrivning motsvarande högst skillnaden mellan det sannolika överlåtelsepriset och den oavskrivna delen av anskaffningsutgiften. 
Om en i 1 mom. avsedd uppskrivning gäller aktier eller andelar som ett moderföretag äger i ett dotterföretag, ska de aktier eller andelar som dotterföretaget äger i moderföretaget anses vara utan värde när uppskrivningen görs. 
Ett belopp motsvarande uppskrivningen ska tas upp i en uppskrivningsfond som ingår i det egna kapitalet. Bestämmelser om begränsningar i utbetalning och annan användning av denna fond finns i aktiebolagslagen och lagen om andelslag. 
Om en uppskrivning visar sig vara obefogad ska den återföras och uppskrivningsfonden minskas i motsvarande mån. 
Frågan om huruvida en nedskrivning enligt 13 § behövs ska bedömas enligt uppskrivningens värde vid räkenskapsperiodens slut. 
18 § 
Latenta skatteskulder och skattefordringar 
Latenta skatteskulder och skattefordringar som beror på periodiseringsskillnader mellan intäkter och motsvarande skattepliktiga inkomster, liksom mellan kostnader och motsvarande, i beskattningen avdragbara utgifter samt på tillfälliga skillnader mellan bokföringsvärden och skattemässiga värden, får med iakttagande av försiktighet tas upp som en särskild post i resultaträkningen och balansräkningen. 
6 kap. 
Koncernbokslut 
1 § 
Skyldighet att upprätta koncernbokslut 
Ett moderföretag ska upprätta och i sitt bokslut ta in ett koncernbokslut, om det är 
1) ett aktiebolag, 
2) ett öppet bolag eller kommanditbolag som har ett aktiebolag som ansvarig bolagsman, eller 
3) ett öppet bolag eller kommanditbolag som har ett öppet bolag eller kommanditbolag som avses i 2 punkten som ansvarig bolagsman, eller 
4) ett andelslag. 
Även andra moderföretag än sådana som avses i 1 mom. är skyldiga att upprätta och i sitt bokslut ta in ett koncernbokslut, om de driver rörelse. Den skyldighet som avses i detta moment gäller dock inte yrkesutövare eller rörelseidkare. 
Trots bestämmelserna om en rättvisande bild i 3 kap. 2 § behöver en liten koncern inte upprätta koncernbokslut om inget av koncernföretagen är ett företag av allmänt intresse. 
Utöver vad som föreskrivs i 3 mom. behöver ett koncernbokslut inte upprättas, om 
1) ett företag som lyder under lagstiftningen i en stat inom Europeiska ekonomiska samarbetsområdet äger minst nio tiondelar av moderföretaget, 
2) moderföretagets övriga ägare har gett sitt samtycke till att koncernbokslut inte upprättas, samt 
3) boksluten för moderföretaget och dess dotterföretag sammanställs med koncernbokslutet för ett företag som lyder under lagstiftningen i en stat inom Europeiska ekonomiska samarbetsområdet och koncernbokslutet ges in för registrering enligt bestämmelserna i 3 kap. 9 §. 
Undantag enligt 4 mom. kan under de förutsättningar som avses där tillämpas också då en i momentet angiven andel av moderföretaget ägs av ett företag som inte lyder under lagstiftningen i en stat inom Europeiska ekonomiska samarbetsområdet, under förutsättning att 
1) detta företag upprättar sitt koncernbokslut och koncernens verksamhetsberättelse,
a) i enlighet med direktivet,
b) på ett sätt som motsvarar det enligt vilket koncernbokslut och koncernverksamhetsberättelser upprättas i enlighet med direktivet,
c) enligt kraven i de internationella redovisningsstandarder som antagits genom IAS-förordningen, eller
d) på ett sätt som motsvarar det som anges i de internationella redovisningsstandarder som definieras i kommissionens förordning (EG) nr 1569/2007 om införande av en mekanism för fastställande av likvärdighet för redovisningsstandarder som tillämpas av tredjelandsemittenter av värdepapper enligt Europaparlamentets och rådets direktiv 2003/71/EG och 2004/109/EG, samt att
 
2) koncernbokslutet granskas av en revisor eller revisionssammanslutning som är godkänd enligt den nationella lagstiftning som företaget lyder under. 
Utöver vad som föreskrivs ovan i denna paragraf behöver koncernbokslut inte upprättas om 
1) dotterföretagen inte vart för sig och tillsammans är väsentliga för att ge en rättvisande bild av koncernen under den avslutade och den föregående räkenskapsperioden, eller om 
2) dotterföretagen inte behöver sammanställas med stöd av 3 §. 
Bestämmelserna i 4 och 5 mom. ska inte tillämpas om värdepapper som emitterats av ett finländskt moderföretag är föremål för handel på en sådan reglerad marknad i Finland eller i någon annan stat som hör till Europeiska ekonomiska samarbetsområdet som avses i Europa Parlamentets och Rådets direktiv 2004/39/EG om marknader för finansiella instrument och om ändring av rådets direktiv 85/611/EEG och 93/6/EEG och Europaparlamentets och rådets direktiv 2000/12/EG samt upphävande av rådets direktiv 93/22/EEG. 
2 § 
Koncernbokslutets innehåll och upplysningar om koncernen som ska ingå i moderbolagets verksamhetsberättelse 
Koncernbokslut ska upprättas som en sammanställning av koncernföretagens resultaträkningar och balansräkningar samt noterna till dessa. På koncernbokslut tillämpas 3—5 kap. med beaktande av särdragen i koncernbokslut jämfört med bokslut. Koncernbokslut ska upprättas samma dag som moderföretagets bokslut. 
I en stor koncern ska i koncernbokslutet tas in en finansieringsanalys för koncernen i vilken ska ges en redogörelse för anskaffningen och användningen av koncernens medel under räkenskapsperioden. Detsamma gäller också sådana koncerner där något av koncernföretagen är ett företag av allmänt intresse. 
I verksamhetsberättelsen för moderföretaget ska ges upplysningar enligt 3 kap. 1 a § även för koncernens del. Bestämmelser om att den som emitterat värdepapper som är föremål för handel på en reglerad marknad ska foga en bolagsstyrningsrapport till verksamhetsberättelsen eller till en särskild berättelse finns i 7 kap. 7 § i värdepappersmarknadslagen. 
Handlingar som ingår i och bifogas till koncernbokslutet ska vara överskådliga och bilda en helhet. 
3 § 
Undantag från skyldighet att ta med dotterföretag i koncernbokslutet 
Ett dotterföretags bokslut behöver inte tas med i koncernbokslutet, om 
1) en rättvisande bild av koncernens verksamhetsresultat och ekonomiska ställning inte äventyras av att boksluten inte sammanställs, 
2) innehavet i dotterföretaget är kortvarigt och avsett enbart att överlåtas vidare, 
3) de uppgifter som är nödvändiga för att upprätta koncernbokslutet undantagsvis inte kan erhållas inom den tid som bestämts för upprättandet av bokslutet eller om anskaffandet av uppgifterna medför oskäliga utgifter, eller 
4) betydande och varaktiga hinder i väsentlig grad begränsar moderföretagets möjligheter att utöva inflytande i dotterföretaget. 
Dotterföretagens bokslut ska sammanställas med koncernbokslutet, om till koncernen hör flera sådana dotterföretag som avses i 1 mom. 1 punkten och koncernbokslutet inte ger en rättvisande bild av koncernens resultat och ekonomiska ställning i det fall att dotterföretagens bokslut inte sammanställs med koncernbokslutet. 
4 § 
Principer för upprättande av koncernbokslut 
Vid upprättande av koncernbokslut ska fortlöpande tillämpas samma principer. Dessa får ändras endast om det är befogat för att ge en rättvisande bild. 
Koncernföretagens bokslut ska före sammanställningen ändras så att i dem enhetligt tillämpas de bokslutsprinciper enligt denna lag som följs antingen i moderföretaget eller i koncernens huvudsakliga verksamhet. Undantag från detta får göras av särskilda skäl. 
5 § 
Dotterföretagets räkenskapsperiod och skyldighet att upprätta mellanbokslut 
Om räkenskapsperioden för ett dotterföretag som ska omfattas av koncernbokslutet utgår högst tre månader före eller efter utgången av moderföretagets räkenskapsperiod, kan sammanställningen med koncernbokslutet ske utan att ett mellanbokslut upprättas, förutsatt att detta förfarande anges i koncernbokslutets noter så som föreskrivs i bokföringsförordningen. 
7 § 
Koncerninterna poster och minoritetsandelar 
Den ackumulerade differensen (avskrivningsdifferens) mellan bokförda och planenliga avskrivningar samt skattemässiga reserver ska tas upp i koncernbalansräkningen uppdelade i eget kapital och latent skatteskuld samt deras förändring i koncernresultaträkningen uppdelad i förändring i latent skatteskuld och räkenskapsperiodens resultat. 
8 § 
Förvärvsmetoden 
Koncernens interna innehav av aktier eller andelar i ett dotterföretag ska elimineras genom att deras anskaffningsutgift dras av och genom att från dotterföretagets eget kapital vid anskaffningstidpunkten dras av ett belopp som motsvarar koncernens innehav. I dotterföretagets eget kapital ska även räknas in den ackumulerade avskrivningsdifferensen och skattemässiga reserver med avdrag av den latenta skatteskulden. 
Om aktier eller andelar i ett företag har förvärvats av koncernen innan företaget blev dotterföretag, får deras anskaffningsutgift elimineras utifrån den tidpunkt då företaget blev dotterföretag. Anskaffningsutgiften för aktier och andelar får elimineras även enligt det egna kapital som dotterföretagets balansräkning uppvisar då den första gången sammanställs med koncernbokslutet, om detta förfarande inte har en väsentlig inverkan på den rättvisande bild som ska ges av koncernens verksamhetsresultat och ekonomiska ställning. 
Om anskaffningsutgiften för aktier eller andelar vid elimineringen enligt 1 mom. är större än motsvarande eget kapital, ska den resterande posten (koncernaktiva) fördelas enligt koncernens ägarandel på de tillgångs- och skuldposter hos dotterföretaget till vilka koncernaktiva kan hänföras. 
Om anskaffningsutgiften för aktier eller andelar vid elimineringen enligt 1 mom. är mindre än motsvarande eget kapital, fördelas den resterande posten (koncernpassiva) enligt koncernens ägarandel på de tillgångs- och skuldposter hos dotterföretaget till vilka koncernpassiva kan hänföras. 
Den del av koncernaktiva som inte kan fördelas enligt 3 mom. (koncerngoodwill) ska aktiveras och skrivas av enligt plan under sin verkningstid. Om moderföretaget inte på ett tillförlitligt sätt kan bedöma verkningstiden ska koncerngoodwill skrivas av inom högst tio år. 
Den del av koncernpassiva som inte kan fördelas enligt 4 mom. (koncernreserv) får tas upp bland balansräkningens passiva som en egen post, förutsatt att motsvarande utgift eller förlust är att vänta i ett dotterföretag. Koncernreserven ska i koncernresultaträkningen tas upp som intäkt när motsvarande utgift eller förlust kostnadsförs i dotterföretagets resultaträkning eller när den motsvaras av en realiserad intäkt. 
11 § 
Latenta skattepåföljder av sammanställning 
Om koncernens resultat till följd av sammanställning är större eller mindre än de sammanlagda resultaten av de bokslut som sammanställts med koncernbokslutet, ska de direkta skatterna för räkenskapsperioden och tidigare räkenskapsperioder korrigeras och kompletteras enligt koncernens resultat innan de tas upp i koncernbokslutet, till den del framtida skattepåföljder för koncernföretagen kan anses uppenbara. 
12 § 
Skyldighet att sammanställa ett intresseföretags bokslutsuppgifter 
Ett intresseföretags bokslutsuppgifter behöver inte sammanställas med koncernbokslutet, om 
1) en rättvisande bild av koncernens verksamhetsresultat och ekonomiska ställning inte äventyras av att boksluten inte sammanställs, eller om 
2) någon annan omständighet som avses i 3 § begränsar utarbetande av en sammanställning. 
13 § 
Sammanställning av intresseföretags bokslutsuppgifter 
Intresseföretagens bokslut ska, om möjligt, ändras före sammanställningen på det sätt som avses i 4 § 2 mom. Vid omräkning av ett utländskt intresseföretags bokslutsposter till finsk valuta ska bestämmelserna i 6 § tillämpas. 
När ett intresseföretags bokslutsuppgifter första gången sammanställs med koncernbokslutet, ska i koncernbalansräkningen ges upplysningar om anskaffningsutgiften för aktierna eller andelarna i intresseföretaget. I en not till koncernbalansräkningen ska den skillnad uppges som erhålls när den andel av eget kapital enligt intresseföretagets senaste bokslut som motsvarar innehavet dras av från anskaffningsutgiften för aktierna eller andelarna i intresseföretaget. Med avvikelse från vad som föreskrivs ovan i denna paragraf, får av anskaffningsutgiften för aktierna eller andelarna i intresseföretaget som en egen post i koncernbalansräkningen antecknas en andel av intresseföretagets eget kapital liksom den i ovannämnda not avsedda skillnad som svarar mot koncernaktiva eller koncernpassiva. 
Den skillnad som avses i 2 mom. får räknas ut även på grundval av det egna kapitalet vid tidpunkten när aktierna eller andelarna i intresseföretaget förvärvades eller, om de har förvärvats av koncernen innan den bokföringsskyldiga blev intresseföretag, på grundval av det egna kapitalet vid tidpunkten när den bokföringsskyldiga blev intresseföretag. 
När intresseföretagets bokslutsuppgifter efter den första gången sammanställs med koncernbokslutet, ska i koncernbalansräkningen anskaffningsutgiften för aktierna eller andelarna i intresseföretaget ökas med en mot koncernens innehav svarande andel av intresseföretagets vinster eller förluster efter det företaget första gången omfattats av sammanställningen. Från anskaffningsutgiften ska dras av de utdelningar och andra motsvarande vinstandelar som koncernföretagen under denna period erhållit från intresseföretaget. Av intresseföretagets vinst för räkenskapsperioden ska ett belopp som motsvarar koncernföretagens ägarandel tas upp i koncernresultaträkningen som intäkt och motsvarande andel av förlusten som kostnad. 
I intresseföretagets eget kapital som avses i 2 - 4 mom. ska även räknas in det sammanlagda beloppet av den ackumulerade avskrivningsdifferensen och de skattemässiga reserverna med avdrag av den latenta skatteskulden. Vid beräkning av ett intresseföretags vinst eller förlust som avses i 4 mom. beaktas förändringen i avskrivningsdifferensen och de skattemässiga reserverna med avdrag av förändringen i den latenta skatteskulden. 
Den enligt 2 mom. beräknade del av anskaffningsutgiften för aktierna eller andelarna i intresseföretaget som överskrider andelen av eget kapital och som inte kan hänföras till intresseföretagets tillgångs- eller skuldposter ska avskrivas på det sätt som anges i 8 § 5 mom. Den andel av anskaffningsutgiften som underskrider andelen av det egna kapitalet och som inte kan hänföras till tillgångs- eller skuldposterna på ovannämnt sätt, ska antecknas som intäkt i koncernresultaträkningen på det sätt som anges i 8 § 6 mom. 
Vid sammanställning av ett intresseföretags bokslutsuppgifter ska den bokföringsskyldiga på det sätt som avses i 7 § 2 och 3 mom. beakta ett mot koncernens ägarandel svarande belopp av internvinst som har aktiverats i balansräkningen och som uppkommit vid överlåtelse av tillgångar mellan intresseföretaget och koncernföretagen och av förändringar i dessa vinster under räkenskapsperioden, om nödvändiga uppgifter finns att tillgå. Dessa internvinster och förändringar i dem behöver inte dras av, om detta inte på ett väsentligt sätt äventyrar en rättvisande bild av koncernens verksamhetsresultat och ekonomiska ställning. 
16 § 
Intresseföretagets koncernbokslut 
Om ett intresseföretag upprättar och i sitt bokslut tar in ett koncernbokslut, ska detta koncernbokslut i enlighet med 12—15 § sammanställas som intresseföretagets uppgifter. 
7 a kap. 
Bokslut och koncernbokslut som skall upprättas enligt internationella redovisningsstandarder 
1 § 
Internationella redovisningsstandarder 
Med internationella redovisningsstandarder avses i denna lag, samt i bestämmelser som ges med stöd av denna lag, standarder som antagits för tillämpning i gemenskapen i enlighet med IAS-förordningen, med tillhörande tolkningar. 
2 § 
Obligatorisk tillämpning av internationella redovisningsstandarder 
En bokföringsskyldig som har emitterat värdepapper som tagits upp till handel på en reglerad marknad i en stat inom Europeiska ekonomiska samarbetsområdet ska upprätta sitt koncernbokslut enligt internationella redovisningsstandarder. 
8 kap. 
Särskilda bestämmelser 
1 § 
Främjande av lagens syfte samt tillsyn 
Bokföringsnämnden som tillsatts av arbets- och näringsministeriet ger anvisningar och utlåtanden om efterlevnaden och tillämpningen av denna lag. Ministeriet publicerar nämndens ställningstaganden för att främja god bokföringssed. 
Patent- och registerstyrelsen övervakar att den anmälningsskyldighet som avses i 3 kap. 9 § iakttas. Om anmälningsskyldigheten åsidosätts, kan patent- och registerstyrelsen vid vite ålägga den som enligt 3 kap. 7 § är skyldig att skriva under bokslutet att ge in bokslutet inom utsatt tid. Beträffande vite gäller viteslagen (1113/1990). I beslut genom vilket vite har förelagts får ändring inte sökas genom besvär. 
Finansinspektionen utövar tillsyn över efterlevnaden av denna lag hos 
1) tillsynsobjekt enligt 4 § i lagen om Finansinspektionen (878/2008), och hos 
2) bokföringsskyldiga som iakttar internationella redovisningsstandarder till den del därom föreskrivs i 37 § i lagen om Finansinspektionen. 
2 § 
Bokföringsnämnd 
Bokföringsnämnden kan ge anvisningar och utlåtanden på ansökan av myndigheter, näringsidkare, kommunorganisationer och bokföringsskyldiga. 
Bokföringsnämnden kan av särskilda skäl för viss tid i enskilda fall bevilja undantag från bestämmelserna i 3 kap. 6 § och 6 kap. 5 § 1 mom. En förutsättning för att undantag ska kunna beviljas är att undantaget inte strider mot Europeiska unionens bestämmelser om bokslut och koncernbokslut. 
Bokföringsnämnden har en kommunsektion. Även andra permanenta eller tidsbestämda sektioner kan inrättas vid bokföringsnämnden. Till sektionerna kan kallas personer som inte hör till bokföringsnämnden. Närmare bestämmelser om uppgifterna för en sektion vid bokföringsnämnden samt om sammansättning, tillsättande och beslutförhet utfärdas genom förordning av statsrådet. 
Vid arbets- och näringsministeriet kan inrättas en sekreterartjänst för bokföringsnämnden. 
4 § 
Bokföringsförseelse 
Den som uppsåtligen eller av grov oaktsamhet 
1) försummar att göra noteringar i bokföringen inom den tid som anges i 2 kap. 4 § 3 mom., 
2) åsidosätter skyldigheten enligt 2 kap. 5 a § att till en verifikation enligt 2 kap. 5 § foga ett av arbetstagaren undertecknat kvitto på eller någon annan utredning som verifierar utbetalningen av lön kontant, 
3) åsidosätter skyldigheten att arkivera bokföringsmaterial enligt 2 kap. 10 §, eller 
4) åsidosätter registreringsskyldigheten enligt 3 kap. 9 §, 
ska, om inte gärningen utgör bokföringsbrott, grovt bokföringsbrott eller bokföringsbrott av oaktsamhet enligt 30 kap. 9, 9 a eller 10 § i strafflagen (39/1889) eller om inte strängare straff för gärningen föreskrivs någon annanstans i lag, för bokföringsförseelse dömas till böter. 
5 § 
Bestämmelser om bokföring i andra lagar 
Utan hinder av denna lag gäller i fråga om bokföringsskyldighet och bokföring samt om offentliggörande av bokslut och verksamhetsberättelse vad som särskilt föreskrivs om detta någon annanstans i lag eller vad den behöriga myndigheten har bestämt eller föreskrivit med stöd av annan lag. 
Med andra bestämmelser eller föreskrifter som avses i 1 mom. kan småföretag i form av aktiebolag inte åläggas att upprätta eller offentliggöra andra uppgifter än sådana som förutsätts i denna lag eller i bestämmelser som utfärdats med stöd av den. Vad som i detta moment föreskrivs om aktiebolag tillämpas också på öppna bolag och på kommanditbolag vars samtliga ansvariga bolagsmän är aktiebolag. 
Med avvikelse från vad som föreskrivs i 2 mom. kan små företag åläggas att i sitt bokslut ta in andra uppgifter än sådana som avses i denna lag och i författningar som utfärdats med stöd av den, förutsatt att 
1) uppgifterna sammanställs i ett gemensamt system, 
2) uppgiftskravet är baserat på skattelagstiftningen, och 
3) uppgifterna samlas in enbart av skatteuppbördsskäl. 
6 § 
Närmare bestämmelser 
Närmare bestämmelser om resultaträknings- och balansräkningsscheman för bokslut, om verksamhetsberättelse, finansieringsanalys och noter som gäller bokslut, om motsvarande scheman, handlingar och noter som gäller koncernbokslut samt om specifikationer till balansräkningen och specifikationer av noter utfärdas genom förordning av statsrådet separat för små- och mikroföretag och separat för övriga bokföringsskyldiga. 
Arbets- och näringsministeriet kan genom förordning justera de gränser som avses i 1 kap. 4 a—4 d § för att uppfylla internationella avtal som är förpliktande för Finland. 
Denna lag träder i kraft den 20. Lagen tillämpas första gången under den räkenskapsperiod som börjar den 1 januari 2016 eller därefter. Bokföringsskyldiga får dock tillämpa denna lag till bokslut, som upprättas efter att lagen trädde i kraft. 
Trots vad som i 5 kap. 2 a § föreskrivs om upptagande och presentation av finansiella instrument i bokslutet till verkligt värde får bokföringsskyldiga på finansiella instrument som tagits upp till verkligt värde innan denna lag trädde i kraft, tillämpa de bestämmelser som gällde vid den tidpunkt då instrumentet antecknades i bokslutet. 
Trots vad som föreskrivs i 5 kap. 5 b § får på finansiella leasingavtal som ingåtts innan denna lag trädde i kraft tillämpas de bestämmelser som gällde vid ikraftträdandet. 
Trots vad som föreskrivs i 5 kap. 8 § 2 mom. om kostnadsföring av utvecklingsutgifter samt i 9 § om kostnadsföring av anskaffningsutgiften för goodwill och i 11 § om kostnadsföring av andra utgifter med lång verkningstid, får de bokföringsskyldiga på utvecklingsutgifter, goodwill och andra utgifter med lång verkningstid vilka aktiverats i bokslutet innan denna lag trädde i kraft tillämpa de bestämmelser som gällde då dessa kostnader togs upp som kostnader. 
2. 
Lag 
om offentliggörande av sådana betalningar till myndigheter som gjorts av företag som är verksamma i utvinningsindustrin eller inom avverkning av naturskog 
I enlighet med riksdagens beslut föreskrivs: 
1 § 
Tillämpningsområde 
I denna lag finns bestämmelser om skyldigheten för företag som är verksamma i utvinningsindustrin eller inom avverkning av naturskog att i en årlig rapport uppge de betalningar som gjorts till myndigheter i de stater där företaget bedriver verksamhet (årsrapport). 
Lagen tillämpas dock inte på företag som inte är företag av allmänt intresse och där högst två av följande tre gränsvärden har överskridits både under den senaste och den omedelbart föregående räkenskapsperioden 
1) omsättning eller motsvarande avkastning 40 000 000 euro, 
2) balansomslutning 20 000 000 euro, 
3) genomsnittligt antal anställda 250 personer. 
2 § 
Definitioner 
I denna lag avses med 
1) företag aktiebolag enligt aktiebolagslagen (624/2006) och andelslag enligt lagen om andelslag (421/2013) samt öppna bolag eller kommanditbolag enligt lagen om öppna bolag och kommanditbolag (389/1988), om samtliga ansvariga bolagsmän i det öppna bolaget eller kommanditbolaget är aktiebolag eller andelslag, 
2) företag av allmänt intresse företag som avses i 1 kap. 9 § i bokföringslagen (1336/1997), 
3) utvinningsindustri verksamhet som inbegriper utforskning, prospektering, upptäckt, utveckling och utvinning av mineraler, olja, naturgasfyndigheter eller andra ämnen, inom ramen för de ekonomiska verksamheter som är förtecknade i bilaga I avdelning B – huvudgrupperna 05–08 i Europaparlamentets och rådets förordning (EG) nr 1893/2006 om fastställande av den statistiska näringsgrensindelningen Nace rev. 2 och om ändring av rådets förordning (EEG) nr 3037/90 och vissa EG-förordningar om särskilda statistikområden,  
4) avverkning av naturskog sådan verksamhet i naturskog som avses i bilaga I avdelning A – huvudgrupp 02, grupp 02.2 i förordning (EG) nr 1893/2006, 
5) myndighet en statlig eller lokal myndighet, vari inbegrips underlydande ämbetsverk samt företag som står under bestämmande inflytande av myndigheten. 
6) projekt kontrakterad verksamhet som ligger till grund för ett företags betalningsansvar gentemot en myndighet, 
7) betalning ett belopp, vare sig det är i pengar eller annat vederlag inom utvinningsindustri eller inom avverkning av naturskog som betalats för
a) produktionsrättigheter,
b) skatter som på inkomster, produktion eller vinst från företag, med undantag för mervärdesskatt och andra konsumtionsbaserade skatter,
c) royalty,
d) dividend och annan vinstutdelning,
e) kontrakts-, upptäckts- och produktionsbonusar,
f) licensavgifter, hyresavgifter, avgifter för registrering av gruvrätter samt andra ersättningar för licenser och eller koncessioner, och
g) betalningar för infrastrukturförbättringar.
 
Om ett kontrakt enligt 1 mom. 5 punkten på ett betydelsefullt sätt är sammankopplat med ett annat sådant kontrakt ska den verksamhet som avtalen avser anses utgöra ett projekt. 
Dividender eller annan vinstutdelning som betalts till en myndighet på samma villkor som till andra ägare i företaget ska inte räknas in i en betalning enligt 1 mom. 6 punkten underpunkt d, om utdelningen inte gjorts i stället för en avgift för produktionsrättigheter eller en royalty. 
Betalningar och verksamheter får inte delas upp eller slås ihop om arrangemanget sker i syfte att undvika tillämpning av denna lag. 
3 § 
Upprättande av årsrapport och dess innehåll 
Företag ska göra upp en årsrapport med följande myndighetsspecifika uppgifter om utvinningsindustri och avverkning av naturskog för den senast avslutade räkenskapsperioden: 
1) utbetalningarnas totala värde, 
2) en specifikation enligt 2 § 1 mom. 6 punkten av det totala värdet. 
I fråga om betalningar som grundar sig på ett specifikt projekt redovisas utöver vad som föreskrivs i 1 mom. det totala värdet av dessa betalningar projektspecifikt och en specifikation enligt 2 § 1 mom. 6 punkten. 
Om betalningarna baserar sig på skyldigheter som hänför sig till en viss verksamhetsenhet, får företaget med avvikelse från 2 mom. redovisa betalningarna per enhet. 
I årsrapporten ska betalningarna och den underliggande verksamheten redovisas enligt sin faktiska karaktär. 
4 § 
Årsrapport för koncerner 
Då ett företag enligt bokföringslagen är skyldigt att upprätta koncernbokslut upprättas en årsrapport för hela koncernen (koncernens årsrapport), om 
1) företaget eller dess dotterföretag, som omfattas av tillämpningsområdet för denna lag, är verksamt i utvinningsindustrin eller inom avverkning av naturskog, eller om  
2) under den senast avslutade räkenskapsperioden minst två av gränsvärdena i 1 § 2 mom. sammanräknat har överskridits i koncernföretag som är verksamma i utvinningsindustrin eller inom avverkning av naturskog. 
Om information om ett företag ingår i koncernens årsrapport behöver företaget inte upprätta årsrapport enligt 3 §. 
Den skyldighet som föreskrivs i 1 mom. gäller inte 
1) moderföretaget i en småkoncern enligt 1 kap. 6 a § i bokföringslagen, om dess dotterföretag inte är ett företag av allmänt intresse, 
2) ett moderföretag som självt är dotterföretag i en koncern vars moderföretag lyder under lagstiftningen i en medlemsstat inom Europeiska ekonomiska samarbetsområdet. 
De betalningar som anges i en koncerns årsrapport ska basera sig på utvinningsindustrin eller på avverkning av naturskog inom koncernen. 
Under förutsättning att samma undantag tillämpas på upprättande av koncernbokslut, behöver i koncernens årsrapport inte tas in ett dotterföretags betalningar, om 
1) betydande och långvariga hinder föreligger som i väsentlig grad förhindrar moderföretaget att utöva inflytande i detta dotterföretag, 
2) det undantagsvis inte är möjligt att utan oskäliga kostnader eller orimligt dröjsmål få den information som behövs för att upprätta en årsrapport för koncernen, eller om 
3) innehavet i dotterföretaget är kortvarigt och uteslutande avsett att vidareöverlåtas. 
5 § 
Hur betalningen bestäms 
Under räkenskapsperioden gjorda betalningar på minst 100 000 euro ska beaktas när det totala värdet av betalningarna som ska redovisas i årsrapporten bestäms. 
Om ett företag har betalt hyra som delbetalningar eller annars gjort periodiska inbetalningar som har samband med varandra, ska dessa vid tillämpningen av 1 mom. räknas ihop för räkenskapsperioden. 
När något annat vederlag än pengar har använts för betalningen ska vederlaget beaktas till sitt verkliga värde. Också arten och mängden för sådana vederlag ska uppges samt en beskrivning ges av hur värdet har bestämts. 
6 § 
Språk och valuta 
Årsrapporten ska upprättas på finska eller svenska, i euro. Om företaget lägger fram de uppgifter som ska ges i årsrapporten också i någon annan valuta, ska den kurs som använts vid omräkningen av uppgifterna anges. 
7 § 
Datering och underskrift 
Årsrapporten och koncernens årsrapport ska dateras och undertecknas. 
I aktiebolag och andelslag ska årsrapporten eller koncernens årsrapport undertecknas av styrelsen och verkställande direktören och i ett öppet bolag och kommanditbolag av de ansvariga bolagsmännen. Om den som undertecknat årsrapporten har framfört avvikande mening om denna, ska på yrkande av undertecknaren tas in ett yttrande om saken i årsrapporten. 
8 § 
Registrering och offentliggörande 
En kopia av årsrapporten och av koncernens årsrapport ska anmälas till patent- och registerstyrelsen för registrering. 
Om företaget är ett aktiebolag eller andelslag ska det göra anmälan inom två månader efter den ordinarie bolagsstämman eller andelsstämman. Ett öppet bolag eller kommanditbolag ska göra anmälan inom sex månader efter räkenskapsperiodens utgång. 
Om den skyldighet som föreskrivs i 2 mom. åsidosätts kan registermyndigheten ålägga verkställande direktören eller en styrelseledamot eller någon annan person som avses i 7 § 2 mom. att vid vite fullgöra skyldigheten inom en tid som registermyndigheten bestämmer. I ett beslut genom vilket registermyndigheten har förelagt vite får ändring inte sökas genom besvär. 
Patent- och registerstyrelsen offentliggör årsrapporter och koncernårsrapporter som anmälts för registrering på samma sätt som bokslutet och verksamhetsberättelsen. 
9 § 
Årsrapportsförseelse 
Den som uppsåtligen eller av grov oaktsamhet åsidosätter 
1) sin skyldighet att försäkra sig om att årsrapporten har upprättats i enlighet med denna lag, eller 
2) skyldigheten att anmäla rapporten för registrering, 
ska, om inte strängare straff för gärningen föreskrivs någon annanstans i lag, för årsrapportsförseelse dömas till böter. 
Till straff döms inte om förseelsen är ringa. 
10 § 
Ikraftträdande 
Denna lag träder i kraft den 2015 och den ska tillämpas på årsrapporter som upprättas för räkenskapsperioder som börjar den 1 januari 2016 och därefter. 
3. 
Lag 
om ändring av aktiebolagslagen 
I enlighet med riksdagens beslut 
ändras aktiebolagslagen (624/2006) 8 kap. 5 och 9 § samt 13 kap 5 § som följer: 
8 kap. 
Eget kapital, bokslut, verksamhetsberättelse och koncern 
5 § 
Verksamhetsberättelse 
Av verksamhetsberättelsen ska alltid framgå den information som anges i denna lag, om aktiebolaget inte är ett småföretag som avses i 1 kap. 4 a § i bokföringslagen eller ett mikroföretag som avses i 4 b § i samma kapitel och om vars verksamhetsberättelse och bokslut finns särskilda bestämmelser bokföringslagen. 
Verksamhetsberättelsen ska innehålla styrelsens förslag till disposition av bolagets vinst samt styrelsens förslag till eventuell utbetalning av annat fritt eget kapital. 
I verksamhetsberättelsen ska uppges 
1) antalet aktier av varje aktieslag och bolagsordningens huvudsakliga bestämmelser om varje aktieslag, samt 
2) de huvudsakliga villkoren för kapitallån och den på lånen upplupna, icke-kostnadsförda räntan. 
I verksamhetsberättelsen ska uppges bolagets utländska filialer. 
Den information som avses i denna lag får dock lämnas i bokslutsnoter i stället för i verksamhetsberättelsen, om inte något annat föreskrivs i bokföringslagen. 
9 § 
Koncernbokslut 
Koncernbokslut ska, utöver vad som föreskrivs annanstans, upprättas i enlighet med detta kapitel. 
Moderbolaget ska alltid upprätta ett koncernbokslut, om det betalar ut medel till aktieägarna eller är ett publikt aktiebolag. Ett koncernbokslut behöver dock inte upprättas för en liten koncern som avses i 1 kap. 6 a § i bokföringslagen och inte heller då bolaget enligt 6 kap. 1 § 4 mom. i bokföringslagen är befriat från skyldigheten att upprätta koncernbokslut. 
13 kap. 
Utbetalning av medel 
5 § 
Utdelningsbart belopp 
Om inte annat följer av vad som i 2 § föreskrivs om bolagets solvens, får bolaget betala ut fritt eget kapital från vilket har dragits av belopp som enligt bolagsordningen inte får betalas ut, samt belopp i form av utvecklingsutgifter som i enlighet med bokföringslagen har tagits upp i balansräkningen. 
Denna lag träder i kraft den 2015. Lagen ska första gången tillämpas den räkenskapsperiod som börjar den 1 januari 2016 eller därefter. Aktiebolag får dock tillämpa denna lag under den räkenskapsperiod som börjar efter ikraftträdandet. 
4. 
Lag 
om ändring av 8 kap. 9 § och 16 kap. 6 § i lagen om andelslag 
I enlighet med riksdagens beslut 
ändras lagen on andelslag (421/2013) 8 kap. 9 § och 16 kap 6 § som följer: 
8 kap. 
eget kapital, bokslut, verksamhetsberättelse och koncern 
9 § 
Koncernbokslut 
Koncernbokslut ska, utöver vad som föreskrivs någon annanstans, upprättas i enlighet med detta kapitel. 
Moderandelslaget ska alltid upprätta ett koncernbokslut, om det betalar ut medel till medlemmarna, andelsägarna eller aktieägarna. Ett koncernbokslut behöver dock inte upprättas för en liten koncern som avses i 1 kap. 6 a § i bokföringslagen och inte heller om andelslaget enligt 6 kap. 1 § 4 mom. i den nämnda lagen är befriat från skyldigheten att upprätta koncernbokslut. 
16 kap. 
Utbetalning av medel 
6 § 
Utdelningsbart belopp 
Om inte annat följer av vad som i 2 § föreskrivs om andelslagets solvens, får andelslaget betala ut fritt eget kapital till ett belopp från vilket har dragits av det belopp som ska avsättas till reservfonden och de övriga medel som enligt stadgarna inte får betalas ut samt belopp i form av utvecklingsutgifter som i enlighet med bokföringslagen har tagits upp i balansräkningen. 
Av det överskott som tillkommer en medlem och en annan andelsägare innehålls hälften för erläggande av det belopp av andelen som är obetalt, om inte annat bestäms i stadgarna. 
Denna lag träder i kraft den 2015. Lagen ska första gången tillämpas den räkenskapsperiod som börjar den 1 januari 2016 eller därefter. Andelslag får dock tillämpa denna lag under den räkenskapsperiod som börjar efter ikraftträdandet. 
5. 
Lag 
om ändring av kreditinstitutslagen 
I enlighet med riksdagens beslut 
upphävs i kreditinstitutslagen (610/2014) 12 kap. 7 §, och 
ändras 12 kap. 1 § 2 och 3 mom. samt 2, 6, 8 och 10 § som följer: 
12 kap. 
Bokslut, delårsrapport och revision 
1 § 
Bestämmelser som tillämpas på upprättande av bokslut 
Vid upprättande av bokslut för kreditinstitut tillämpas inte bokföringslagens 1 kap. 4 § 1 mom. om räkenskapsperiod, 3 kap. 1 § 1 mom. 3 punkten om begränsning av skyldigheten att upprätta finansieringsanalys och 3 mom. om begränsning av skyldigheten att upprätta verksamhetsberättelse, 1 a § om verksamhetsberättelsens innehåll och 6 § om tiden för upprättande av bokslut, 4 kap. 1 § om definitionen på omsättning, 3 § om definitionen på bestående och rörliga aktiva och 4 § om definitionen på omsättnings- och finansieringstillgångar samt 5 kap. 2 § om hur fordringar, finansiella tillgångar och skulder tas upp i balansräkningen, 2 a § om upptagande av finansiella instrument till verkligt värde samt om fonden för verkligt värde, 4 § om redovisning av inkomst som intäkt enligt tillverkningsgrad och 6 § om periodisering av anskaffningsutgiften för omsättningstillgångar. Därvid ska inte heller tillämpas vad som i 8 kap. 1 § 1 mom., 3 och 4 §, 5 § 3 mom. 2 punkten och 6 § i aktiebolagslagen föreskrivs om eget kapital, bokslut, verksamhetsberättelse och koncern eller i 8 kap. 1 § 1 mom., 3 och 4 §, 5 § 3 mom. 3 punkten och 6 § i lagen om andelslag föreskrivs om eget kapital, bokslut, verksamhetsberättelse och koncern. 
Vid upprättande av koncernbokslut för kreditinstitut tillämpas inte bokföringslagens 6 kap. 1 § 3—6 mom. om undantag från skyldigheten att upprätta koncernbokslut och 2 § 3 mom. om verksamhetsberättelse för koncerner och inte heller 8 kap. 9 § 1 mom. i aktiebolagslagen samt 8 kap. 9 § 1 mom. i lagen om andelslag. 
2 § 
Närmare bestämmelser, föreskrifter, anvisningar, yttranden och undantag. 
Genom förordning av finansministeriet utfärdas närmare bestämmelser om hur finansiella instrument och förvaltningsfastigheter samt förändringar i deras värden ska upptas i bokslutet, om balans- och resultaträkningens uppställningsformer och om finansieringsanalys, om upplysningar som ska ges i noterna till balans- och resultaträkningen och finansieringsanalysen samt i verksamhetsberättelsen, om koncernbalans- och koncernresultaträkningens uppställningsformer och koncernens finansieringsanalys, om upplysningar som ska ges i noterna till koncernbalans- och koncernresultaträkningen samt till koncernens finansieringsanalys samt om specifikationer till balansräkningen och noterna. Genom förordning av finansministeriet kan dessutom föreskrivas om undantag från de internationella redovisningsstandarderna om hur finansiella instrument och förvaltningsfastigheter samt förändringar i deras värden ska upptas i bokslutet och om på tillämpningen av standarderna baserade tilläggskrav i fråga om vad som ska framgå av bokslutet eller verksamhetsberättelsen. 
Finansinspektionen får meddela närmare föreskrifter om hur bokslut för kreditinstitut ska upprättas. Finansinspektionen kan genom sina föreskrifter begränsa upptagandet av noter som enligt de i 7 kap. 1 § i bokföringslagen avsedda internationella redovisningstandarderna ska anges samt rätten att som räkenskapsperiodens intäkter bokföra ränte- och hyresinkomster som grundar sig på sådana fordringar eller finansiella leasingavtal, vilkas till betalning förfallna räntor, amorteringar eller hyror vid bokslutstidpunkten har varit obetalda en längre tid än den som nämns i Finansinspektionens föreskrifter eller som till följd av gäldenärens konstaterade fallissemang sannolikt inte kommer att betalas. Finansinspektionen ska innan den meddelar dessa föreskrifter begära yttrande från finansministeriet och bokföringsnämnden. 
Om Finansinspektionens anvisningar eller yttranden om hur de i detta kapitel, i aktiebolagslagen, i lagen om andelslag och i bokföringslagen ingående bokslutsbestämmelserna samt om hur de förordningar som utfärdats med stöd av dem ska tillämpas på kreditinstitut är viktiga för den allmänna tillämpningen av bokföringslagen, bokföringsförordningen, aktiebolagslagen eller lagen om andelslag, ska Finansinspektionen begära yttrande från bokföringsnämnden innan den ger en anvisning eller yttrar sig. 
Finansinspektionen kan på ansökan av ett kreditinstitut av särskilda skäl för viss tid bevilja undantag från de internationella redovisningsstandarderna, från tiden för upprättande av bokslut, från räkenskapsperioden för ett inhemskt dotterföretag som ingår i ett sammanställt koncernbokslut och från upptagande i koncernbokslutet av tillgångar som är föremål för leasingavtal enligt 10 § 2 mom. i detta kapitel. En förutsättning för sådana undantag är att de inte står i strid med Europeiska unionens rättsakter om kreditinstitut. 
6 § 
Upptagande av finansiella instrument till verkligt värde samt fonden för verkligt värde 
Derivatinstrument och andra finansiella instrument ska tas upp i bokslutet till sitt verkliga värde. När de tas upp och presenteras i bokslutet ska de internationella redovisningsstandarderma iakttas. 
Förändringar i finansiella instruments verkliga värde ska tas upp i fonden för verkligt värde, då en internationell redovisningsstandard som avses i 1 mom. förutsätter att de tas upp i det egna kapitalet. 
Fonden för verkligt värde ska justeras när ett finansiellt instrument avyttras eller förfaller eller annars enligt en standard som avses i 1 mom. är föremål för nedskrivning via resultaträkningen. 
Om de internationella redovisningsstandarder som avses i 1 mom. inte förutsätter att motsvarande omständigheter tas upp i noterna ska av verksamhetsberättelsen, i fråga om finansiella instrument som tagits upp till verkligt värde, framgå  
1) företagets mål och policy för hantering av finansiella risker, inklusive dess säkringspolicy för varje viktig typ av planerad transaktion där säkringsredovisning används, och 
2) marknads-, kredit-, likviditets- och kassaflödesrisker. 
I moderföretagets verksamhetsberättelse ska tas upp information som avses i 4 mom. också om koncernen. 
8 § 
Upptagande av förvaltningsfastigheter till verkligt värde 
Förvaltningsfastigheter får tas upp till verkligt värde. När sådana fastigheter tas upp och presenteras i bokslutet ska de internationella redovisningsstandarderna samt bestämmelserna i 6 § 2—4 mom. om fonden för verkligt värde iaktas. 
10 § 
Koncernbokslut 
Ett kreditinstitut är skyldigt att upprätta koncernbokslut om det är moderföretag i en koncern eller ett sådant moderföretag som avses i artikel 4.15 i EU:s tillsynsförordning och är föremål för gruppbaserad tillsyn enligt den nämnda förordningen. 
Om kreditinstitutet har slutit ett leasingavtal enligt vilket riskerna och förmånerna i anslutning till de tillgångar som avtalet avser till väsentliga delar övergår på leasingtagaren i början av leasingperioden, får leasinggivaren ta upp tillgången i sitt koncernbokslut som om den vore såld, och leasingtagaren som om den vore köpt. När tillgångarna tas upp och presenteras i bokslutet ska de internationella redovisningsstandarderna iakttas. 
Koncernens finansieringsanalys ska ingå i koncernbokslutet, och i den ska utredas anskaffningen och användningen av medel under räkenskapsperioden. Dessutom ska i moderbolagets verksamhetsberättelse tas in information om koncernens verksamhet och kapitaltäckning. 
Koncernens dotter- eller ägarintresseföretag vars balansomslutning utgör mindre än en procent av moderföretagets senast fastställda balansomslutning och understiger 10 miljoner euro, får lämnas utanför det sammanställda koncernbokslutet. Om dotter- eller intresseföretagets balansomslutning sammanräknad med balansomslutningen för koncernens övriga dotter- och ägarintresseföretag utgör minst fem procent av koncernens balansomslutning, ska den ändå sammanställas med koncernbokslutet. 
Om ett försäkringsbolag eller ett därmed jämförbart utländskt försäkringsföretag hör till ett kreditinstituts eller holdingföretags koncern, får koncernbokslutet trots detta kapitel upprättas i enlighet med 3 kap. i lagen om tillsyn över finans- och försäkringskonglomerat, om det behövs för att ge en rättvisande bild av resultatet av koncernens verksamhet och finansiella ställning. 
Denna lag träder i kraft den 20 . 
6. 
Lag 
om ändring av 10 § i sparbankslagen 
I enlighet med riksdagens beslut 
ändras 10 § i sparbankslagen (1502/2001) som följer: 
10 § 
Sparbankens bundna egna kapital består av grundkapitalet, reservfonden, fonden för verkligt värde samt av en eventuell uppskrivningsfond och grundfond. Övriga fonder samt räkenskapsperiodens och föregående räkenskapsperioders vinst hänförs till det fria egna kapitalet.  
Denna lag träder i kraft den 20 . 
Helsingfors den 22 oktober 2015 
Statsminister
Juha
Sipilä
Justitie- och arbetsminister
Jari
Lindström
Förordningsutkast
Statsrådets förordning 
om ändring av bokförningsförordning 
I enlighet med statsrådets beslut 
upphävs i bokföringsförordningen (1339/1997) 1 kap. 1 § 3 och 4 mom., 2 § 3 och 4 mom., 5 §, 6 § 4 mom., 7 §, 10 § 1 och 2 mom. och 11 § 3 mom., 2 kap. 2 § 1 mom. 1 och 7 punkt och 2 – 4 mom., 3 § 5 och 6 punkt och 2 och 3 mom., 4 § 1 mom. 8 – 10 och 12 punkt och 5 och 6 mom., 5 § 1 mom. 5 punkt och 4 och 5 mom., 6 § 1 mom. 2 och 3 punkt och 2 mom., 7a § 2 mom., 7b § 3 mom.,  8 § 5 mom. och 11 §, 3 kap.1 § 2 mom. och 2 § 5 mom., 4 kap.3 § 1 mom. 5 punkt och 4 § 1 mom. 6 punkt, 5 kap. 2 – 4 §, sådana som de lyder i 1 kap.1 §:n 4 mom. och 2 §:n 4 mom. i förordningen 1313/2004, 7 § delvis i i förordningen 1313/2004 och 11 §:n 3 mom. i förordningen 748/2001, 2 kap.2 §:n 1 mom. 7 punkt i förordningen 748/2001, 2 och 4 mom. i förordningen 1313/2004, 4 §:n 6 mom. och 5 §:n 5 mom. i förordningen 748/2001, 7a §:n 2 mom. och 7b §:n 3 mom. i förordningen 547/2008 och 11 § i förordningen 748/2001 och 3 kap.2 §:n 5 mom. i förordningen 748/2001,  
ändras 1 kap.1 § 1 mom., 2 § 1 mom., 3 §, 4 § 1 mom., 6 § 1 mom., 9 §, 10 § 3 och 4 mom. och 11 § 1 mom., 2 kap.2 § rubrik, 3 § 1 mom. 1, 2 och 4 punkt, 4 § 1 mom. 3 – 5 punkt och 2 mom. 5 och 6 punkt, 5 § 1 mom. 4 punkt, 7 § 1 och inledningen i 2 mom. och 2 mom. 1 och 2 punkt, 8 § 1 mom. 1 punkt och inledningen i 2 mom. och 4 mom., 9 § 3 mom., 10 § 2 mom., 4 kap.1 §, 2 § inledningen i 1 mom. och 8 och 9 punkt, 3 § 1 mom. inledningen och 1, 2, 4, 6 och 7 punkt och 2 mom., 4 § 1 mom. inledningen och 5 punkt, inledningen i 5 kap. kap. , 5a kap.1 §, sådana som de lyder1 kap.6 § 1 mom. samt 2 kap.4 § 4 punkt och 8 § 4 mom. i förordningen 1313/2004, 4 kap.1 § i förordningen 748/2001, 3 § 1 mom. 2 och 4 punkt i förordningen 1313/2005 och 7 punkt i förordningen 748/2001 och 5a kap.1a § i förordningen 736/2001, samt  
fogas till 2 kap.1 § 1 mom. en ny 5a och 5b punkt, i kapitlet en ny 2a §, 3 § 1 mom. en ny 3a och 7 punkt, 4 § 1 mom. en ny 5a punkt, 2 mom. en ny7 punkt, 4 § en ny 7 mom.,  5 § en ny 1b, 1c och 3a punkt, en ny 5a §, 7 § 2 mom. en ny 4a punkt, 7b § en ny 4 mom., 4 kap. 2 § 1 mom. en ny 5a och 10 punkt. 
1 kap. 
Resultaträknings- och balansräkningsscheman 
1 § 
Resultaträkning enligt kostnadsslag 
Resultaträkningen ska upprättas enligt följande schema, om inte annat bestäms nedan: 
11. VINST (FÖRLUST) FÖRE BOKSLUTSDISPOSITIONER OCH SKATTER 
12. Bokslutsdispositioner
a) Förändring av avskrivningsdifferens
b) Förändring av skattemässiga reserver
c) Koncernbidrag
 
13. Inkomstskatt 
14. Övriga direkta skatter 
15. RÄKENSKAPSPERIODENS VINST (FÖRLUST) 
2 § 
Resultaträkning enligt funktion 
Resultaträkningen får upprättas enligt följande schema i stället för det som bestäms i 1 § 1 mom., om inte annat bestäms nedan: 
10. VINST (FÖRLUST) FÖRE BOKSLUTSDISPOSITIONER OCH SKATTER 
11. Bokslutsdispositioner
a) Förändring av avskrivningsdifferens
b) Förändring av skattemässiga reserver
c) Koncernbidrag
 
12. Inkomstskatt 
13. Övriga direkta skatter 
14. RÄKENSKAPSPERIODENS VINST (FÖRLUST) 
3 § 
Resultaträkning för ideella sammanslutningar och stiftelser 
Resultaträkningen för ideella sammanslutningar och stiftelser ska upprättas enligt följande schema: 
10. Allmänna understöd 
11. Räkenskapsperiodens resultat 
12. Bokslutsdispositioner
a) Förändring av avskrivningsdifferens
b) Förändring av skattemässiga reserver
c) Koncernbidrag
 
13. Räkenskapsperiodens överskott (underskott) 
Med ordinarie verksamhet enligt 1 mom. avses verksamhet för uppnående av det syfte som nämns i stadgarna. 
De intäkter och kostnader i varje grupp som hänför sig till ordinarie verksamhet, tillförda medel samt investerings- och finansieringsverksamhet får specificeras i en not i stället för i resultaträkningen. Om det behövs för att ge en rättvisande bild ska intäkterna av och kostnaderna för den ordinarie verksamheten dessutom i resultaträkningen eller i en not specificeras enligt verksamhetsområde. I fråga om rörelsen behöver i resultaträkningen inte anges annat än de sammanlagda beloppen av intäkter och kostnader, förutsatt att en särskild resultaträkning över rörelsen tas upp i noterna.  
Om det behövs för att ge en rättvisande bild får ideella sammanslutningar och stiftelser upprätta sin resultaträkning enligt schemat i 4 §, då verksamheten huvudsakligen består av besittning av fastighet. Då ska i noterna specificeras intäkter och kostnader som hänför sig till följande grupper: 
1) ordinarie verksamhet, 
2) tillförda medel, 
3) investerings- och finansieringsverksamhet, samt 
4) allmänna understöd. 
Trots vad som föreskrivs ovan i denna paragraf får ideella sammanslutningar och stiftelser upprätta sin resultaträkning enligt kostnadsslag som föreskrivs i 1 § eller enligt funktion som föreskrivs i 2 §, förutsatt att noterna innehåller de uppgifter som förutsätts ovan i 4 mom. 
4 § 
Resultaträkning för fastighet 
Resultaträkningen för verksamhet som baserar sig på besittning av fastighet i andra företag än de som avses i 3 kap. 9 § 1 mom. 1–3 punkten bokföringslagen upprättas enligt följande schema i stället för det som bestäms i 1 § 1 mom.: 
4. FASTIGHETSBIDRAG 
7. VINST (FÖRLUST) FÖRE BOKSLUTSDISPOSITIONER OCH SKATTER 
8. Bokslutsdispositioner
a) Förändring av avskrivningsdifferens
b) Förändring av skattemässiga reserver
c) Koncernbidrag
 
9. Direkta skatter 
10. RÄKENSKAPSPERIODENS VINST (FÖRLUST)/ÖVERSKOTT (UNDERSKOTT) 
6 § 
Balansräkning 
Balansräkningen uppgörs enligt följande schema: 
IV Övriga fonder 
1. Fond för inbetalt fritt eget kapital 
2. Reservfond 
3. Fonder enligt bolagsordningen eller stadgarna 
4. Fond för verkligt värde 
5. Övriga fonder 
V Balanserad vinst (förlust) från tidigare räkenskapsperioder 
VI Räkenskapsperiodens vinst (förlust) 
B ACKUMULERADE BOKSLUTSDISPOSITIONER 
1. Avskrivningsdifferens 
2. Skattemässiga reserver 
D FRÄMMANDE KAPITAL 
1. Masskuldebrevslån 
2. Lån mot konvertibla skuldebrev 
3. Skulder till kreditinstitut 
4. Återlåning från arbetspensionsförsäkringsanstalter 
5. Erhållna förskott 
6. Leverantörsskulder 
7. Finansieringsväxlar 
8. Skulder till företag inom samma koncern 
9. Skulder till ägarintresseföretag 
10. Övriga skulder 
11. Resultatregleringar 
Ideella sammanslutningar och stiftelser ska i sin balansräkning särskilt ta upp kapital vars användning har begränsats genom specialbestämmelser (bunden fond). I noterna ska anges användningen av de medel som utgör täckning för det bundna fondkapitalet samt fondens intäkter, kostnader, tillgångar och skulder och likaså uppgifter om fondens kapital och ändringar i det, om dessa uppgifter inte framgår av resultaträkningen eller balansräkningen. Motsvarande uppgifter ska lämnas också om transaktioner mellan en stiftelse och företag som hör till dess koncern respektive den bundna fonden. Om de bundna fonderna är flera till antalet får de uppgifter som avses ovan i detta moment, med undantag för fondernas kapitalbelopp, anges sammanställda på ett sådant sätt att de väsentliga omständigheterna framgår trots sammanställningen. 
8 § 
Kontinuitet i uppställningarna 
Resultaträkningarnas och balansräkningarnas uppställningsform får inte ändras, om det inte behövs för att enligt 3 kap. 2 § ge en rättvisande bild. 
9 § 
Mer detaljerad uppställning 
Resultaträkningen och balansräkningen får kompletteras med mellansummor och i dem får tas upp sådana nya poster som till innehållet inte kan hänföras till de benämningar som nämns i resultat- respektive balansräkningsscheman, om detta inte äventyrar en rättvisande bild enligt 3 kap. 2 § i bokföringslagen 
Resultaträkningen och balansräkningen ska upprättas mer detaljerat än vad schemat utvisar, om detta är nödvändigt för att de faktorer som inverkat på räkenskapsperiodens resultatbildning eller balansräkningsposterna ska kunna klargöras. 
10 § 
Sammanslagning av poster 
Om det för att ge en rättvisande bild inte är väsentligt att posterna anges separat får de i de resultaträkningsscheman som ingår i 1–5 § sammanslås, om sammanslagningen leder till ett tydligare framställningssätt. I en resultaträkning som upprättas enligt schemat i 1 eller 2 § ska dock anges omsättningen och räkenskapsperiodens vinst (förlust) samt de mellansummor som markerats med stora bokstäver i schemat. 
Om det för att ge en rättvisande bild inte är väsentligt att posterna anges separat får de poster som angetts med arabiska siffror i balansräkningsschemat enligt 6 §, med undantag av egna aktier eller andelar samt andelar i företag inom samma koncern, slås samman, om sammanslagningen leder till ett tydligare framställningssätt. 
11 § 
Tillämpning av andra benämningar och utelämnande 
Om det under en enskild benämning inte förekommer några siffror för denna och föregående räkenskapsperiod, ska benämningen inte anges i resultaträkningen eller balansräkningen. Dessutom får den bokföringsskyldiga avvika från siffer- och bokstavsbeteckningar på benämningarna i de scheman som ingår i 1–6 § eller ange benämningarna utan dessa beteckningar. 
2 kap. 
Finansieringsanalys och noter 
2 § 
Noter om presentation av bokslut 
Noterna ska innehålla 
5 a) uppgift om de poster till bruttobelopp som i resultaträkningen eller balansräkningen sammanställts enligt 1 kap. 10 §, om denna uppgift är väsentlig, 
5 b) uppgift om de poster som i resultaträkningen eller balansräkningen sammanställts enligt 1 kap. 11 §, om denna uppgift är väsentlig, 
2 a § 
Principerna för upprättande av bokslut 
Noterna ska innehålla uppgift om de värderingsprinciper och -metoder samt periodiseringsprinciper och -metoder som följts vid upprättandet av bokslutet. 
Information som avses i 1 mom. behöver dock inte ges om 
1) omsättningstillgångar, då tillgångarna används i samma ordning som de förvärvats, 
2) immateriella tillgångar som aktiverats i balansräkningen enligt 5 kap. 5 a § i bokföringslagen, om anskaffningsutgiften kostnadsförs på motsvarande sätt som vid beskattningen, 
3) utvecklingsutgifter, goodwill och andra utgifter med lång verkningstid, om de inte har aktiverats i enlighet med 5 kap. 8, 9 eller 11 § i bokföringslagen, 
4) prestationer som kräver en lång tillverkningstid, om de inkomster som de genererar, med avvikelse från 5 kap. 4 § i bokföringslagen ska bokföras enligt prestationsprincipen, 
5) finansiella instrument och förvaltningsfastigheter, då dessa ska värderas enligt 5 kap. 5 § i bokföringslagen, 
6) grunden för den kurs enligt vilken fordringar samt skulder och andra förbindelser i utländsk valuta omräknats till finsk valuta, om kursen på bokslutsdagen har tillämpats.  
I noter som avses ovan i 1 mom. behöver inte anges enskilda bokslutsbestämmelser, om den bokföringsskyldiga inte tillämpar internationella redovisningsstandarder enligt 7 a kap. i bokföringslagen. 
3 § 
Noter till resultaträkningen 
Noterna ska innehålla 
1) i stora företag och företag av allmänt intresse uppgift om fördelningen av omsättningen per bransch och geografiskt marknadsområde, om dessa branscher och marknader avsevärt skiljer sig från varandra i fråga om hur försäljningen av produkter och tjänster är organiserad, 
2) uppgift om exceptionella intäkts- och kostnadsposters belopp och innehåll, om posterna inte är oväsentliga,  
3) redogörelse för grunderna för avskrivningar enligt plan och ändringarna i dem, 
3 a) beloppet av nedskrivningar enligt 5 kap. 13 § i bokföringslagen, om de inte separat har tagits upp i resultaträkningen,  
4) redogörelse för ändringar i avsättningar, om ändringarna inte är oväsentliga,  
7) beloppet av finansiella kostnader som avses i 5 kap. 2 § 3 mom. i bokföringslagen, om det inte separat har tagits upp i resultaträkningen. 
4 § 
Noter till balansräkningens aktiva 
Noterna ska innehålla 
3) utredning om avskrivningstid och -metod för aktiverade utvecklingsutgifter, 
4) utredning om avskrivningstid och -metod för goodwill, 
5) uppgift om vid emission av lån uppkomna utgifter som inte har tagits upp som kostnad och kapitalrabatter, om de inte separat har tagits upp i balansräkningen bland övriga utgifter med lång verkningstid, 
5 a) utredning om värderings- och periodiseringsprinciperna gällande anskaffningsutgifterna för sådana i balansräkningen aktiverade immateriella rättigheter som avses i 5 kap. 5 a § och övriga utgifter med lång verkningstid som avses i 5 kap. 11 § i bokföringslagen, 
Utöver vad som bestäms i 1 mom., ska följande uppgifter om bestående aktiva, särskilt för anskaffningsutgiften och uppskrivningen, uppges per balanspost: 
5) räkenskapsperiodens avskrivningar enligt plan samt 
6) nedskrivningar och deras återföringar, samt 
7) räntor som under räkenskapsperioden i enlighet med 4 kap. 5 § 3 mom. i bokföringslagen hänförts till anskaffningsutgiften.  
I fråga om sådana finansiella instrument som har tagits upp bland bestående aktiva och vilka har tagits upp till ett högre värde än det verkliga värdet och i fråga om vilka ingen nedskrivning enligt 5 kap. 13 § i bokföringslagen har gjorts, ska i en not till bokslutet meddelas bokföringsvärdet och det verkliga värdet, antingen per finansiellt instrument eller grupperade på ett annat ändamålsenligt sätt samt en motiverad redogörelse för att det bokförda värdet kommer att uppnås igen och eventuella andra motiveringar för varför ingen nedskrivning har gjorts. 
5 § 
Noter till balansräkningens passiva 
Noterna ska innehålla 
1 a) avdrag av anskaffningsutgiften för egna aktier och rättelser av posterna i eget kapital, 
1 b) i sådana fall då den bokföringsskyldiga är ett aktiebolag eller andelslag, en beräkning av utdelningsbart kapital vari som en minskningspost har beaktats utvecklingsutgifter som aktiverats i enlighet med 5 kap. 8 § 3 mom. i bokföringslagen, 
1c) uppgifter om vilken andel av belopp som avses i 1 b punkten som innehavarna av kapitallån enligt 4 kap. 8 § i bokföringslagen är berättigade till, 
3) uppgifter om de centrala rättigheter som sammanhänger med finansiella instrument som den bokföringsskyldiga har emitterat och som berättigar till aktier eller någon annan andel av det egna kapitalet samt om antal sådana instrument av varje slag, 
3 a) uppgifter om de centrala villkoren för och det sammanlagda beloppet av masskuldebrevslån som den bokföringsskyldiga emitterat, 
4) uppgifter om de poster som ingår i resultatregleringarna, om de inte är oväsentliga, 
5 a § 
Verkligt värde i noterna 
Om den bokföringsskyldiga i enlighet med 5 kap. 2 a och 2 b § i bokföringslagen har värderat finansiella instrument eller andra tillgångar som avses i de nämnda paragraferna, ska i noterna anges 
1) de viktigaste bakomliggande antagandena för värderingsmodellerna och -metoderna, 
2) det sammanlagda verkliga värdet för varje kategori av finansiella instrument eller andra tillgångar, 
3) de förändringar av värdet på kategorier som avses i 2 punkten som redovisas i resultaträkningen och i fonden för verkligt värde, 
4) för varje kategori av derivatinstrument, upplysningar om i vilken omfattning de används, 
5) typen av kategorier som avses i 4 punkten, inklusive viktiga villkor som kan påverka belopp, tidpunkt och säkerhet vad gäller framtida kassaflöden, samt 
6) förändringar i fonden för verkligt värde under räkenskapsperioden. 
Om derivatinstrumenten inte i enlighet med 5 kap. 2 a § i bokföringslagen har värderats till verkligt värde, är det i fråga om varje kategori av instrument nödvändigt att i bokslutsnoterna ange instrumentens verkliga värde, om detta kan fastställas på ett tillförlitligt sätt, samt uppgifter om omfattningen och arten av deras användning. Det verkliga värdet ska baseras på marknadsvärdet i fråga om derivatinstrument för vilka en tillförlitlig marknad med lätthet kan bestämmas. Om marknadsvärdet inte med lätthet kan bestämmas för ett instrument men däremot för dess beståndsdelar eller för ett liknande instrument, får det verkliga värdet härledas från värdet på beståndsdelarna eller på liknande instrument. 
7 § 
Säkerheter, ansvarsförbindelser och arrangemang som inte har tagits med i balansräkningen  
Noterna ska innehålla följande uppgifter om panter och andra sakrättsliga säkerheter som ställts av den bokföringsskyldiga. 
Om en ansvarsförbindelse eller ett annat åtagande inte har tagits upp i balansräkningen så som avses i 5 kap. 14 § i bokföringslagen eller på något annat sätt, ska i noterna anges  
1) den bokföringsskyldigas pensionsansvar, som inte har överförts till en pensionsanstalt, 
2) den bokföringsskyldigas leasing- och hyresansvar, 
4 a) den bokföringsskyldigas övriga åtaganden, 
Om riskerna eller fördelarna med arrangemang som avses i 2 mom. är väsentliga, och i den mån denna information kan anses vara nödvändig för bedömningen av den bokföringsskyldigas ekonomiska ställning ska i fråga om denna post anges 
1) dess kommersiella syfte, samt 
2) en bedömning av dess ekonomiska inverkan på den bokföringsskyldiga. 
De i 2 mom. nämnda poster som hänför sig till följande räkenskapsperiod, ska anges som en summa. 
Vid värdering av säkerheter som avses i 1 mom. ska iakttas vad som i 5 kap. 2 § 1 mom. 3 punkten i bokföringslagen föreskrivs om upptagande av skulder i balandsräkningen. 
7 b § 
Transaktioner med närstående parter 
Noterna ska innehålla uppgift om den bokföringsskyldiges transaktioner med närstående parter, om transaktionerna är väsentliga och inte har genomförts under normala marknadsvillkor. Uppgifter om enskilda transaktioner får sammanföras med avseende på deras typ, med undantag för de fall där särskild information kan anses vara nödvändig för att bedöma vilken inverkan transaktioner med närstående part har på den bokföringsskyldigas ekonomiska ställning. I uppgifterna ska ingå 
1) en beskrivning av transaktionen, 
2) det totala beloppet för transaktionen, 
3) uppgift om typen av närstående partsförhållande samt 
4) annan information avseende transaktionerna som är nödvändig för att bedöma den bokföringsskyldigas ekonomiska ställning. 
Vid tillämpningen av denna paragraf har närstående part samma betydelse som i de internationella redovisningsstandarder som antagits i enlighet med IAS-förordningen som avses i 1 kap. 4 d § i bokföringslagen.  
Vad som föreskrivs i 1 mom. gäller inte transaktioner där part i transaktionen är ett dotterföretag som helt ägs av den bokföringsskyldiga eller av ett företag inom samma koncern.  
Trots vad som föreskrivs i 1 mom. ska i noterna om transaktioner som på sedvanliga villkor genomförts med en närstående part anges parterna och beloppen, ifall det är nödvändigt för att ge en rättvisande bild. 
9 § 
Innehav i andra företag 
Uppgifter som avses i 1 mom. behöver inte ges, om den bokföringsskyldiga eller det företag som är föremål för ägandet orsakas betydande olägenhet av att uppgifterna ges och grunderna för avvikelsen meddelas. 
10 § 
Noter angående en bokföringsskyldig som hör till en koncern 
Om man med stöd av 6 kap. 1 § 4 eller 5 mom. i bokföringslagen har låtit bli att upprätta koncernbokslut, ska detta samt namnet och hemorten för det företag i vars koncernbokslut moderföretagets och dotterföretagens bokslut tas in nämnas i en not till moderföretagets resultaträkning eller balansräkning. 
3 kap. 
Koncernresultaträkning och koncernbalansräkning 
2 § 
Redovisning av vissa poster i koncernresultaträkningen 
De poster som enligt 6 kap. 13 § bokföringslagen ska tas upp som intäkter eller kostnader, ska i koncernresultaträkningen redovisas sammanräknade i gruppen finansiella intäkter och kostnader med benämningen "Andel av intresseföretagens vinst (förlust)". Om postens särkaraktär kräver det, ska den dock tas upp antingen bland de intäkter och kostnader som redovisas före rörelsevinsten eller bland extraordinära intäkter och kostnader. 
4 kap. 
Noter till koncernbokslutet 
1 § 
Uppgifter som motsvarar ett enskilt företags noter 
I noterna till koncernbokslutet ska i tillämpliga delar anges de i 2 kap. 2–10 § avsedda uppgifterna om koncernen, med beaktande av att 
1) sådana transaktioner mellan koncernföretagen som elimineras när koncernbokslutet upprättas, inte ska tas med i utredning som avses i 2 kap. 7 b §, 
2) av de uppgifter som avses i 2 kap. 8 § 1 mom. separat ska anges det genomsnittliga sammanlagda antalet anställda i företag vilkas bokslut ska sammanställas med koncernbokslutet när det är fråga om samföretag som avses i 6 kap. 15 § i bokföringslagen. 
2 § 
Noter angående upprättande 
Noterna till koncernbokslutet ska innehålla 
5 a) uppgifter och motivering med tanke på situationer som avses i 6 kap. 5 § 2 mom. i bokföringslagen samt en redogörelse för väsentliga händelser efter dotterföretagets räkenskapsperiod, som behövs för att bilda sig en uppfattning om dotterbolagets ekonomiska ställning och resultat. 
8) grunden för den kurs enligt vilken ett utländskt dotterföretags eller intresseföretags bokslutsposter har omräknats till finsk valuta,  
9) en redogörelse för avskrivningstiden för koncerngoodwill som uppkommit i samband med upprättandet av koncernbokslut, samt  
10) väsentliga förändringar i koncerngoodwill jämfört med föregående räkenskapsperiod, specificerade enligt 2 kap. 4 § 2 mom. 
3 § 
Noter angående dotter- och intresseföretag 
Noterna till koncernbokslutet ska innehålla 
1) i fråga om ett dotterföretag som har sammanställts med koncernbokslutet, namn och hemort samt den sammanlagda ägarandel som koncernföretagen och de personer som handlar i eget namn men på koncernföretagens vägnar har i detta dotterföretag, och likaså en utredning om grunden för bestämmande inflytande enligt 1 kap. 5 § i bokföringslagen, om den inte är sådant ägande som enligt 1 mom. 1 punkten i den nämnda paragrafen medför röstmajoritet i ett företag där det inte finns skillnader i rösträtten mellan aktier eller andelar, 
2) de uppgifter som avses i 1 punkten om ett dotterföretag vars bokslut inte har sammanställts med koncernbokslutet samt om en sådan grund för att en sammanställning inte gjorts som avses i 6 kap. 3 § i bokföringslagen, 
4) de uppgifter som avses i 1 punkten i fråga om ett intresseföretag eller ett ägarintresseföretag vars bokslut inte har sammanställts med koncernbokslutet, grunden för att inte göra en sammanställning samt information om detta företags eget kapital och om räkenskapsperiodens vinst eller förlust i det senast upprättade bokslutet,  
6) sådana uppgifter som avses i 1 punkten om företag som i enlighet med 6 kap. 15 § i bokföringslagen har sammanställts med koncernbokslutet samt en redogörelse för vad det gemensamma inflytandet baserar sig på, samt 
7) i det fall att dotterföretaget i enlighet med 6 kap. 5 § 2 mom. i bokföringslagen har sammanställts med koncernbokslutet på basis av ett bokslut som har upprättats för en räkenskapsperiod som har gått ut vid en annan tidpunkt än moderföretagets räkenskapsperiod, redogörelse för väsentliga händelser som har påverkat dotterföretagets resultat och ekonomiska ställning och som har ägt rum under tiden mellan utgången av dotterföretagets och moderföretagets räkenskapsperioder. 
Om den bokföringsskyldiga inte tillämpar 6 kap. 7 § 6 mom. bokföringslagen, inräknas i det egna kapital som avses i 1 mom. 4 punkten även de ackumulerade bokslutsdispositionerna. Från detta belopp ska dessutom de latenta skatteskulderna dras av. 
4 § 
Övriga noter 
Utöver vad som bestäms i 1–3 § ska noterna till koncernbokslutet innehålla 
5) det ännu oavskrivna beloppet av koncernaktiva eller det ännu inte intäktsförda beloppet av koncernpassiva som beror på intresseföretag, samt 
5 a kap. 
Tillämpning av internationella redovisningsstandarder 
1 § 
Tillämpning av bokföringsförordningen på bokslut och koncernbokslut som upprättats i enlighet med de internationella redovisningsstandarderna 
På bokslut och koncernbokslut som upprättats i enlighet med de internationella redovisningsstandarder som avses i 7 a kap. 1 § i bokföringslagen ska bestämmelserna i denna förordning inte tillämpas, med undantag av  
1) 2 kap. 7 a §, 8 § 1 mom. 1 punkten och 2–4 mom., 9 § 1–3 mom., 10 § 1 mom., samt 
2) 4 kap. 1 §, 3 § 1 mom. 1–4 och 6 punkten och 4 § 6 punkten. 
6 kap. 
Ikraftträdande- och övergångsbestämmelser 
3 § 
Ikraftträdande av 2015 års ändringar 
Denna förordning träder i kraft den 2015. Förordningen ska första gången tillämpas den räkenskapsperiod som börjar den 1 januari 2016 eller därefter. De bokföringsskyldiga får dock tillämpa denna förordning till bokslut som upprättas efter att förordningen trätt i kraft. 
Förordningsutkast
Statrådets förordning 
om uppgifter som ska tas upp i små- och mikroföretags bokslut 
I enlighet med statsrådets beslut föreskrivs: 
1 kap. 
Allmänna bestämmelser 
1 § 
Tillämpningsområde samt bokslutsuppgifter som ska lämnas av små- och mikroföretag. 
I denna förordning föreskrivs om resultaträknings- och balansräkningsscheman för småföretag som avses i 1 kap. 4 a § i bokföringslagen och för mikroföretag som avses i 1 kap. 4 b § i samma lag samt om uppgifter som ska framgå av noterna. I bokföringsförordningen föreskrivs om resultaträknings- och balansräkningsscheman och noter för andra bokföringsskyldiga. 
I 3 kap. 1 § 2 mom. i bokföringslagen föreskrivs om sådana jämförelsetal för den närmast föregående räkenskapsperioden som ska anges också i fråga om små- och mikroföretags resultaträknings- och balansräkningsposter samt om rättelse av jämförelsetalen. 
Med de undantag som nämns i 3 kap. 1 § 3 mom. i bokföringslagen är småföretag och mikroföretag befriade från att upprätta verksamhetsberättelse enligt 1 a § i nämnda kapitel. 
I 3 kap. 7 § i bokföringslagen föreskrivs om datering och underskrift av bokslut. Om det inte framgår av noterna eller av bokslutet i övrigt ska i samband med underskrifterna 
1) lämnas uppgift om att bokslutet har upprättats i enlighet med denna förordnings bestämmelser om små- och mikroföretag, och 
2) informeras om förändringar i det egna kapitalet samt om styrelsens förslag till användning av utdelningsbart fritt eget kapital, om småföretaget är ett aktiebolag eller ett andelslag. 
3) 
2 § 
Bestämmelser i annan lagstiftning 
Utöver vad som föreskrivs i denna förordning är ett småföretag eller mikroföretag som är ett 
1) aktiebolag, 
2) öppet bolag eller kommanditbolag som har ett aktiebolag som ansvarig bolagsman, 
3) öppet bolag eller kommanditbolag som har ett bolag som avses i 2 punkten som ansvarig bolagsman 
inte skyldigt att i sitt bokslut lämna uppgifter enligt någon annan lag än en skattelag eller enligt en bestämmelse som utfärdats med stöd av den. 
Utöver vad som föreskrivs i denna förordning ska små- och mikroföretag som är andelslag i sitt bokslut lämna också uppgifter enligt lagen om andelslag och enligt andra lagar. 
Vad som föreskrivs i 2 mom. ska på motsvarande sätt tillämpas på små- och mikroföretag som är  
1) ett öppet bolag, 
2) ett kommanditbolag, 
3) en förening, 
4) en stiftelse, eller 
5) en annan sammanslutning än en sådan som avses i 1 mom. 
3 § 
Rättvisande bild av små- och mikroföretag 
Utöver vad som föreskrivs i detta kapitel och i 3 kap. ska ett småföretag enligt 3 kap. 2 § 3 mom. i bokföringslagen i noterna ange också andra omständigheter för att ge en rättvisande bild av företaget. Detta moment gäller också andra mikroföretag än sådana som avses i 2 § 1 mom. 
Bokslutet för ett mikroföretag som avses i 2 § 1 mom. uppfyller kravet på en rättvisande bild enligt 3 kap. 2 § 5 mom. i bokföringslagen om det innehåller de uppgifter som förutsätts i detta kapitel och i 4 kap. 
2 kap. 
Resultaträknings- och balansräkningsscheman för småföretag 
1 § 
Resultaträkningsscheman enligt kostnadsslag och funktion samt förkortad resultaträkning 
Resultaträkningen för ett småföretag ska upprättas enligt schemat för resultaträkning enligt kostnadsslag i denna förordnings bilaga I eller schemat för resultaträkning enligt funktion i bilaga II, om inte något annat föreskrivs nedan i 2 eller 3 §. 
Småföretag får dock sammanställa 1 - 5 punkten i bilaga I samt 1 - 3 och 6 punkten i bilaga II till posten Bruttoresultat. 
2 § 
Fastighetsschema 
Trots vad som föreskrivs i 1 § ska resultaträkning upprättas enligt fastighetsschemat i denna förordnings bilaga III om 
1) småföretaget inte är ett aktiebolag, öppet bolag eller kommanditbolag enligt 1 kap. 2 § 1 mom., och om 
2) småföretagets verksamhet är baserad på fastighetsförvaltning. 
Trots vad som föreskrivs i 1 mom. får bostadsaktiebolag upprätta sin resultaträkning enligt schemat för resultaträkning enligt kostnadsslag i bilaga I, om alla delägare har gett sitt samtycke till detta. 
Om de vederlag som tas ut kan specificeras som vederlag för skötsel samt vederlag för amorteringar och räntor, ska de sistnämnda redovisas under punkten övriga finansiella intäkter i bilaga III. 
3 § 
Förenings- och stiftelseschema 
Trots vad som föreskrivs i 1 och 2 § ska ett småföretag som är en ideell sammanslutning eller stiftelse upprätta sin resultaträkning enligt förenings- och stiftelseschemat i denna förordnings bilaga IV. 
Med ordinarie verksamhet enligt förenings- och stiftelseschemat avses verksamhet för uppnående av det syfte som nämns i stadgarna. 
De intäkter och kostnader i varje grupp som avses i bilaga IV och hänför sig till ordinarie verksamhet, tillförda medel samt investerings- och finansieringsverksamhet får specificeras i en not i stället för i resultaträkningen. Om det behövs för att ge en rättvisande bild ska intäkterna av och kostnaderna för den ordinarie verksamheten dessutom i resultaträkningen eller i en not specificeras enligt verksamhetsområde. I fråga om rörelsen behöver i resultaträkningen enligt bilaga IV inte anges annat än de sammanlagda beloppen av intäkter och kostnader, förutsatt att en särskild resultaträkning över rörelsen tas upp i noterna. 
Om det behövs för att ge en rättvisande bild får ideella sammanslutningar och stiftelser upprätta sin resultaträkning enligt fastighetsschemat i bilaga III, då verksamheten huvudsakligen består av fastighetsförvaltning. Då ska i noterna specificeras intäkter och kostnader som hänför sig till följande grupper: 
1) ordinarie verksamhet, 
2) tillförda medel, 
3) investerings- och finansieringsverksamhet, samt 
4) allmänna understöd. 
Trots vad som föreskrivs ovan i denna paragraf får ideella sammanslutningar och stiftelser upprätta sin resultaträkning enligt kostnadsslag som i bilaga I eller enligt funktion i bilaga II §, förutsatt att noterna innehåller de uppgifter som förutsätts ovan i 4 mom. 
4 § 
Balansräkningsschema för småföretag 
Balansräkningen för småföretag ska upprättas enligt schemat i denna förordnings bilaga V. 
Trots vad som föreskrivs i 1 mom. får aktivsidan i balansräkningen för ett småföretag upprättas så att  
1) immateriella tillgångar, materiella tillgångar och placeringar redovisas separat under bestående aktiva, 
2) omsättningstillångar, fordringar och finansiella värdepapper samt kassa och bank bokförs separat bland rörliga aktiva. 
Trots vad som föreskrivs i 1 mom. får passivsidan i balansräkningen för småföretag upprättas så att 
1) som eget kapital bokförs separat aktie-, andels- eller annat motsvarande kapital, överkursfond, uppskrivningsfond, övriga fonder, balanserad vinst (förlust) från tidigare räkenskapsperioder och räkenskapsperiodens vinst (förlust) samt kapitallån, 
2) ackumulerade bokslutsdispositioner, avsättningar sammanlagt och främmande kapital ska bokföras separat. 
Av fordringar som avses i 3 mom. 2 punkten ska separat anges beloppet av långfristiga fordringar och av främmande kapital som avses i 3 mom. 2 punkten ska anges beloppet av långfristiga skulder. 
Ideella sammanslutningar och stiftelser ska i sin balansräkning särskilt ta upp kapital vars användning har begränsats genom specialbestämmelser (bunden fond). I noterna ska anges användningen av de medel som utgör täckning för det bundna fondkapitalet samt fondens intäkter, kostnader, tillgångar och skulder och likaså uppgifter om fondens kapital och förändringar i det, om dessa uppgifter inte framgår av resultaträkningen eller balansräkningen. Motsvarande uppgifter ska lämnas också om transaktioner mellan en stiftelse och företag som hör till dess koncern respektive den bundna fonden. Om de bundna fonderna är flera till antalet får de uppgifter som avses ovan i detta moment, med undantag för fondernas kapitalbelopp, anges sammanställda på ett sådant sätt att de väsentliga omständigheterna framgår trots sammanställningen. 
Medel som ska förvaltas särskilt ska tas upp som en egen grupp i balansräkningen. 
5 § 
Kontinuitet i uppställningarna 
Resultaträkningarnas och balansräkningarnas uppställningsform får inte ändras utan särskilt skäl. 
6 § 
Mer detaljerad uppställning 
Resultaträkningen och balansräkningen får kompletteras med mellansummor och i dem får tas upp sådana nya poster som till innehållet inte kan hänföras till de benämningar som nämns i resultat- respektive balansräkningsscheman, om detta inte äventyrar en rättvisande bild enligt 3 kap. 2 § i bokföringslagen 
Resultaträkningen och balansräkningen ska upprättas mer detaljerat än vad schemat utvisar, om detta är nödvändigt för att de faktorer som inverkat på räkenskapsperiodens resultatbildning eller balansräkningsposterna ska kunna klargöras. 
7 § 
Sammanslagning av poster 
Om det för att ge en rättvisande bild inte är väsentligt att posterna anges separat får de i de resultaträkningsscheman som ingår i bilagorna I-IV sammanslås, om sammanslagningen leder till ett tydligare framställningssätt. I en resultaträkning som upprättas enligt schemat ska dock anges omsättningen och räkenskapsperiodens vinst (förlust) samt de mellansummor som markerats med stora bokstäver i schemat. 
Om det för att ge en rättvisande bild inte är väsentligt att posterna anges separat får de poster som angetts med arabiska siffror i balansräkningsschemat enligt bilaga V, med undantag av egna aktier eller andelar samt andelar i företag inom samma koncern, slås samman, om sammanslagningen leder till ett tydligare framställningssätt. 
8 § 
Tillämpning av andra benämningar och utelämnande 
Om arten av den bokföringsskyldigas verksamhet kräver det, ska i resultaträkningen och balansräkningen med avvikelse från bilagorna I-V i fråga om de poster som markerats med arabiska siffror användas benämningar som motsvarar verksamhetens art. 
Om det under en enskild benämning inte förekommer några siffror för denna och föregående räkenskapsperiod, ska benämningen inte anges i resultaträkningen eller balansräkningen. Dessutom får den bokföringsskyldiga avvika från siffer- och bokstavsbeteckningar på benämningarna i de scheman som ingår i bilagorna I-V eller ange benämningarna utan dessa beteckningar. 
3 kap. 
Småföretags noter 
1 § 
Principerna för upprättande av bokslut 
Noterna ska innehålla uppgift om de värderingsprinciper och -metoder samt periodiseringsprinciper och -metoder som följts vid upprättandet av bokslutet. 
Information som avses i 1 mom. behöver dock inte ges om 
1) omsättningstillgångar, då tillgångarna används i samma ordning som de förvärvats, 
2) immateriella tillgångar som aktiverats i balansräkningen enligt 5 kap. 5 a § i bokföringslagen, om anskaffningsutgiften kostnadsförs inom 10 år, 
3) utvecklingsutgifter, goodwill och andra utgifter med lång verkningstid, om de inte har aktiverats i enlighet med 5 kap. 8, 9 eller 11 § i bokföringslagen, 
4) prestationer som kräver en lång tillverkningstid, om de inkomster som de genererar, med avvikelse från 5 kap. 4 § i bokföringslagen ska bokföras enligt prestationsprincipen, 
5) finansiella instrument och förvaltningsfastigheter, då dessa ska värderas enligt 5 kap. 5 § i bokföringslagen, 
6) grunden för den kurs enligt vilken fordringar samt skulder och andra förbindelser i utländsk valuta omräknats till finsk valuta, om kursen på bokslutsdagen har tillämpats. 
Utöver vad som föreskrivs i 2 mom. behöver i fråga om tillgångar bland bestående aktiva inte anges uppgifter som avses i 1 mom., om 
1) i anskaffningsutgiften för tillgången har räknats in endast de rörliga utgifterna för anskaffningen och tillverkningen, 
2) avskrivningar enligt plan för maskiner och inventarier motsvarar de maximiavskrivningar som godkänns i beskattningen, 
3) uppskrivningar enligt 5 kap. 13 § i bokföringslagen inte har gjorts, 
4) erhållna understöd har bokförts som minskning av anskaffningsutgiften, 
5) anskaffningsutgifter för små anskaffningar och tillgångar vilkas sannolika ekonomiska livslängd är högst tre år, ska i sin helhet kostnadsföras på den räkenskapsperiod då anskaffningen gjorts, 
6) det bokföringssätt som avses i 5 kap. 5 b § i bokföringslagen inte har tillämpats på anskaffningar enligt nämnda paragraf. 
I noter som avses ovan i 1 mom. behöver inte anges enskilda bokslutsbestämmelser, om småföretaget inte tillämpar internationella redovisningsstandarder enligt 7 a kap. i bokföringslagen. 
2 § 
Exceptionella poster 
Noterna ska innehålla uppgift om exceptionella intäkts- och kostnadsposters belopp och innehåll, om posterna inte är oväsentliga. 
3 § 
Väsentliga händelser efter räkenskapsperioden 
I noterna ska innehålla uppgifter om sådana väsentliga händelser som skett efter räkenskapsperioden och som annars inte framgår av bokslutet. Dessutom ska en uppskattning av sådana händelsers ekonomiska betydelse läggas fram. 
4 § 
Uppskrivningsfond 
Om ett småföretag på det sätt som föreskrivs i 5 kap. 17 § i bokföringslagen har gjort en uppskrivning av den oavskrivna anskaffningsutgiften för en tillgång som hör till bestående aktiva ska i noterna 
1) anges förändringarna i uppskrivningsfonden under räkenskapsperioden, 
2) tas in en utredning om skattekonsekvenserna av förändringarna i uppskrivningsfonden, 
3) anges de uppskrivna tillgångarnas sammanlagda bokföringsvärde före uppskrivningen. 
5 § 
Verkligt värde i noterna 
Om ett småföretag i enlighet med 5 kap. 2 a eller 2 b § i bokföringslagen har värderat finansiella instrument eller andra tillgångar som avses i de nämnda paragraferna, ska i noterna anges 
1) de viktigaste bakomliggande antagandena för värderingsmodellerna och -metoderna, 
2) det sammanlagda verkliga värdet för varje kategori av finansiella instrument eller andra tillgångar, 
3) de förändringar av värdet på kategorier som avses i 2 punkten och som redovisas i resultaträkningen och i fonden för verkligt värde, 
4) för varje kategori av derivatinstrument, upplysningar om i vilken omfattning de används, 
5) typen av kategorier som avses i 4 punkten, inklusive viktiga villkor som kan påverka belopp, tidpunkt och säkerhet vad gäller framtida kassaflöden, samt 
6) förändringar i fonden för verkligt värde under räkenskapsperioden. 
Om derivatinstrumenten inte i enlighet med 5 kap. 2 a § i bokföringslagen har värderats till verkligt värde, är det i fråga om varje kategori av instrument nödvändigt att i bokslutsnoterna ange instrumentens verkliga värde, om detta kan fastställas på ett tillförlitligt sätt, samt uppgifter om omfattningen och arten av deras användning. Det verkliga värdet ska baseras på marknadsvärdet i fråga om derivatinstrument för vilka en tillförlitlig marknad med lätthet kan bestämmas. Om marknadsvärdet inte med lätthet kan bestämmas för ett instrument men däremot för dess beståndsdelar eller för ett liknande instrument, får det verkliga värdet härledas från värdet på beståndsdelarna eller på liknande instrument. 
6 § 
Långfristiga lån 
I noterna ska anges det sammanlagda beloppet av sådana till långfristigt främmande kapital hörande skulder som förfaller senare än efter fem år.  
7 § 
Säkerheter, ansvarsförbindelser och arrangemang som inte har tagits med i balansräkningen samt pensionsansvar 
Noterna ska innehålla uppgifter om 
1) sakrättsliga säkerheter som ett målföretag har ställt av sina tillgångar, specificerade som handfången pant, fordonsinteckningar, företagsinteckningar, fastighetsinteckningar och eventuella andra slag av realsäkerhet, 
2) det sammanlagda beloppet av ekonomiska åtaganden utanför balansräkningen, 
3) uppgifter om karaktären av och det kommersiella syftet med arrangemang utanför balansräkningen, om arrangemangen är förenade med väsentliga risker och fördelar och om informationen om dem är nödvändig för bedömningen av småföretagets ekonomiska ställning, och om 
4) småföretagets pensionsansvar, som inte har överförts på en pensionsanstalt. 
Från säkerheter som avses i 1 mom. 1 punkten ska särskiljas de som småföretaget har ställt 
1) för företag som hör till samma koncern som småföretaget, och 
2) för sina intresseföretag. 
En sådan säkerhet som avses i 1 mom. 1 punkten ska anges högst till beloppet av den skuld eller något annat åtagande som den ställts för. Om säkerhetens värde är mindre än skulden eller åtagandet ska säkerheten specificeras till detta mindre värde. Vid värderingen av säkerheten ska iakttas vad som i 5 kap. 2 § 1 mom. 3 punkten i bokföringslagen föreskrivs om redovisning av skulder i balansräkningen. 
8 § 
Uppgifter om moderföretaget 
I noterna ska som moderföretagets namn och hemort anges uppgifterna om den koncern som upprättar koncernbokslutet och som småföretaget närmast hör till. 
9 § 
Lån till verkställande direktören och personer inom administrationen samt åtaganden till förmån för dem 
I fråga om verkställande direktören, medlemmarna och suppleanterna i styrelsen samt i fråga om personer tillhörande motsvarande förvaltningsorgan ska per förvaltningsorgan i noterna anges  
1) det sammanlagda beloppet av penninglån som beviljats dem, minskningen och ökningen av beloppet under räkenskapsperioden samt de huvudsakliga räntevillkoren och övriga villkor för lånen, 
2) det sammanlagda beloppet av säkerheter och ansvarsförbindelser som gäller dem och det huvudsakliga innehållet, samt 
3) pensionsförbindelserna för dessa uppdrag. 
10 § 
Transaktioner med intressenter 
Noterna ska innehålla uppgift om småföretagets transaktioner med intressenter, om transaktionerna är väsentliga och inte har genomförts under normala marknadsvillkor. 
Uppgifter om enskilda transaktioner som avses i 1 mom. får sammanföras med avseende på deras typ, med undantag för de fall där särskild information kan anses vara nödvändig för att bedöma vilken inverkan transaktionerna har på småföretagets ekonomiska ställning. 
I uppgifterna om en transaktion med en intressent ska ingå 
1) en beskrivning av transaktionen, 
2) värdet av transaktionen, 
3) uppgift om typen av intressentförhållande samt 
4) annan information avseende transaktionerna som är nödvändig för att bedöma småföretagets ekonomiska ställning. 
Med intressent avses vid tillämpningen av denna paragraf en juridisk person som i förhållande till småföretaget 
1) har bestämmande inflytande, eller 
2) är ett intresseföretag. 
Utöver vad som föreskrivs i 4 mom. räknas följande personer som intressenter: 
1) verkställande direktören, 
2) medlemmarna och suppleanterna i styrelsen, samt 
3) personer som hör till motsvarande organ som de som nämns i 1 och 2 punkten. 
Trots vad som föreskrivs i 1 mom. ska i noterna anges sådana transaktioner som på sedvanliga villkor genomförts med intressenter samt parterna i och värdet av transaktionerna, om dessa uppgifter behövs för att ge en rättvisande bild. 
11 § 
Personal 
I noterna ska anges det genomsnittliga antalet anställda under räkenskapsperioden. 
12 § 
Förvärv och överlåtelse av egna aktier och andelar 
I noterna ska anges 
1) grunderna för under räkenskapsperioden gjorda förvärv av sådana andelar i eget kapital som motsvarar egna aktier eller andelar (egna andelar), 
2) antal och nominellt belopp för egna andelar som förvärvats eller avyttrats under räkenskapsperioden eller, om andelarna inte har något nominellt belopp, det bokföringsmässiga motvärdet samt den relativa andel som de utgör av det tecknade kapitalet. 
13 § 
Uppgifter som motsvarar verksamhetsberättelsen 
Ett småföretag är inte skyldigt att upprätta verksamhetsberättelse enligt 3 kap. 1 a § i bokföringslagen. Om sådan information som avses i den nämnda paragrafen behövs för att ge en rättvisande bild av småföretaget, ska den dock lämnas i noterna. 
4 kap. 
Mikroföretags resultaträkning och balansräkning samt noter 
1 § 
Resultaträkningsscheman och förkortad resultaträkning för mikroföretag 
Resultaträkningen för ett mikroföretag ska upprättas i enlighet med 2 kap. 1 § 1 mom. samt 2 och 3 §.  
Mikroföretaget får dock 
1) ta upp punkterna 1 - 5 i bilaga I eller punkterna 1 - 3 och 6 i bilaga II som en sammanslagen post under Bruttoresultat, och 
2) utelämna de underpunkter som angivits med bokstäver i de nämnda bilagorna I och II. 
2 § 
Mikroföretags balansräkning 
Balansräkningen för ett mikroföretag ska upprättas i enlighet med 2 kap. 4 §. 
Trots vad som föreskrivs i 1 mom. får balansräkningen för ett mikroföretag upprättas så att  
1) bland bestående aktiva på aktivsidan separat tas upp immateriella tillgångar, materiella tillgångar och placeringar, samt bland rörliga aktiva separat tas upp omsättningstillgångar, fordringar, finansiella värdepapper samt kassa och bank, och 
2) på passivsidan separat tas upp eget kapital, ackumulerade bokslutsdispositioner, avsättningar och främmande kapital. 
I det egna kapitalet enligt 1 mom. 2 punkten ska separat tas upp poster som enligt lagen om mikroföretag hör till det egna kapitalet samt balanserad vinst (förlust) från tidigare räkenskapsperioder och räkenskapsperiodens vinst (förlust). I det främmande kapitalet ska separat tas upp beloppet av kortfristiga skulder. 
3 § 
Kontinuitet i uppställningarna samt avvikelse från schema  
Vad som i 2 kap. 5 § föreskrivs om kontinuitet i uppställningarna samt i 6 - 8 § i samma kapitel om en mer detaljerad uppställning och sammanslagning av poster samt om ändring och utelämnande av benämningar på poster, ska tillämpas också på mikroföretags resultaträkning och balansräkning. 
4 § 
Mikroföretags noter 
Vad som ovan i 3 kap. föreskrivs om småföretags noter ska tillämpas också på mikroföretag, med undantag för sådan information om värdering till verkligt värde enligt 5 § som avses i 5 kap. 2 a och 2 b § i bokföringslagen.  
Ett mikroföretag är inte skyldigt att upprätta verksamhetsberättelse enligt 3 kap. 1 a § i bokföringslagen. Mikroföretaget kan dock i noterna redovisa den information som avses i nämnda paragraf. 
5 kap. 
Övriga bestämmelser 
1 § 
Ikraftträdande 
Denna förordning träder i kraft den 2015. Förordningen ska första gången tillämpas den räkenskapsperiod som börjar den 1 januari 2016 eller därefter. De bokföringsskyldiga får dock tillämpa denna förordning till bokslut som upprättas efter att förordningen trätt i kraft. 
BILAGA I 
SMÅFÖRETAGS RESULTATRÄKNING ENLIGT KOSTNADSSLAG 
Sådan resultaträkning enligt kostnadsslag som avses ovan i 2 kap. 1 § 1 mom. ska upprättas som följer: 
1. OMSÄTTNING 
2. Förändring av lager av färdiga varor och varor under tillverkning 
3. Tillverkning för eget bruk 
4. Övriga rörelseintäkter 
5. Material och tjänster 
a) Material, förnödenheter och varor 
aa) Inköp under räkenskapsperioden 
ab) Förändring av lager 
b) Köpta tjänster 
6. Personalkostnader 
a) Löner och arvoden 
b) Lönebikostnader 
ba) Pensionskostnader 
bb) Övriga lönebikostnader 
7. Avskrivningar och nedskrivningar 
a) Avskrivningar enligt plan 
b) Nedskrivningar av tillgångar bland bestående aktiva 
c) Exceptionella nedskrivningar av rörliga aktiva 
8. Övriga rörelsekostnader 
9. RÖRELSEVINST (-FÖRLUST) 
10. Finansiella intäkter och kostnader 
a) Intäkter från andelar i företag inom samma koncern 
b) Intäkter från andelar i ägarintresseföretag 
c) Intäkter från övriga placeringar bland bestående aktiva, separat intäkter från företag inom samma koncern 
d) Övriga ränteintäkter och finansiella intäkter, separat intäkter från företag inom samma koncern 
e) Nedskrivningar av placeringar bland bestående aktiva 
f) Nedskrivningar av finansiella värdepapper bland rörliga aktiva 
g) Räntekostnader och övriga finansiella kostnader, separat kostnader till företag inom samma koncern 
11. VINST (FÖRLUST) FÖRE BOKSLUTSDISPOSITIONER OCH SKATTER 
12. Bokslutsdispositioner 
a) Förändring av avskrivningsdifferens 
b) Förändring av skattemässiga reserver 
c) Koncernbidrag 
13. Inkomstskatt 
14. Övriga direkta skatter 
15. RÄKENSKAPSPERIODENS VINST (FÖRLUST) 
BILAGA II 
SMÅFÖRETAGS RESULTATRÄKNING ENLIGT FUNKTION 
Sådan resultaträkning enligt funktion som avses ovan i 2 kap. 1 § 1 mom. ska upprättas som följer: 
1. OMSÄTTNING 
2. Kostnader för inköp och tillverkning 
3. Bruttobidrag 
4. Kostnader för försäljning och marknadsföring 
5. Administrationskostnader 
6. Övriga rörelseintäkter 
7. Övriga rörelsekostnader 
8. RÖRELSEVINST (-FÖRLUST) 
9. Finansiella intäkter och kostnader 
a) Intäkter från andelar i företag inom samma koncern 
b) Intäkter från andelar i ägarintresseföretag 
c) Intäkter från övriga placeringar bland bestående aktiva, separat intäkter från företag inom samma koncern 
d) Övriga ränteintäkter och finansiella intäkter, separat intäkter från företag inom samma koncern 
e) Nedskrivningar av placeringar bland bestående aktiva 
f) Nedskrivningar av finansiella värdepapper bland rörliga aktiva 
g) Räntekostnader och övriga finansiella kostnader, separat kostnader till företag inom samma koncern 
10. VINST (FÖRLUST) FÖRE BOKSLUTSDISPOSITIONER OCH SKATTER 
11. Bokslutsdispositioner 
a) Förändring av avskrivningsdifferens 
b) Förändring av skattemässiga reserver 
c) Koncernbidrag 
12. Inkomstskatt 
13. Övriga direkta skatter 
14. RÄKENSKAPSPERIODENS VINST (FÖRLUST) 
BILAGA III 
FASTIGHETSSCHEMA FÖR SMÅFÖRETAGS RESULTATRÄKNING 
1. Intäkter av fastighet 
a) Vederlag 
b) Hyror och arrenden 
c) Serviceintäkter 
d) Övriga intäkter av fastigheten 
2. Kreditförluster och korrektivposter 
3. Kostnader för fastighetens skötsel 
a) Personalkostnader 
b) Förvaltning 
c) Drift och underhåll 
d) Skötsel av gårdsområden 
e) Städning 
f) Värme 
g) Vatten och avloppsvatten 
h) El och gas 
i) Avfallshantering 
j) Skadeförsäkringar 
k) Hyror och arrenden 
l) Fastighetsskatt 
m) Reparationer 
n) Övriga skötselkostnader 
4. FASTIGHETSBIDRAG 
5. Avskrivningar och nedskrivningar 
a) Byggnader och konstruktioner 
b) Maskiner och inventarier 
c) Övriga utgifter med lång verkningstid 
6. Finansiella intäkter och kostnader 
a) Dividendintäkter 
b) Ränteintäkter 
c) Övriga finansiella intäkter 
d) Räntekostnader 
e) Övriga finansiella kostnader 
7. VINST (FÖRLUST) FÖRE BOKSLUTSDISPOSITIONER OCH SKATTER 
8. Bokslutsdispositioner 
a) Förändring av avskrivningsdifferens 
b) Förändring av skattemässiga reserver 
c) Koncernbidrag 
9. Direkta skatter 
10. RÄKENSKAPSPERIODENS VINST (FÖRLUST)/ÖVERSKOTT (UNDERSKOTT) 
BILAGA IV 
RESULTATRÄKNINGSSCHEMA FÖR ETT SMÅFÖRETAG SOM ÄR EN IDEELL SAMMANSLUTNING ELLER STIFTELSE  
Resultaträkningen för ideella sammanslutningar och stiftelser som avses ovan i 2 kap. 3 § ska upprättas som följer: 
Ordinarie verksamhet 
1. Intäkter 
2. Kostnader 
a) Personalkostnader 
b) Avskrivningar 
c) Övriga kostnader 
3. Överskott/underskott 
Tillförda medel 
4. Intäkter 
5. Kostnader 
6. Överskott/underskott 
Investerings- och finansieringsverksamhet 
7. Intäkter 
8. Kostnader 
9. Överskott/underskott 
10. Allmänna understöd 
11. Räkenskapsperiodens resultat 
12. Bokslutsdispositioner 
a) Förändring av avskrivningsdifferens 
b) Förändring av skattemässiga reserver 
c) Koncernbidrag 
13. Räkenskapsperiodens överskott (underskott) 
BILAGA V 
BALANSRÄKNINGSSCHEMA FÖR SMÅFÖRETAG 
Balansräkningen för småföretag som avses ovan i 2 kap. 4 § ska upprättas som följer: 
A k t i v a 
A BESTÅENDE AKTIVA 
I Immateriella tillgångar  
1. Utvecklingsutgifter 
2. Immateriella rättigheter 
3. Goodwill 
4. Övriga immateriella tillgångar 
5. Förskottsbetalningar 
II Materiella tillgångar 
1. Mark- och vattenområden, separat anskaffningsutgifter för arrenderättigheter som hänför sig till fastigheter och som har aktiverats enligt 5 kap. 11 § i bokföringslagen 
2. Byggnader och konstruktioner, separat anskaffningsutgifter för arrenderättigheter som hänför sig till fastigheter och som har aktiverats enligt 5 kap. 11 § i bokföringslagen 
3. Maskiner och inventarier 
4. Övriga materiella tillgångar 
5. Förskottsbetalningar och pågående nyanläggningar 
III Placeringar 
1. Andelar i företag inom samma koncern 
2. Fordringar hos företag inom samma koncern 
3. Andelar i ägarintresseföretag 
4. Fordringar hos ägarintresseföretag 
5. Övriga aktier och andelar 
6. Övriga fordringar 
B RÖRLIGA AKTIVA 
I Omsättningstillgångar 
1. Material och förnödenheter 
2. Varor under tillverkning 
3. Färdiga produkter/varor 
4. Övriga omsättningstillgångar 
5. Förskottsbetalningar 
II Fordringar, separat långfristiga 
1. Kundfordringar, separat långfristiga 
2. Fordringar hos företag inom samma koncern, separat långfristiga 
3. Fordringar hos ägarintresseföretag, separat långfristiga 
4. Lånefordringar, separat långfristiga 
5. Övriga fordringar, separat långfristiga 
6. Obetalda aktier/andelar, separat långfristiga 
7. Resultatregleringar, separat långfristiga 
III Finansiella värdepapper 
1. Andelar i företag inom samma koncern 
2. Övriga aktier eller andelar 
3. Övriga värdepapper 
IV Kassa och bank 
P a s s i v a 
A EGET KAPITAL 
I Aktie- eller andelskapital eller annat motsvarande kapital 
II Överkursfond 
III Uppskrivningsfond 
IV Övriga fonder 
1. Fond för inbetalt fritt eget kapital 
2. Reservfond 
3. Fonder enligt bolagsordningen eller stadgarna 
4. Fond för verkligt värde 
5. Övriga fonder 
V Balanserad vinst (förlust) från tidigare räkenskapsperioder 
VI Räkenskapsperiodens vinst (förlust) 
B ACKUMULERADE BOKSLUTSDISPOSITIONER 
1. Avskrivningsdifferens 
2. Skattemässiga reserver 
C AVSÄTTNINGAR 
1. Avsättningar för pensioner 
2. Skatteavsättningar 
3. Övriga avsättningar 
D FRÄMMANDE KAPITAL, separat långfristigt 
1. Masskuldebrevslån, separat långfristiga 
2. Lån mot konvertibla skuldebrev, separat långfristiga 
3. Skulder till kreditinstitut, separat långfristiga 
4. Återlåning från arbetspensionsförsäkringsanstalter, separat långfristig  
5. Erhållna förskott, separat långfristiga 
6. Leverantörsskulder, separat långfristiga 
7. Finansieringsväxlar, separat långfristiga 
8. Skulder till företag inom samma koncern, separat långfristiga 
9. Skulder till ägarintresseföretag, separat långfristiga 
10. Övriga skulder, separat långfristiga 
11. Resultatregleringar, separat långfristiga 
Senast publicerat 22.10.2015 16:18